current user: public

If you have questions about the server, please let us know.

Query: 3asa_A mol:protein length:400 LL-diaminopimelate aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390
# Score Template Links and tools%idFirst MKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQENAFFPEFPEDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYADGHFVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQLEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPALQSLast
1 -111.0003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model  100  1MKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQENAFFPEFPEDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYADGHFVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQLEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPALQS 394
2 -103.0003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  41  37VQRNENFGKLRAGYLFPEIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLATREGYSGYGAEQGQGALREAVASTFYGHARAADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDEYMVCNPDNHFFPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYANGEPVHADWNRVMTTCFNGASNIVQAGGLACLQPEGLNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFP--GKPSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFGSRENILEAVRRFKEAYGKRN 441
3 -101.0004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  40  38LVRNVNLEKLKNNYLFPEINRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAHGLSTVEGYRGYGLEQGNKTLRKAIAETFYRDLVKSNEVFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHVYMPCGPNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDG-SPRSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELLYSNGFPIINDFHRIVTTSFNGASNIAQAGGLACLSSGGLRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFK--GSKSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFGRRDHIVEASKRLQNFFNTRT 443
4 -101.0002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  40  24VSRNSNMSKLQAGYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDD-NPRSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLYSDGFPVAKDFNRIICTCFNGASNISQAGALACLTPEGLHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPN--QSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHRENILEACRRFKQLYK... 426
5 -94.1006DK6 Entity 1(prereleased)  ali follow..  38  3.LINENFLKLKAGYLFPEIARRAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDELGNRSTFKGYGPEQGYDFLRNAIADNDYKARIEADEIFISDGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEVYLKCTPENGFVPDI-PQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGREAQALHPLWSRRHSTKFNGASYIVQKGAEALYTDEGKKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPA-GLTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFNSRANVEEVCRRIAAL..... 410
6 -91.3002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  23  8ARRFARIDRLPPY---VFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDT----HGYSTSRGIPRLRRAISHWYRDRYDPESEAIVTIGSKEGLAHLLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRS-VPLVPGIDFFNELESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPEL--------VSALARIKSYHDYGTFTPLQVAAIAALEGDQQRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVWAKIPEAHLGSLEFAKKLLQDAKVSVSPGIGFGDYGDDHVRFALIENRDRLRQAVRGIKAMFRADG 399
7 -91.1001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  23  1MALSDRLELVSASEI-------RKLFDIAAGMKDVISLGIGEPDFDTPQHIKEYAKEALDK-----GLTHYGPNIGLLELREAIAEKLKKQNDPKTEIMVLLGANQAFLGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVE-VPTYEEDEFRLNVDVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWI--------IERMVKFQMYNATCPVTFIQYAAAKALKDERSEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRDTGLTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAYEKLEEAMDRMERVLKERK 387
8 -88.7002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  21  14HMISNKLANIPDSYF-----GKTMGRKIEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPEN----QKYGAFHGKEAFKQAIVDFYQRQYDKEDEVCILYGTKNGLVAVTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPL---LEPPHYLPDWSIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDA-KNPSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDM--------IQALKKYQTHTNAGMFGALQDAAIYALNHYDDEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPP-GYDSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLALDDQKLDEAAIRLTELAYLYE 398
9 -88.7001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  20  6IMVSRRISEIPIS---KTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQK-----GEVKYTDPRGIYELREGIAKRIGERYISPDQVVVTNGAKQALFAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNV-VETFMSKNFQPSLELVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTD-EFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKV--------ATAVSKIQSHTTSCINTVAQYAALKALEVDNS-YMVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRG---DDVKFCERLLEEKKVALVPGSAFL--KPGFVRLSFATSIERLTEALDRIEDFLNS.. 382
10 -87.8002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  24  2..LSKRLLNFESF---EVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKE-----GKTHYTDSRGILELREKISELYKDKYIIPDNIIITGGSSLGLFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVF-CDFTVES---LEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEG-KCYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEI--------IEAILKLQQNLFISAPTISQYAALKAFEKETENSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNIGE---DGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYANSYENIKEGLERIKEFLNK.. 370
11 -87.7001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  22  1MKLAARVESVSPS---MTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQ-----GKTRYGPAAGEPRLREAIAQKLQRDNYGADNILVTNGGKQSIFLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVI-LPTTVETQFKVSPEITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAAPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPL--------VKAATKIQGHSTSNVCTFAQYGAIAAYENSQDQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFPSIAKTGRSSLDFCSELLDQHQVATVPGAAFG--ADDCIRLSYATDLDTIKRGMERLEKFLHGI. 387
12 -87.4003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  24  3.LKNSSRSAVDPF---IVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLET-----DALGYTVALGLPALRQRIARLYGEWYLDPGRVVITPGSSGGFLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVD-LPTAPENRLQPVPAAGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKA----VTALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQ--------VRVVERIAQNMFICAPHASQVAALAALDCDAELQNLDVYKANRKLMLERLPKAFTRIAPPDGAFYVYADVSDLTDDSRAFAAEILEKAGVAVTPGLDFDPEGAGTLRFSYARATADIEEGLDRLEAFMQARG 383
13 -87.0004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  21  3MDLSKRFNKNLNK---IEVSMIRQFDQSISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDA-----DESHYTGMAGLLALRQAASAFVKEKYNPDNEILVTIGATEALSSLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEI---TRSNDFVLTPEMGEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEY--LPDQTILISGLSKSHAMTGWRLGLIFAPAVL--------TAQLIKSHQYLVTAATTSVQFAAIEALTNGKDLPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPVQGQDSFKFLQDFAKEKAVAFIPGVAFGKYGEGYLRISYAASMETIKEAMKRLKEFMEQYA 392
14 -87.0002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  21  1......MSRVPEPSVFLVVDEAKR--KARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTT----YGYCLKSCTLPFLEEAARWYEGRYDPRREALALIGSQEGLAHLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFL---IPLREDGLADLKVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGE-APSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEA--------LARLERVKGVIDFNQYAGVLRMGVEALKTPKERGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPE-GVDDLEFGLRLVER-GVALAPGRGFGPGGKGFVRIALVRPLEELLEAAKRIREALD... 376
15 -87.0005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  23  3.DRVALRAGVPPF---YVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHL-----NQLGYSVALGIPELRDAIAADYQRRHVEPDAVVITTGSSGGFLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVE-IPCGPQTRFQPTAQMDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCA--WQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVL--------RRAVDCLTGNFTICPPVLSQIAAVSAFTPEATDGNLASYAINRSLLLDGLRRIGDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTAGGSFVRISFAGPSGDIEEALRRIGSWLPS.. 387
16 -86.6001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  23  3.GLSRRVQAMKPS---ATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQ-----GKTKYAPPAGIPELREALAEKFRRENVTPEETIVTVGGSQALFLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVE-VETLPEEGFVPDPEITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEG-EHFSPGRV--APEHTLTVNGAAKAFAMTGWRIGYACGPKEV--------IKAMASVSSQSTTSPDTIAQWATLEALTNQEAEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLL-EAGVAVVPGTDFA--AFGHVRLSYATSEENLRKALERFARVLGR.. 384
17 -85.2003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  15  28YFTSNTAKDVWSL---TNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDI----PMVNQYSPTRGRPSLINSLIKLYSPIYLKAENVTVTTGANEGILCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYV-RNTRGEEWTIDFEQTSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNA-------ELLSYAAKAHTRICFASPSPLQEACANSINDALKEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSKVKIKDFRISHWLINELGVVAIPPTEFYKAAENLLRFAVCKDDAYLENAVERLKLLKDYL. 447
18 -83.8005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  26  70MSLSPRVQSLKPS---KTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIRE-----GFTRYTLNAGITELREAICRKLKEENYAPDQILVSNGAKQSLLAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVV-IPTKISNNFLLDPKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHTSFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHI--------VAACSKLQGQVSSGASSIAQKAGVAALGLGKVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFIDFSAYYNDSSSLALYFLDKFQVAMVPGDAFG--DDSCIRISYATSLDVLQAAVEKIRKALEPLR 470
19 -83.8002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  19  1MATVSRLRPYATTVF--------AEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAG-----GVNQYPPGPGSAPLRRAIAAQRRRHFDPETEVLVTVGATEAIAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDGRGFALDADATPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAEL--------IAGVRAAKQYLSYVGGAPFQPAVALALDTEDAAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRPLGYDSTEFCAALPEKVGVAAIPMSAFCDPAAGLVRFTFCKRDDTLDEAIRRLSVLAERPA 397
20 -83.2001xi9_A mol:protein length:406 putative transaminase  ali model follow..  22  4IRASKRALSVEYA----IRDVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKE-----GHNYYGDSEGLPELRKAIVEREKRKNITPDDVRVTAAVTEALQIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVE-YRTIEEEDWQPDIDITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEG-EHISPGSLTK-DVPVIVMNGLSKVYFATGWRLGYMYFVDPENKLS---EVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIFPKIEVPWKNDKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPPIEILEEAMDRFEKFMKERL 398
21 -83.1003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  15  7.KFKKLGTDNAPG---QEVRQSAAGLEALIRGARPVDFSHGDVDAPTPGAFDLFSAGVQSG-----GVQAYTEYRGDLGIRDLLAPRLAAFTDARDGLIITPGTQGALFAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVLDYVSADETRAGLDLTFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVAENVVTIMGPSKTESLSGYRLGVAFGSRAI--------IARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYR 406
22 -83.0004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  16  5.LQARRLDGIDYNPW--------VEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFML---NQYTKTFGYPPLTKILASFFGELLDPLRNVLVTVGGYGALFAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFV-ELGSSSNWQLDPMETSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHI--------MKHLRTVHQNSVFHCPTQSQAAVAESFEREQLVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRYDRRFVKWMIKNKGLVAIPVSIFYSVFDHYIRFCFVKDEATLQAMDEKLRKWKVELE 423
23 -83.0004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  19  24IEKSSKLENVCYD---IRGPVLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTA------QGYCDSKGLYSARKAIMQHYQARGVTVEDIYIGNGVSELIVAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVH-YLCDESSDWFPDLDITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPL-APDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKG---YIEGLEMLASMRLCANVPAQHAIQTALGGYQSITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFPKIDAKRFDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYH 423
24 -82.7001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  23  6LIPQSKLPQLGTTIF--------TQMSALAQQHQAINLSQGFPDFDGPRYLQERLAHHVAQ-----GANQYAPMTGVQALREAIAQKTERLYDADSDITVTAGATEALYAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRM---LQPPHFRVDWQESERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPI--------SAEIRKVHQYLTFSVNTPAQLALADMLRAEPELALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAVTLDDVEFCQWLTQEHGVAAIPLSVFCPFPHKLIRLCFAKKESTLLAAAERLRQL..... 386
25 -82.3003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  22  9..................FERLRALLKEITPKKRGLDLGIGEPQFETPKFIQDALKNHTH------SLNIYPKSAFEESLRAAQRGFFKRRFLKENELISTLGSREVLFNFPSFVYQNPTIAYPNPFYQIYEGAAKFIKAKSLL-MPLTKENDFTPSLNELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENT-PPPSLLEANEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRL--------LEKYKAFRAYLGYTSANAIQKASEAAWLDDRHAEFRNIYANNLKLARKIFKN----TLIYPYSFYVYLPVQ----NGENFAKTLYQNEGIITLPALYLGRNGADYVRLALVYDTPLLEKPLEIIETYRENHA 376
26 -81.7001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  17  13FDLPKRYQGSTKSVW--------VEYIQLAAQYKPLNLGQGFPDYHAPKYALNALAAAANSPD--PLANQYTRGFGHPRLVQALSKLYSQTINPMTEVLVTVGAYEALYTIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRF-IPLKPNADWVLDNNENEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEAL--------LKNLQMVHQNCVYTCATPIQEAIAVGFETELKNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSLARKDYRFTKWMTKSVGLQGIPPSAFYSEGEDFVRYCFFKKDENLQKAAEILRKWKGS.. 428
27 -81.0001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  24  1MRLHPRTEAAKESIF--------PRMSGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALG------RQDQYAPPAGLPALREALAEEFA---VEPESVVVTSGATEALYLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDLTPEGFRLDLSATPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPRRLR---EFAPERTFTVGSAGKRLEATGYRVGWIVGPKEF--------MPRLAGMRQWTSFSAPTPLQAGVAEALKLARREALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPG------WDAFRLVEEARVALIPASAFYDPPKDLFRFAFCKTEEELHLALERLGRVVNSPR 372
28 -80.3001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  18  1MSSWDVSMSNHAGLVFNPIRTVSDNAKPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSFIVKDNVVLCSGGSHGILAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHF-YNCRPENDWEADLDKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPTSVADFET-TVPRVILGGTAKNLVVPGWRLGWLLYVDPHGNGPS--FLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMSRIDLEKKTDVEFFEKLLEEENVQVLPGTIFH--APGFTRLTTTRPVEVYREAVERIKAFCQRHA 414
29 -80.3003jtx_A mol:protein length:396 aminotransferase  ali model follow..  22  1.GMNTLLKQL-KPYPFARLHEAMQGIS-APEGMEAVPLHIGEPKHPTPKVITDALTASLHEL------EKYPLTAGLPELRQACANWLKRRYDADNEILPVLGSREALFSFQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFA---CPAPSFNPDWRVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAEL--------LKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHIDNRRLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVPD--GDDLAFARNLWQKAAIQVLPGRFLGNPGEGYVRIALVADVATCVKAAEDIVSLYR... 396
30 -80.1002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  17  9.VFSDRVLLTEES---PIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYEN------KPEVVYYSHSAGIWELREAFASYYKRRQVKPENVLVTNGGSEAILSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLI-PVTRRMEEGFAIESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRG-EFASALSIES--DKVVVIDSVSKKFSACGARVGCLITRNEE--------LISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSDFVRETYRERVETVLKKLEEHLKRFTKPSGAFYITAELP--VEDAEEFARWMLTDFNTMVAPLRGFYLTGKKEIRIACVLEKDLLSRAIDVLMEGLKMFC 397
31 -79.9005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  20  1.ANAKRIEGLDSNVW--------VEFTKLAADPSVVNLGQGFPDISPPSYVKEELSKAAFI----DNMNQYTRGFGHPALVKALSCLYGKIYDPNEEILVAVGAYGSLFSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVF-IPLRSKSDWTFDPRESSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHL--------IKHLQTVQQNSFYTCATPLQAALAEAFWIDIKNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGAYDYKFVKWMTKHKKLTAIPVSAFCDSFEKLVRFCFIKKDSTLDAAEEIFRAW..... 410
32 -78.5003ele_A mol:protein length:398 Amino Transferase  ali model follow..  20  2MVVNESMYQLSVRSAIRELFEYGKKRAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDYDS-VALHGYTSAQGDVETRAAIAEFLNNTHFNADNLYMTMGAAASLSICFRALDAYDEFITIAPYFPEYKVFVNAAGARLVEV---ADTEHFQIDFDINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFV---TKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAE-LYAAVCGAGRALGYVCAPSLFQKMIVKCQGAT---GDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVKAL--EDDSNAFCEKAKEE-DVLIVAADGFG--CPGWVRISYCVDREMIKHSMPAFEKIYKKYN 397
33 -78.0003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  18  14KQNELHIKDLGMASIRDLVALVTNLE--KATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVA----SIYPNLDGLPELKQEASRFAKLFVIPARACVPTVGSMQGCFVSFLVANREYGTLFIDPGFNLNKLQCRILGQKFE-SFDLFEYRGEKLREKQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDEPLYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLEESFGRALYALSSGATHSAQWGMAAMLKACNDRDSVIEYGRKARIMKKMFLDNGFDGNEPLADGFYFT-VGYKGMDSSKLIEKFVRYGMCAITLKT-TGSKRNEAMRICTSLLPESFPDLEKRLQMLNAE.. 436
34 -76.8004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  17  36.......SSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSGK----FNGYPPTVGADNLRQVVSTYWRRFCLKWENVIITSGVSQAIVALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRY-YYLDPSKSWECDLRVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDT-NVPRLILGGTAKYQVCPGWRVGWSILIDPMNVAGD---WAVGMERLTQLIAGVNSICQEAIARTLLKCPTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMLKLNLSYFSDMEFYEKLLDEENVQVLPGEIFG--MSGFLRATVSRPSAVLNEAVDRIIEFCERHK 437
35 -75.6003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  21  21..RPSDMAKKTFN---PIRAIVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDALDSGK----YNGYAPSIGFLSSREEIASYYHCPELEAKDVILTSGCSQAIDCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKL-YNLLPEKSWEIDLKIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATL-STDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNE--IRDGLVKLSQRILGPCTIVQGALKSILCRTPGHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMVGIEMEHFNDVEFTERLVAEQSVHCLPATCFE--YPNFIRVVITVPEVMMLEACSRIQEFCEQHY 419
36 -75.2003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  22  4..RPSDMSNKTFN---PIRAIVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDALDSGK----YNGYAPSIGYLSSREEVASYYHCPELEAKDVILTSGCSQAIECLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKL-YNLLPEKSWEIDLKIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATL-STNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNE--IRDGLVKLSQRILGPCTIVQGALKSILQRTPQQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMVGIEMEHFNDVEFTERLIAEQSVHCLPATCFE--YPNFFRVVITVPEVMMLEACSRIQEFCEQ.. 400
37 -71.3004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  15  14HMSSLRPRREDPPVLEEWYRR-----HLGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVVM-----DDSVSQGGEGVRRAIADRYAG--GDADRVLVTHGSSEAIATLNALLHRGDRVVVQEGIYHSLGHYPRAAGCD-VAVLPGRAVRDGEIDPDVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADP---GADGGDTVSYGTLSKTFGLPGLRVGWAVAPKEL--------LTATFPLRDRTTLFLSPLVELVAERAVRHADEGARAAEARHNLAHLTGWMAAHEVRWTPPEGGVCALPVFRELPQEVERFCLELLERHRTLLVPGTAFG--APHGARLGFGGPQEDFRAGLDGLSRFLRERA 397
38 -70.6003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  20  2.......MKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQGTKL-----NYGWIEGSPAFKKSVSQLYTG--VKPEQILQTNGATGANLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAE-VDLWQIEEENGWLPDLEIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSEL-----DVPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQV--------TDILRDYRDYTMICAGVFDDLVAQLALAHYQEERNRHILEENLAILDQWIEEELVSYIRPAVVSTSFVKI-AVDMPMEDFCLQLLQEHGVLLVPGNRFE--RDGYVRLGFACEQETLIKGLEKLSQFLRRFD 372
39 -69.9006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  10  14.HMHPQATPAPGA---PLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEA------EEGLQATYEKRFTEAFFQLHRQPTLVKNKTMLSYAASISTVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLY---PIDESVFYDVDLERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMLENSGVRYLAIEDTGKTWPVQDAKCALITASDDI--------WETVYNLHTSVLLNVSPFVLNMLTQYVRDSAAASVREVLTRNRECARKTLDGSILEYQEPVVKSVAWFRVDHPELTA-TDVHRLLSADGVYVLPGRYFPSKGDAYVRMALAREPEMFADAMALTRQVLDRHG 406
40 -69.3003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  14  74MAGYINTDGIRERL---FAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVAN-------NYPVPDRCLVNTEKIINYFLQELSAEQTDLFPTEGGTAAIVYAFHLLKKGDKIAINEPIFTPYLRIPELKDYELVVDLHSYEKNDWEIEPNKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSVV-----PYNTMLVYSYSKLFGCTGWRLGVIALNEKN--------VFDDNIAHLDKVELRQLHKRYSSVVLDDSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLIDIYRLNFEQVDFLLKLAEKNGVVLVDGVGFG-AKPGELRVSQANLPTEYALIGKQVLELLKEYY 526
41 -69.1003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  16  76.......................REVLALCDHPDLLQREEIKTLFSAISRAKQILAMIPGR-----ATGAYSHSQGIHGLRDAIASGIASRDANADDIFLTDGASPGVHLMMQLLNEKDGILVPIPQYPLYSASIALHGGALV-PYYLNESTGWGLETSDVINVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKFHSFKKIEEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQASVNLCSNITGQILASLVMNPPKASDESYASYKAEGILASLARRAKALEHAFNKLGITCNEAEGAMYVFPQICANKAPDAFYALRLLESTGIVVVPGSGFGQPGTWHFRCTILPQEDKIPAVISRFTVFHEAF. 484
42 -68.9003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  17  54.KPFTEVIRANIG---DAQAMGQQPITFLRQVMALCTYLLDSPSFPEDAKKR---ARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDADPDNIYLTTGASDGISTLKILVSGGGKVMIPIPQYPLYSAVISELDAIQV-NYYLDEENCWALNVNELRDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRYEMGPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLV-------KLLSVRLCPPVSGQAAMDIVVNPPVESVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFPRIFHQMAPDMFYCMKLLEETGICVVPGSGFGREGTYHFRMTILPPVEKLKTVLQKVKDFHINF. 487
43 -67.1005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  13  6......................QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELPVLAESEQRPVQQIESEAHQAYFTLLGQHGYEPGRVLSCYSSSVSMILARSLSASVDRVALVHPTFDNIADLLRGNGLDLV-PVEEDALHGADLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAH-YDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDI--------GLPVEKIYSDILLGVSPLILALIREFSRDAADADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVE-RVAFAGRTGTEVWE-ELQRHHVFALPCRQFHSDGDHMVRIALSRSTEPLEKSVQVLRTVLETR. 376
44 -67.0001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  16  4..LSRNATFNSHGQDSSYFEYEKNPYHEVHNTNGIIQMGLAENAKNPEAAAFKKNGESIFA-----ELALFQDYHGLPAFKKAMVDFMAEIRFDPNHLVLTAGATSANETFICLADPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNGFQITETRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKM-------SFGLVSSQTQHLLSAMLSDKKLTKNAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERLDLAMQRLKAFVGEYY 433
45 -66.8002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  17  87...............FERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-------GCNYPVPPRMLNISEKIVRQYIIREMSESVNLFAVEGGTAAMAKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEVAINADPSLNWQYPDSEDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAIC-----PENTLLVYSFSKYFGATGWRLGVVAAHQQN--------VFDLALDKLQESEKVALDHRYRSLLPDVRSLKKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDKQSSTGDMLFRIADETGIVLLPGRGFG-SNRPSGRASLANLNEYEYAAIGRALRKMAD.. 520
46 -66.5002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  17  86...............FERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILG--------CNYPVPPRMLTVSEQIVRQYIVREPESVDLFAVEGGTAAMARISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKVPIHADPDNGWQYSDAEDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSV-----CPRNTLLVYSFSKYFGATGWRLGVIAAHKDN--------------VFDHALSQLPESAKKALDHRYRSPDVRSLKFIDRLVADSRVVALNHTGLSTPQQVQNYYTLIDLQNVQSSTGDMLFRVADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRALRRLAD.. 519
47 -66.3003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  17  87...............FERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-------GCNYPVPPRMLNISEKIVRQYIIREMSESVNLFAVEGGTAAMAKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEVAINADPALNWQYPDSEDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSL-----FAICPANTLLVYSFSKYFGATGWRLGVVAAHKEN--------IFDLALGRLPESEKTALDDRYRSLLPDVRSLKKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLIDLQDKQSSTGDMLFRIADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRLRQMADELY 523
48 -65.5001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  16  2..LSKLATNEEHGENSPYFDYDSDPFHPLKNPNGVIQMGLAENQLNPKGSICSEGIKSFK------AIANFQDYHGLPEFRKAIAKFMEKTRFDPERVVMAGGATGANETIICLADPGDAFLVPSPYYPAFNRDLRWRTGVQLIPIHCESSNNFKITSKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILDEKDLVHIVYSLSKDMGLPGFRVGIIYSFND-------DVVNCARKMSSGLVSTQTQYFLAAMLSDEKFVDNRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLRPTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGVDIALARIRRFVGVEK 428
49 -64.8003if2_A mol:protein length:444 Aminotransferase  ali model follow..  17  2MKFSKFGQKFTQPTGISQL--MDDLGDALKSDQPVNMLGGGNPAKIDAKALGNDNDTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRHYLTSENIALTNGSQNAFFYLFNLFVDKSILLPLTPEYIGYSDVHVEGQHFAAVLVTHDGEEGFFKPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYSDAHLNWD---NNTILCFSLSK-IGLPGMRTGIIVADAKV--------IEAVSAMNAVVNLAPTRFGAAIATPLVANDRDNEIKPFYQKQATLAVKLLKQAPLMIHKPEGAIFLWLWFKDLPISTLDLYERLKAK-GTLIVPSEYFFPGAHECIRMSIAADEQTLIDGIKVIGEVVREL. 440
50 -64.4003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  15  2MTFSLFGDKFTRH---SGITRLMEDLNDGLRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKAADALCNYDGPQGKTALLNALAVLLRETLIEPQNIALTNGSQSAFFYLFNLFADGSTKKVLFPLAPEYIGYADSGLEDDLFVIELLPEGQFKYHVDIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVP-FPGIIFSEARPL--WNPNIILCMSLSK-LGLPGSRCGIIIANDKT--------ITAIANMNGIISLAPGGMGPAMMCEMIKRNDETVIKPFYYQRVQQTIAIIRRYRCLIHKPEGAIFLWLWFKDL-PITTELLYQRLKARGVLMVPGHYFFPHTHQCMRMNYVPEPDKIEAGVKILAEEIERA. 413
51 -59.6002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  13  8QSLNEQLQQSNATAFAMLSDLGQNMSQSAEAKSTTYNATIGMATNKDGKMFASSLDAMFNDL-TPDEIFPYAPPQGIEELRDLWQQKMLRDNPEMSRPIVTNALTHGLLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHY---SYNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSLFNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGTS-DQTTKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHD--VDPEALRKHLIDKYSIGVIALNATD------IRIAFSCEKDDIPHVFDSIAKAIDDLR 430
52 -58.0003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  16  9...................KPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGC--DLMSYFSDMTEPELEDAIKDLHGVVGTEDRYIVVGTGSTQLCAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKW-------EGDAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHY--------TPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKE-------VAKKMVEYIIVNSIGVSKESQVRTAKILNVLKEKYGREMMKNRWEKLREVVKESDFTLPKYPEAFCNYPAFAWLGTKEETDLVSELRRHKVMSRAGERCGS-DKKHVRVSMLSREDVFNVFLERLANMKLIKS 388
53 -56.1001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  15  51...........................SEKIQGCSADVASGDGLFLEEYWKQHKEASAVLSPWHRMSYFFNPVSNFIFELEKTIKELHEVVGAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYT--------PIKYKADEDILLFTMSKFTGHSGSRFGWALIKDE-------SVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVATFGFKKLRERWVNITALLDQSDFSYQELPQSEYCNYFRRKCEWEEDKDCYQTFQNGRINTQNGVGFE-ASSRYVRLSLIKTQDDFDQLMYYLKDMVKAKR 426
54 -55.5003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  15  7VAAKHAKGKKLKDVIFV-TAGQAQADAKENGRENVVNGTLGEGNLVFLKTVKEEYLSLSDS-----EHVGYAPIAGIPDFLCAAEKECFGNFRPEGRSIATAGGTGGIHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLFDEHNNFVNELAAKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADE-FFEVNKSTSRATWSNICRPAMRTMANIVADPAKFKYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTD----SANAICEELKKEHIYVIALANGIRIAACGIPKCQMTGLAEKIYNAMKSLGKL..... 418
55 -54.7004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  16  6MTIKRATWNNGPDLAFDINNKANAAIE-KYGREAVINAALGTLLDDKGKIIALPSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKPEGSAIATPGGTGAIRAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDFAFIDEGIRDSDRIASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGISS-----SKEIIEEFEASLAHSARCNWSNGTHAAQNILIEQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPT-----DKAFDIVKDLEKENIFTIPSAKGI-------RVAICGGEEKIPKLVQRLAFYTNKK. 413
56 -52.7004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  17  1MAMFEHIDAYPGDPILTLNENFQKD-----PRDQKVNLSIGIYDAEGRIPVMGAVREAETALQRDSGPKPYLPMVGLAAYRDAVQSLVFGADRAAGRIATLSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFT-VNTYPYYDEATGGLKFDLPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDAAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAER-VLGQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKEEELSAMCRRIARMRQSIHGLRDHVSGEALTRYVKMFTYTGLTESQVDALREVHGVYILRSGRMCVAG---------LNDSNVGIVADAIGKVLKSGA 402
57 -52.7003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  3....ENITAAPADPILGLADLFRAD-----ERPGKINLGQGVYKDETGKTVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVR-EYAYYDAENHTLDFDAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDR-AFSQMKAAIYANYSNPPAHGASVVATILSNDELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQN---MFSFSGLTKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL.... 396
58 -51.8002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  12  3....ENITTAPADPILGLADLLR-----ADERPGKIDLGMGVYDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLE-VREYAYYDAENHTLDFDAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDR-AFSQMKAAIRVNYSSPPAHGASVVATILSNDELTDMRQRIQRMRQLFVNTLQEKG-----ANRDFS-QNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL.... 396
59 -50.9001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  13  3....ENITATTADPILGLADLFR-----ADERPGKIDLGIGYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLE-VREYAYYDAENHTLDFDAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFALYNERVGACTLVAADSETVDR-AFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMFSLTKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL.... 396
60 -50.6004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  13  3VGTFENITAAPADPILGLADLFRAD-----ERPGKINLGIGVKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGINDKRARPGGTGALRVAAFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLE-VREYAYYDAENHTLDFDAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDR-AFSQMKAAIRANYSNPPAHGASVVATILSNDELTDMRQRIQRMRQLFVNTLQEKG-RDFSFIIKQNGMFSFSGL---TKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL.... 400
61 -50.5005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  13  2.SWWTHVEMGPPDPILGVTEAFKRD-----TNSKKMNLGVGAYRDDNGKPVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENFVTVQTISGTGALRIGASLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQ-LQGYRYYDPKTCGFDFTIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKR-VESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKLQEVKGMADRIIGMRTQLVNLKKEGSTHNWQHITDQIGMFC-KPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLA--HAIHQVTK.......... 401
62 -50.4003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  13  2.SWWTHVEMGPPDPILGVTEAFKRD-----TNSKKMNLGVGAYRDDNGKPVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENFVTVQTISGTGALRVGASLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQ-LQGYRYYDPKTCGFDFSIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKR-VESQLKILIRPLYSNPPLNGARIAATILTSPDLRKLQEVKGMADRIISMRTQLVNLKKEGSSHNWQHITDQIGMFCLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLA--HAIHQVTK.......... 401
63 -50.2001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  14  3....ENITAAPADPILGLADLFRAD-----ERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLENETTKLYLGIDGIPEFGRCTQELLFGKGINDKRARTASGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLE-VREYAYYDAENHTLDFDAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDR-AFSQMKAAIRANYSSPPAHGASVVATILSNDALRAEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL........... 396
64 -50.1001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  14  3....GNLKPQAPDKILALMGEFRAD-----PRQGKIDLGVGVYDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQT-YRYFDAETRGVDFEAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATREL-AQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRAMAELEAVRSGMLRLREQLAELRDLSGSDRFGFVAEHRGMFSATPEQVKRIKEEFGIYMVGDS----------RINIAGNDNTIPILARAIIEVG.... 393
65 -49.9002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  13  1..MFENITTAPADPILGLADLLR-----ADERPGKIDLGMGVYNDETGKTVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLE-VREYAYYDAENHTLDFDAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDR-AFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFTIKQNGMGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLC--EAIVAVL........... 396
66 -49.9004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  15  16MSLFSAVELAPRDPILGLNEAFN-----ADTRPTKVNLGVGVYTNEDGKILLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDVVTAQALGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFE-VVAYPYYDAKTNGVNFDYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAAR-VLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRAVQELGEMRDRIRAMRNGLVRLKAAGIERDFSFINAQRGMFSYTSAQVDRLREEFGIYAVSTG----------RICVAANTRNLDVVANAIAAVLK... 414
67 -49.7003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  19  1............GMQFPSIEDLRARNTMKRYGQGVLPLWVAESDFSTCPAVLQAITDAVQR-----EAFGYQPDG--SLLSQATAEFYADRYARPEWIFPIPDVVRGLIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDATGGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQHTVAAGVSDTAASVCITITAPSKAWNIAGLKCAQIIFSNPSDA-------EHWQQLSPVIKDGASTLGLIAAEAAYRYGTDNQEVAYLKNNHDFLLHEIPK-GAKITPMQATYLMWIDFRDTTIEG-SPSEFFIEKAKVAMNDGAWFGEDGTGFCRLNFATSREVLEEAIDRMAKAVSHHT 377
68 -49.4003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  15  2......FQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLGIIPQLQAVAEAEARLNAQPH-----GASLYLPMEGLNCYRHAIAPLLFGADLKQQRVIQTLGGSGALADFLKRYFPESGVWVSDPTWENHVAIFAGAGFE-VSTYPWYDEATNGVRFNLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGR-VLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKALKEVEEMRTRILAMRQELVVLSTEMPERNFDYLLNQRGMTGLSAAQVDRLREEFGVYLIASG----------RMCVAGNTANVQRVAKAFAAVM.... 397
69 -48.5003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  13  5................LVFKLTADFREDPDPRKVNLGVGACHPWVLPVVKKVEQKIANDNS-----LNHEYLPILGLAEFRSCASRLALGDDQSLGGTGALRIGADFLARYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQ-VLSQMEKIVRITWSNPPAQGARIVASTLSNPELFETGNVKTMADRILTMRSELRRLEALKTPGTWNHITDQIGMFS-NPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSTKIAENLYFQSDYKDDDD 415
70 -48.0003t32_A mol:protein length:383 Aminotransferase, class I/II  ali model follow..  17  22..............................KNEELIHAWIADMDFEVPQPIQTALKKRIEH-----PIFGYTLPP--ENIGDIICNWTKKQYIQKEWIVFSAGIVPALTSIQAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVSPLQKQNDTYAIDFEFQQGVKLMLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASLEELAARTITCMAPSKTFNIAGLQASIIIIPNEKLRQ------AFTSIQYRQGFHGLNIFAYTAMQSAYTECNDNEIRFYIEDNAKFACEYIKD-TLSVMKPEGSFLLWIDCSALNLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGCPRSVLEEILNRLRHTFS... 383
71 -48.0004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  15  8AQTQGPGSMGKPDPILGLGQDFR-----MDPAKRKVNLSIGVYDDADQPFVLECVKQATLG-----TNMDYAPVTGIASFVEEAQKLLRDGRIASCQTLGGTGALRIGGDLNRFVANCNRIYGPDVGYPNHESIFAKAGME-LTPYSYYDPATKGLNLAAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAPRHLVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKR-LVSQLALLIRPMYNNPPLYGAWVVSSILKDPQLTAKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGMMA-TREQVELLRSEYHIYMTLNGRAAVSGLNSTNVEYVS--QAIHNVTK.......... 403
72 -47.8004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  15  18............................MDPAKRKVNLSIGVYDDADQPFVLECVKQATLG-----TNMDYAPVTGIASFVEEAQKLCFGPTIASCQTLGGTGALRIGGDLNRFVANCNRIYGPDVGYPNHESIFAKAGME-LTPYSYYDPATKGLNLAAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQYDAFVPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKR-LVSQLALLIRPMYSNPPLYGAWVVSSILKDPQLTAKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGMTGLTREQVELLRSEYHIYMTLNG----------RAAVSGNSTNVEYVSQAIHNVTK... 390
73 -47.6003dzz_A mol:protein length:391 putative pyridoxal 5`-phosphate-dependent C-S lyase  ali model follow..  14  13..................PKRQGNSIKWGVLKEKELPMWIAEMDFKIAPEIMASMEEKLKV-----AAFGYESVP--AEYYKAVADWEEIEHPKEDWCVFASGVVPAIAMVRQFTSPGDQILVQEPVYNMFYSVIEGNGRRVISSDLIYENSKYSVNWAATPSVRMMVFCNPHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLVLTDEDITPAFTVWDAKNWVVSLISPSKTFNLAALHAACAIIPNPDLRA------RAEESFFLAGIGEPNLLAIPAAIAAYEEGHDRELKQVLRDNFAYAREFLAK-EVKVLDSNASYLAWVDISALGMNAEDFCKYLREKTGLIISAGNGYRGNGHEFVRINLACPKELVIDGMQRLKQGVLNLN 390
74 -47.6001d2f_A mol:protein length:390 MALY PROTEIN  ali model follow..  16  27...............................TADLLPFTISDMDFATAPCIIEALNQRLMH-----GVFGYSRWKN-DEFLAAIAHWFSTQHIDSQTVVYGPSVIYMVELIRQWSETGEGVVIHTPAYDAFYKAIEGNQRTVMPVALEKQADGWFCDMGAKPECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMVWGEQPHIPWSNVA--RGDWALLTSGSKSFNIPALTGAYGIIENSSSRDAYLSALKGRDGLSS-----PSVLALTAHIAAYQQGAPDALRIYLKDNLTYIADKMNA-ELNWQIPQSTYLAWLDLRPLNIDDNALQKALIEQEKVAIMPGYTYGEEGRGFVRLNAGCPRSKLEKGVAGLINAIRAVR 390
75 -47.6003b1c_A mol:protein length:392 BetaC-S lyase  ali model follow..  16  7............KYNFQTAPNRLSHHTYKETDPQLLPAWIADMDFEVMPEVKQAIHDYAEQ-----LVYGYTYAS--DELLQAVLDWEKSEHFDKEDIVFVEGVVPAIIAIQAFTKEGEAVLINSPVYPPFARSVRLNNRKLVSNSLKEENGLFQIDFEVENDVKLYLLCNPHNPGGRVWEREVLEQIGHLCQKHHVILVSDEIHQDLTLFGHEHVSFNTVPDFKDFALVLSSATKTFNIAGTKNSYAIIENPTLCA------QFKHQQLVNNHHEVSSLGYIATETAYRYGKPVALKAVLEENIQFAVEYFAQ-RLKVMKPQGTYLIWLDFSDYGLTDDALFTLLHDQAKVILNRGSDYGSEGELHARLNIAAPKSLVEEICKRIVCCLPK.. 392

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24