current user: public

If you have questions about the server, please let us know.

Query: 3bwn_A mol:protein length:391 L-tryptophan aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390
# Score Template Links and tools%idFirst MVKLENSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMSYFSDMTNLCWFLEPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGPYIELVTSPNNPDGTIRETVVNRPDDDEAKVIHDFAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSELRRHKVMSRAGERCGSDKKHVRVSMLSREDVFNVFLERLANMKLIKSIDLLast
1 -106.0003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model  100  1MVKLENSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMSYFSDMTNLCWFLEPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSQPVSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFDKKGPYIELVTSPNNPDGTIRETVVNRPDDDEAKVIHDFAYYWPHYTPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAWLGTKEETDLVSELRRHKVMSRAGERCGSDKKHVRVSMLSREDVFNVFLERLANMKLIKSIDL 391
2 -77.8001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  34  40.....ECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFFNPV--SNFISFELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANVSNPEQYIEMVTSPNNPEGLLRHAVIK-----GCKSIYDMVYYWPHYTPIKYKADEDILLFTMSKFTGHSGSRFGWALIKDESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKTQKGTRDLNTFGFKKLRERWVNITALLDQSDRFSYQELPQSYCNYFRRMRPPSPSYAWVKCEEDKDCYQTFQNGRINTQNGVGFEASSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRKT. 428
3 -66.8003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  16  11.VDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLET---DALGYTVALGL------PALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDR----VGIGAPGYPSYRQILRALGLVPVDLPTVPADFAGLDLAGLMVASPANPTGTMMGALIEAAQAQGASFISDEIYHGIEYETALELTDECYVINSFSKYFSMTGWRVGWMVVPED-QVRVVERIAQNMFICAPHASQVAALAALDCDAE-----------LQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVY--------ADVSDLTDDSRAFAAEILEKAGVAVTPGLDFDPGAGTLRFSYARATADIEEGLDRLEAFMQARGEG. 385
4 -66.6002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  16  9.FESFEVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKE---GKTHYTDSRGI------LELREKISELYKDKYKADIIPDNIIITGGSSLGLFFALSSIIDDGDE----VLIQNPCYPCYKNFIRFLGAKPVFCDFSLEEALSDKTKAIIINSPSNPLGEVIREIYEFAYENIPYIISDEIYNGLVYIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDE-IIEAILKLQQNLFISAPTISQYAALKAFEK---------ETEREINSMIKEFDRRRRLVLKYVKDFG-WEVNNPIGAYYVFPN-----------IGEDGREFAYKLLKEKFVALTPGIGFGSGKNYIRISYANSYENIKEGLERIKEFLNK..... 370
5 -65.1003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  13  37.VWSLTNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDIPM--VNQYSPTRGR------PSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDE----VIVFEPFFDQYIPNIELCGGKVVYVPIQFEKAITSKTKAVIINTPHNPIGKVLTTLGNICVKHNVVIISDEVYEHLYFTDSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNAELLSYAAKAHTRICFASPSPLQEACANSINDALK--------IGYFEKMRQEYINKFKIFTSIFDELG-LPYTAPEGTYFVLVDPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIAENLLRFAVCKDDAYLENAVERLKLLKDYL.... 447
6 -64.9005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  16  11.VPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHL---NQLGYSVALGI------PELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDR----VAMASPGYPCYRNILSALGCEVVEIPCQMLAEIDPPLRGVVVASPANPTGTVLAAIASWCDASDVRLISDEVYHGLVYQGAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTV-LRRAVDCLTGNFTICPPVLSQIAAVSAFTP---------EATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVY--------ADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTGGSFVRISFAGPSGDIEEALRRIGSWLPSQ.... 388
7 -63.7001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  18  15.IPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQK---GEVKYTDPRGI------YELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDE----VIVFSPVWVSYIPQIILAGGTVNVVETEVEGLLVGKTKAVLINSPNNPTGVVLEGLVRLAKKRNFYIISDEVYDSLVYLDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEK-VATAVSKIQSHTTSCINTVAQYAALKALEVDNS-------------YMVQTFKERKNFVVERLKKMG-VKFVEPEGAFYLFFK-----------VRGDDVKFCERLLEEKKVALVPGSAFL-KPGFVRLSFATSIERLTEALDRIEDFLNSR.... 383
8 -63.5001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  17  11.MKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQ---GKTKYAPPAGI------PELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDE----VIVLSPYWVSYPEMVRFAGGVVVEVETRVRRAITPRTKALVVNSPNNPTGAVLEALARLAVEHDFYLVSDEIYEHLLYEGGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKE-VIKAMASVSSQSTTSPDTIAQWATLEALTNQEAS-------RAFVEMAREAYRRRRDLLLEGLTALG-LKAVRPSGAFYVLMDTSP----------APDEVRAAERLLEAGVAVVPGTDFAA-FGHVRLSYATSEENLRKALERFARVLGR..... 384
9 -63.2001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  16  7.LELVSASEIRKLFDIAA-GMKDVISLGIGEPDFDTPQHIKEYAKEALDK---GLTHYGPNIGL------LELREAIAEKLKKQNGIEADPKEIMVLLGANQAFLMGLSAFLKDGEE----VLIPTPAFVSYAPAVILAGGKPVEVPTELKKYVTDKTRALIINSPCNPTGAVLEEIADFVVEHDLIVISDEVYEHFIYASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSW-IIERMVKFQMYNATCPVTFIQYAAAKALKD--------ERSWKAVEEMRKEYDRRRKLVWKRLNEMG-LPTVKPKGAFYIF--------PRIRDTGLTSKKFSELMLKEARVAVVPGSAFGKGEGYVRISYATAYEKLEEAMDRMERVLKERK... 387
10 -62.8001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  14  10.VSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQ---GKTRYGPAAGE------PRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDE----VIIPAPFWVSYPEMVKLAEGTPVILPTQIRQAITPKTKLLVFNTPSNPTGMVVRAIAQVAVEAGLWVLSDEIYEKILYDD-PEAYERSVVCSGFAKTYAMTGWRVGFLAGPVP-LVKAATKIQGHSTSNVCTFAQYGAIAAYE----------NSQDCVQEMLAAFAERRRYMLDALNAMPGLECPKPDGAFYMF--------PSIAKTGRSSLDFCSELLDQHQVATVPGAAFGA-DDCIRLSYATDLDTIKRGMERLEKFLHGI.... 387
11 -62.8002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  13  17.TEESPIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYEN----KPEVVYYSHSAG------IWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDE----ILVLEPFYANYNAFAKIAGVKLIPVTRNLESFINERTKGIVLSNPCNPTGVVMRYLVEIAERHGLFLIVDEVYSEIVFRGLSIESDKVVVIDSVSKKFSACGARVGCLITRNEELIS-HAMKLAQGRLAPPLLEQIGSVGLLN----------LDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPVEDAEEFARWMLTDFN-----MDGETTMVAPLRGFYLGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCSS. 399
12 -62.1001xi9_A mol:protein length:406 putative transaminase  ali model follow..  15  19........DVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKE---GHNYYGDSEGL------PELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDE----ILVPGPSYPPYTGLVKFYGGKPVEYRTDIRKKITDRTKAIAVINPNNPTGALLEEILNIAGEYEIPVISDEIYDLMTYEG-LTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPSEVREAIDRLARIRLCPNTPAQFAAIAGLT----------GPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIE-------VGPWKNDKEFVLDVLHNAHVLFVHGSGFGYGAGHFRAVFLPPIEILEEAMDRFEKFMKERLKE. 400
13 -61.7004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  14  10.LDGIDYNPWVEFVKLAS--EHDVVNLGQGFPDFPPPDFAVEAFQHAV-SGDFMLNQYTKTFGY------PPLTKILASFFGELLGQEIDPRNVLVTVGGYGALFTAFQALVDEGDE----VIIIEPFFDCYEPMTMMAGGRPVFVSLELAGKFTSRTKALVLNTPNNPLGKVLELVASLCQQHDVVCITDEVYQWMVYASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDH-IMKHLRTVHQNSVFHCPTQSQAAVAESFE---REQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVG-LKPIIPQGSYFLITDISDFKRKMPDLPGAYDRRFVKWMIKNKGLVAIPVSIFYSFDHYIRFCFVKDEATLQAMDEKLRKWKVELEN.. 424
14 -61.6003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  13  12.GTDNAPGQEVRQSAAGLEA-GRPVDFSHGDVDAHTPGAFDLFSAGVQ---SGGVQAYTEYRG------DLGIRDLLAPRLAAFTGAPVDADGLIITPGTQGALFLAVAATVARGDK----VAIVQPDYFANRKLVEFFEGEMVPVQLDLEEAFKAGARVFLFSNPNNPAGVVIGQIAALAARYGATVIADQLYSRLRYAGASVDAENVVTIMGPSKTESLSGYRLGVAFGSRA-IIARMEKLQAIVSLRAAGYSQAVLRGWFD----------EAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLF--------PRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSHTADSVRLNFSQDHEAAVAAARRIVTLVERYR... 406
15 -61.6004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  14  33.VCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTA----QGYCDSKGL------YSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDE----MLVPAPDYPLWTAAVSLSSGKAVHYLCDIRAKITPRTRGIVIINPNNPTGAVLMEIVEIARQHNLIIFADEIYDKILYDD-LAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISE--------FITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNI-----HDDQKMVLDFLLQEKVLLVQGTAFNPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQ.. 424
16 -61.3004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  15  13.LNKIEVSMIRQFDQ-SISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDA---DESHYTGMAGL------LALRQAASAFVKEKYHLTYNPDEILVTIGATEALSASLTAILEPGDK----VLLPAPAYPGYEPVVNLVGAEVVEIDTRSNDFVGEALKAVILNYPTNPTGVTIKNLAEVLKKYPIFVISDEVYAELTYTGAEYLPDQTILISGLSKSHAMTGWRLGLIFAPAV-LTAQLIKSHQYLVTAATTSVQFAAIEALT----------NGKDDALPMKEEYIKRRDYIIEKMEAMK-FKIIKPDGAFYIFAKIP-------VAQGQDSFKFLQDFAKEKAVAFIPGVAFGKGEGYLRISYAASMETIKEAMKRLKEFMEQYAD.. 393
17 -61.3001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  12  19.YQGSTKSVWVEYIQLAA--QYKPLNLGQGFPDYHAPKYALNALAAAANSPDPLANQYTRGFGH------PRLVQALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDE----VIIIEPFFDCYEPMVKAAGGIPRFIPLELEALFNEKTKMIIINTPHNPLGKVLEVVANLCKKWNVLCVSDEVYEHMVFCTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEA-LLKNLQMVHQNCVYTCATPIQEAIAVGFE---TELKRLKSPECYFNSISGELMAKRDYMASFLAEVG-MNPTVPQGGYFMVADWSSLDSKV-ETDARKDYRFTKWMTKSVGLQGIPPSAFYSGEDFVRYCFFKKDENLQKAAEILRKWKGSS.... 429
18 -61.3002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  12  4VPEPSVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTTY--GYCLKSCT------LPFLEEAARWYEGRYGVGLDPREALALIGSQEGLAHLLLALTEPEDL----LLLPEVAYPSYFGAARVASLRTFLIPLRVPEGVWREAKVLLLNYPNNPTGAVFEEALGLARKHGLWLIHDNPYVDQVYLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEAL-ARLERVKGVIDFNQYAGVLRMGVEALK----------TPKEVVRGYARVYRERALGMAEALKGV--LSLLPPRATMYLWGRLPEGV----------DDLEFGLRLVERGVALAPGRGFGGGKGFVRIALVRPLEELLEAAKRIREALD...... 376
19 -61.2005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  15  79.LKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIRE---GFTRYTLNAGI------TELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDE----VIIPAPYWVSYTEQARLADATPVVIPTDLESKLTEKSRLLILCSPSNPTGSVLEEIARIIAKHRLLVLSDEIYEHIIYASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKH-IVAACSKLQGQVSSGASSIAQKAGVAALG-------LGKAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYGSEAEGFGLDSSSLALYFLDKFQVAMVPGDAFG-DDSCIRISYATSLDVLQAAVEKIRKALEPLRAT. 472
20 -60.9002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  14  20.LANIPDSYFGKTMGRIEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPENQ--KYGAFHG------KEAFKQAIVDFYQRQYNVTLDKEEVCILYGTKNGLVAVPTCVINPGDY----VLLPDPGYTDYLAGVLLADGKPVPLNLEVDSQIIDKTKLIYLTYPNNPTGSTFDEAIAKFKGTDTKIVHDFAYGAFGFLASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKD-MIQALKKYQTHTNAGMFGALQDAAIYALN----------HYDDFLEEQSNVFKTRRDRFEAMLAKAD-LPFVHAKGGIYVWLETPP---------GYDSEQFEQFLVQEKSILVAPGKPFGEGNRYVRISLALDDQKLDEAAIRLTELAYLYE... 398
21 -60.5003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  12  20.IKDLGMASIRDLVALVKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVASI--YPNLDG------LPELKQEASRFAKLFVNIDIPARACVPTVGSMQGCFVSFLVANRTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFESYLQTGQFCSIIYSNPNNPTWQCLRIIGELATKHDVIVIEDLAYFGMDFPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLLYALSSGATHSAQWGMAAMLKACND-------GEYNFRDSVIEYGRKARIMKKMFLDNGFNIVYEPLADGFYF---------TVGYKGMDSSKLIEKFVRYGMCAITLKTTGSKRNEAMRICTSLLPESFPDLEKRLQMLNAE..... 436
22 -60.4001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  13  11.HAGLVFNPIRTVSDNAKPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEASQECNGYFPTVG------SPEAREAVATWWRNSFKSTIVKDNVVLCSGGSHGILMAITAICDAGDY----ALVPQPGFPHYETVCKAYGIGMHFYNCEIRRLKDDKTKLLIVTNPSNPCGSNVEDIVRLAEELRLPLFSDEIYAGMVFVADFETTVPRVILGGTAKNLVVPGWRLGWLLYVDPSFLEGLKRVGMLVCGPCTVVQAALGEALLN----------TPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYRDIK----TDVEFFEKLLEEENVQVLPGTIFHA-PGFTRLTTTRPVEVYREAVERIKAFCQRHAA.. 415
23 -60.3006DK6 Entity 1(prereleased)  ali follow..  16  16.LFPEIARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDELGNTFKGYGPEQG------YDFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGNIL-DIFGQGNT----IAITDPVYPVYVDTNVMIGNTGEADENGAYAIPQEKADLIYLCYPNNPTGAVLEAWVKYARENGSVLLYDAAYEAFIQDEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKWSRRHSTKFNGASYIVQKGAEALYT---------DEGKSQTKALIEHYMGNAALLVEACKNAG-LSVFGGVNAPYVWVGCPA---------GLTSWQMFDKMLNEANVVITPGSGFGSGEGYFRISAFNSRANVEEVCRRIAAL........ 410
24 -60.3003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  16  56........ARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLAEGYSGYGAEQG------QGALREAVASTFYGHAG--RAADEIFISDGSKCDI-ARIQMMFGSKPT----VAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGSKAKRTDIIFFCSPNNPTGAALTELVNFARKNGSILVYDAAYALYISYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALVHADWNRVMTTCFNGASNIVQAGGLACLQ---------PEGLKEMNAMIKFYKENAQILKTTFTEMG-FSVYGGDDAPYIWVGFP----------GKPSWDVFAEILERCNIVTTPGSGYGAGEGFVRASAFGSRENILEAVRRFKEAYGKRNAS. 443
25 -59.9001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  15  7.TEAAKESIFPRMSGLAQ--RLGAVNLGQGFPSNPPPPFLLEAVRRALG----RQDQYAPPAGL------PALREALAEEFA------VEPESVVVTSGATEALYVLLQSLVGPGDE----VVVLEPFFDVYLPDAFLAGAKARLVRLDLEKALTPRTRALLLNTPMNPTGLVLEAIARLARAHDLFLISDEVYDELYYGEREFAPERTFTVGSAGKRLEATGYRVGWIVGPKE-FMPRLAGMRQWTSFSAPTPLQAGVAEALK--------LARREGFYEALREGYRRRRDLLAGGLRAMG-LRVYVPEGTYFLMAE---------------PGWDAFRLVEEARVALIPASAFYLEKDLFRFAFCKTEEELHLALERLGRVVNSPREA. 374
26 -59.9001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  13  12.LPQLGTTIFTQMSALAQ--QHQAINLSQGFPDFDGPRYLQERLAHHVAQ---GANQYAPMTGV------QALREAIAQKTERLYGYQPDADDITVTAGATEALYAAITALVRNGDE----VICFDPSYDSYAPAIALSGGIVKRMALEFAALLSERTRLVILNTPHNPSATVFAALWQAIAGHEIFVISDEVYEHINFLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAP-ISAEIRKVHQYLTFSVNTPAQLALADMLR----------AEPEHYLALPDFYRQKRDILVNALNESR-LEILPCEGTYFLLVDYS-------AVSTLDDVEFCQWLTQEHGVAAIPLSVFCAPHKLIRLCFAKKESTLLAAAERLRQL........ 386
27 -59.8002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  14  17.LPPYVFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDTH--GYSTSRGI------PRLRRAISHWYRDRYDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDT----ILVPNPSYPIHIYGAVIAGAQVRSVPLRAIRESIPKPRMMILGFPSNPTAQCFERVVALAKQYDVMVVHDLAYADIVYMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPE-LVSALARIKSYHDYGTFTPLQVAAIAALE----------GDQQCVRDIARQYQQRRDVLVKGLREAG-WMVENPKASMYVWAKIPEPYA------HLGSLEFAKKLLQDAKVSVSPGIGFGDGDDHVRFALIENRDRLRQAVRGIKAMFRADG... 399
28 -59.6005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  12  6.IEGLDSNVWVEFTKLAA--DPSVVNLGQGFPDISPPSYVKEELSKAAFIDN--MNQYTRGFGH------PALVKALSCLYGKIYQRQIDPNEILVAVGAYGSLFNSIQGLVDPGDE----VIIMVPFYDCYEPMVRMAGAVPVFIPLELESKFSSKTKAIILNTPHNPLGKVLQVIADLCVKHDTLCISDEVYEWLVYATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAH-LIKHLQTVQQNSFYTCATPLQAALAEAFW---IDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSVG-LKPIVPDGGYFIIVSSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDFEKLVRFCFIKKDSTLDAAEEIFRAW........ 410
29 -59.5002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  15  43........ARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSEGYSGYGAEQG------AKPLRAAIAKTFY--GGLGIGDDDVFVSDGAKCDI-SRLQVMFGSNVT----IAVQDPSYPAYVDSSVIMGQTGQFNTDVQKLSTVGRTDIIFFCSPNNPTGAALTQLVEFAKKNGSIIVYDSAYAMYMSFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLVAKDFNRIICTCFNGASNISQAGALACLT---------PEGLEAMHKVIGFYKENTNIIIDTFTSLG-YDVYGGKNAPYVWVHFP----------NQSSWDVFAEILEKTHVVTTPGSGFGPGEGFVRVSAFGHRENILEACRRFKQLYK...... 426
30 -59.4003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  12  2..MTFEPYPFERLRALLKTPKKRGLDLGIGEPQFETPKFIQDALKNHTH----SLNIYPKSAF------EESLRAAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFVLF--DYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLSLNEKELQEVDLVILNSPNNPTGRTLISWVKLALKHDFILINDECYSEIYENT-NEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLL-EKYKAFRAYLGYTSANAIQKASEAAWL-----------DDRHAEFFRNIYANNLKLARKIFKN-----TLIYPYSFYVYLPVQ------------NGENFAKTLYQNEGIITLPALYLGRGADYVRLALVYDTPLLEKPLEIIETYRENHA... 376
31 -59.2002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  14  7.LRPYATTVFAEMSALAT--RIGAVNLGQGFPDEDGPPKMLQAAQDAIAG---GVNQYPPGPGS------APLRRAIAAQRRRHFGVDYDPEEVLVTVGATEAIAAAVLGLVEPGSE----VLLIEPFYDSYSPVVAMAGAHRVTVPLALRRAVTPRTRALIINSPHNPTGAVLAAIAEIAVAANLVVITDEVYEHLVFAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAE-LIAGVRAAKQYLSYVGGAPFQPAVALALD----------TEDAWVAALRNSLRARRDRLAAGLTEIG-FAVHDSYGTYFLCADPRPLGYD-------DSTEFCAALPEKVGVAAIPMSAFCDPNHLVRFTFCKRDDTLDEAIRRLSVLAERPATG. 399
32 -59.1004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  14  57........NRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAHGLSEGYRGYGLEQG------NKTLRKAIAETFYR--DLHVKSNEVFVSDGAQSDI-SRLQLLLGSNVT----IAVQDPTFPAYIDSSVIIGQTGHFHEKTKKLAMTPRTDVIFFCSPNNPTGYVLHQLVDFAKTNGSIIIFDSAYAAFIEYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELIINDFHRIVTTSFNGASNIAQAGGLACLS---------SGGLKEIRSVNNYYKENRKILMDTLVSLG-LKVYGGVNAPYLWVHFK----------GSKSWDVFNEILENTHIITVPGSGFGPGEEYLRISGFGRRDHIVEASKRLQNFFNTRTKH. 445
33 -58.0005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  11  6...........QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNEL---PVLWAESEQRPVQQIESEAHQAYFTLLG-QHGYPAEPGRVLSCYSSSVSMEILARSLSASVDR----VALVHPTFDNIADLLRGNGLDLVPVEEDLSAELLSSVGCVFVTTPNNPTGRVLRRLAEQCAEHGTVLALDTSFRGFHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSED-IGLPVEKIYSDILLGVSPLILALIREFSR---------DAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVE-----------VAFAGRTGTEVWEELQRHHVFALPCRQFHDGDHMVRIALSRSTEPLEKSVQVLRTVLETR.... 376
34 -58.0003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  16  20........QKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARLSSTCRGYGPDFG------LPALRQKLSEDFYRGF---VDAKEIFISDGAKVDL-FRLLSFFGPNQT----VAIQDPSYPAYLDIARLTGAKEIIAAFFPEFPEDTHIDILCLCSPNNPTGTVLRAIVHYAIEHEILILFDAAYSTFISFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ------------LEAIHYYRENSDLLRKALLATG-FEVFGGEHAPYLW--------VKPTQANISDRDLFDFFLREYHIAITPGIGFGRGSGFVRFSSLGKREDILAACERLQMAPALQS... 394
35 -57.9003ele_A mol:protein length:398 Amino Transferase  ali model follow..  15  25...........GKKRAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDYDSALHGYTSAQG------DVETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRALTSDAYDE---FITIAPYFPEYKVFVNAAGARLVEVPADLEERINAHTRGVIINSPNNPSGTVIKKLSDLLEKKPIFIIADEPYREIVYPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYAAVCGAGRALGYVCAPSLFQKMIVKCQGA---------------TGDINAYKENRDLLYEGLTRIG-YHCFKPDGAFYMFVK-----------ALEDDSNAFCEKAKEEDVLIVAADGFGC-PGWVRISYCVDREMIKHSMPAFEKIYKKYNK.. 398
36 -57.7004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  13  20.PRREDPPVLEEWYRRLGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAV---VMDDSVSQG------GEGVRRAIADRYA-----GGDADRVLVTHGSSEAIALTLNALLHRGDR----VVVQEGIYHSLGHYPRAAGCDVAVLPGVLAGLVTPGTAAVIVNFPHNPTGVTLRALKERTAATGAVLVWDAATAEIAHADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKE-LLTATFPLRDRTTLFLSPLVELVAERAVR----------HADELIGARAAEARHNLAHLTGWMAAHELVRWTPPEGGVCALPVFRELERAAAG--PQEVERFCLELLERHRTLLVPGTAFGA-PHGARLGFGGPQEDFRAGLDGLSRFLRERAAG. 399
37 -56.9004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  12  42..RTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSG--KFNGYPPTVG------ADNLRQVVSTYWRRFCQTKLKWENVIITSGVSQAIVLALTALCNEGDN----ILVCAPSFPHYKSVCDSYGIECRYYYLAAAGMVDSHTKAFVIINPSNPCGSNVSDIIDFCQQHQIPLISDEIYAEMVLNN-FDTNVPRLILGGTAKYQVCPGWRVGWSILIDPM-WAVGMERLTQLIAGVNSICQEAIARTL---------LKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSYFQDLK----SDMEFYEKLLDEENVQVLPGEIFGM-SGFLRATVSRPSAVLNEAVDRIIEFCERHKK.. 438
38 -56.9003jtx_A mol:protein length:396 aminotransferase  ali model follow..  14  6.LKQLKPYPFARLHEAMQPEGMEAVPLHIGEPKHPTPKVITDALTASLH----ELEKYPLTAG------LPELRQACANWLKRRYD---ADNEILPVLGSREALFSFVQTVLNPVSDGKPAIVSPNPFYQIYEGATLLGGGEIHFANCSISEEVWKRTKLVFVCSPNNPSGSVWKEVFDLQDKYGFIIASDECYSEIYFAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELL-KNFLLYRTYHGSAMSIPVQRASIAAWD-----------DEQHVIDNRRLYQEKFERVIPILQQV--FDVKLPDASFYIWLKVP----------DGDDLAFARNLWQKAAIQVLPGRFLARGEGYVRIALVADVATCVKAAEDIVSLYR...... 396
39 -56.8003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  13  14........NVHENSAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQ---GTKLNYGWIEG------SPAFKKSVSQLYT-----GVKPEQILQTNGATGANLLVLYSLIEPGDH----VISLYPTYQQLYDIPKSLGAEVDLWQIKLRQLIRPTTKMICINNANNPTGAVLEELVEIASEVGAYILSDEVYRSFSELSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQ-VTDILRDYRDYTMICAGVFDDLVAQLALA----------HYQEILERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVK---------IAVDMPMEDFCLQLLQEHGVLLVPGNRFER-DGYVRLGFACEQETLIKGLEKLSQFLRRFDKE. 374
40 -56.6003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  11  28.KTFNPIRAIVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDALDSG--KYNGYAPSIG------FLSSREEIASYYHCP-EAPLEAKDVILTSGCSQAIDLCLAVLANPGQN----ILVPRPGFSLYKTLAESMGIEVKLYNLQLEYLIDEKTACLIVNNPSNPCGSVLQKILAVAARQCVPILADEIYGDMVFLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIRDGLVKLSQRILGPCTIVQGALKSILC---------RTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFE----NDVEFTERLVAEQSVHCLPATCFEY-PNFIRVVITVPEVMMLEACSRIQEFCEQHYH.. 420
41 -56.1003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  11  11.KTFNPIRAIVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDALDSG--KYNGYAPSIG------YLSSREEVASYYHCP-EAPLEAKDVILTSGCSQAIELCLAVLANPGQN----ILIPRPGFSLYRTLAESMGIEVKLYNLQLESLIDEKTACLVVNNPSNPCGSVLQKILAVAERQCVPILADEIYGDMVFMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIRDGLVKLSQRILGPCTIVQGALKSILQ---------RTPQEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEHFPEFE----NDVEFTERLIAEQSVHCLPATCFEY-PNFFRVVITVPEVMMLEACSRIQEFCEQ..... 400
42 -55.6003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  12  62.ANIGDAQAMGQQPITFLRQVMALCTYPLDSPSFPEDAKKR-ARRILQACGGNSLGSYSASQGV------NCIREDVAAYIRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEEAKDHCDPKVLCIINPGNPTGQVIEDVIHFAWEEKLFLLADEVYQDNVYSPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAAPDMFYCMKLLEETGICVVPGSGFGQGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEK. 490
43 -55.4003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  12  1......GMSVGEAMDTEVRAAAQAVCLAFNENPEAVEPRVQAAIAAAA-----------ARINRYPFDAEPRVMRKLAEHFS------CPEDNLMLVRGIDECFDRISAEFSSM------RFVTAWPGFDGYRARIAVSGLRHFEIGLTDDLAQVSRDDCVVLANPSNPTGQALSGELDQLRQRAGKLLIDETYVDYS-ARGLAYGENELVFRSFSKSYGLAGLRLGALFGPSELIAAMKR---KQWFCNVGTLDLHALEAAL-----------DNDRAREAHIAKTLAQRRRVADALRGLGYRVASS---------------EANFVLVENAAGERTLRFLRERGIQVKDAGQFGL-HHHIRISIGREEDN-DRLLAALAEYSDHS.... 337
44 -55.2003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  15  26.....................ASWIKLNTNENPYPPSPEVVKAILEELGPDGAALRIY-------PSASSQKLREVAGELYG------FDPSWIIMANGSDEVLNNLIRAFAAEGEE----IGYVHPSYSYYGTLAEVQGARVRTFGLTGDFPERYEGKVFFLTTPNAPLGPSFEYIDELARRCAGMLVLDETYAEFNALELVRRHENVVVTRTLSKSYSLAGMRIGLAIARPEVIAALDK---IRDHYNLDRLAQAACVAALR-----------DQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYL-------------FATPPDRDGKRVYDGLYARKVLVRHFSDPLL-AHGMRISIGTREEM-EQTLAALKEIGE...... 353
45 -54.9003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  10  83.IRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAV-----ANNYPVPDRCL------VNTEKIINYFLQELDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDK----IAINEPIFTPYLRIPELKDYELVEVDLEIEKLKDPSIKALIVVNPTNPTSKELNAIKQAVEKNKLMIISDEVYGAFVPNFYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFD-DNIAHLDKVELRQLHKRYSSVVLDPDKMKFIDRLCADSRSIGLYHTAGLSTPQQIMEALFSMTHLLTSTTNTHYYSLIDIYRKEFRDYLTNNFEQVDFLLKLAEKNGVVLVDGVGFGAKPGELRVSQANLPTEYALIGKQVLELLKEYYEE. 528
46 -54.2003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  16  6LSDLPLREELRGEHAYGAPQLNVDIRLNTNENPYPPSEALVADLVATVDKIATELNRY-------PERDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRT----ALGFQPSYSMHPILAKGTHTEFIAVSRGLEEIRAKQPDIVFVTTPNNPTGDVTDDVERIINVAPGIVIVDEAYAEFSPSPLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVML---VRLPYHLSALSQAAAIVALR-----------HSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDF--------------SDQHAAWQAFLDRGVLIRDVG-----AGHLRTTIGVPEEN-DAFLDAAAEIIKLNLSA. 368
47 -53.9002f8j_A mol:protein length:347 Histidinol-phosphate aminotransferase  ali model follow..  17  25.....................RDKTYLALNENPFPFPEDLVDEVFRRLNS---------DALRIYYDSPDEELIEKILSYLDTDF---LSKNNVSVGNGADEIIYVMMLMF--------DRSVFFPPTYSCYRIFAKAVGAKFLEVPLRIPEVNVGEGDVVFIPNPNNPTGHVFEEEIERILKTGAFVALDEAYYEFSYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNR---VRLPFNVSYVSQMFAKVALD-----------HREIFEERTKFIVEERERMKSALREMGYRITDSRGNFV-------------FVFMEKEEKERLLEHLRTKNVAVRS-------REGVRITIGKREEN-DMILRELEVF........ 340
48 -53.2006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  10  22.APGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQA-----------YEKRFTEAFFQLHRQ--PTALVKNKTMLSYAASISTMVAGMFLKKERLA----VTLIEPCFDNLYDVLANMDVPLYPIDESPELERRVRTDALFLVDPNNPTGFSFEEVVRFCKDHDKLLLIDFCFASFTLFELENSGVRYLAIEDTGKTWPVQDAKCALITASDD-IWETVYNLHTSVLLNVSPFVLNMLTQYVR---------DSAADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAWFRVDHP----------LTATDVHRLLSADGVYVLPGRYFYKGDAYVRMALAREPEMFADAMALTRQVLDRHGR.. 407
49 -53.1003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  12  80................ALCDHPDLLQREEIKTLFSADS-ISRAKQILAMIPGRATGAYSHSQGI------HGLRDAIASGIASRDGFPANADDIFLTDGASPGVHLMMQLLINEKDG----ILVPIPQYPLYSASIALHGGALVPYYLNESTSRGINVRALVVINPGNPTGQVQYDIVKFCKNEGLVLLADEVYQENIYVD--EDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVLCSNITGQILASLVMNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQ-QKAIEAAKAANKAPDAFYALRLLESTGIVVVPGSGFGQGTWHFRCTILPQEDKIPAVISRFTVFHEAFMSE. 487
50 -53.0004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  13  18.......ADLRGKAPYGAPQLAVPVRLNTNENPHPPTRALVDDVVRSVREAAIDLHRY-------PDRDAVALRADLAGYLTAQTGIQLGVENIWAANGSNEILQQLLQAFGGPGRS----AIGFVPSYSMHPIISDGTHTEWIEASRAVAAVVDRKPDVVFIASPNNPSGQSVPDLCKLLDVAPGIAIVDEAYGEFSSQPVEEYPSKLVVTRTMSKAFAFAGGRLGYLIATPAVIDAMLL---VRLPYHLSSVTQAAARAALR-----------HSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDANFVLFGEF--------------ADAPAAWRRYLEAGILIRDVG-----PGYLRATTGLAEEN-DAFLRASARIATDLVPV. 373
51 -52.8001fg3_A mol:protein length:356 HISTIDINOL PHOSPHATE AMINOTRANSFERASE  ali model follow..  15  29.....................NGDVWLNANEYPTAVEFQLTQQ-----------------TLNRYPECQPKAVIENYAQYAG------VKPEQVLVSRGADEGIELLIRAFCEPGKDA---ILYCPPTYGMYSVSAETIGVECWQLDLQGISDKLDGVKVVYVCSPNNPTGQLIQDFRTLLERGKAIVVADEAYIEFSLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMK---VIAPYPLSTPVADIAAQALS---------PQGIVAMRERVAQIIAEREYLIAALKEIP-------------CVEQVFDSETNYILARFKASSAVFKSLWDQGIILRDQNKQPSLSGCLRITVGTREES-QRVIDALRAE........ 354
52 -52.3001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  13  3LFNTAHGGNIREPATVLGISPDQLLDFSANINPLGMPVSVKRALIDNL-----------DCIERYPDADYFHLHQALARHHQ------VPASWILAGNGETESIFTVASGL------KPRRAMIVTPGFAEYGRALAQSGCEIRRWSLREAEALTPDLDCLFLCTPNNPTGLLLQAIADRCKSLNINLILDEAFIDFGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAAMARMRRQ--QMPWSVNALAALAGEVALQ-----------DSAWQQATWHWLREEGARFYQALCQLPLLTV--------------YPGRANYLLLRCEEDIDLQRRLLTQRILIRSCANYGLDSRYYRVAIRSAAQN-ERLLAALRNVLTGIAPA. 363
53 -52.3004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  15  23.....................PGAIKLASNETVFGPLPSVRAAIDRAT-----------DTVNRYPDNGCVQLKAALARHLG----PDFAPEHVAVGCGSVSLCQQLVQVTASVGDE----VVFGWRSFELYPPQVRVAGAIPIQVPLTMLATVTDRTRLIFVCNPNNPTSTVVDALARFVEAAHILIAIDEAYVEYDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDK---VYVPFTVSSIGQAAAIASL-----------DAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLG--------------SRTQDFVEQAADARIVVRPYG-----TDGVRVTVAAPEEN-DAFLRFARRWRSDQKLA. 357
54 -52.1003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  16  30.....................KEVIKLASNENPFGTPPKAIECLRQNA-----------NKAHLYPDDSMIELKSTLAQKYK------VQNENIIIGAGSDQVIEFAIHSKLNSKNA----FLQAGVTFAMYEIYAKQCGAKCYKTQSILYETHKDEIKLIFLCLPNNPLGECLSEATEFIKGEDCLVVIDAAYNEFEPCELIKEFDNVLYLGTFSKLYGLGGLRIGYGIANANIISAFYK---LRAPFNVSNLALKAAVAAMD-----------DDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFI-------------TYFFDEKNSTDLSEKLLKKGIIIRNLKSYGL--NAIRITIGTSYEN-EKFFTEFDKILR...... 365
55 -51.7002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  10  82IEGRFERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGIL------GCNYPVPPRML------TVSEQIVRQYIVREAVPPESVDLFAVEGGTAAMSLRISGLLKAGDK----VAIGMPVFTPYIEIPELAQYDLKEVPIELDKLKDPDVKIFFCVNPSNPPSVKLDRVRAIVAEQDLLILTDDVYGTFADE-FSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHAL-------SQLPESAKKALDHRYRSLLPDV----------RSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALMDEADAYKQAQSSTGDMLFRVADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRRLADELYE. 523
56 -51.7003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  12  16...........DIYTEGVFKGRELLDYSSNINPLGIPKSFLNNIDEGI-----------KNLGVYPDVNYRRLNKSIENYLK------LKDIGIVLGNGASEIIELSISLF--------EKILIIVPSYAEYEINAKKHGVSVMCIDYEDIISKIDDVDSVIIGNPNNPNGGLINHVLKLAEEKKKTIIIDEAFIEFSFVGEIKNYSCLFIIRAMTKFFAMPGIRFGYGITNNKEIAAKIKAK--QNPWNINCFAEMAAINCLK-----------DTNYIEESLLWIKKERKRFIEELNKIG-------------FIKRVFSPHANFVLCRLESGEKLYDSLLKEDIVIRRCCNFGLDDSFVRFAIKDEKKN-TKFLRALKGVENN..... 360
57 -51.6003ffh_A mol:protein length:363 Histidinol-phosphate aminotransferase  ali model follow..  15  32.....................TKITKLSSNENPLGTSKKVAAIQANSS-----------VETEIYPDGWASSLRKEVADFYQ------LEEEELIFTAGVDELIELLTRVLLDTTTN----TVMATPTFVQYRQNALIEGAEVREIPLLQDNAIDEKTTIVWICNPNNPTGNYIADIQAFLDRSDVLVVLDEAYIEYKHEKLVRTYKNLIITRTFSKIYGLASARVGYGIADKEIIRQLNI---VRPPFNTTSIGQKLAIEAI-----------KDQAFIGECRTSNANGIKQYEAFAKRFEKVKL--------------YPANGNFVLIDLGEAGTIFSYLEKNGYITRSGAALGF-PTAVRITIGKEEDN-SAVIALLEKLL....... 363
58 -51.4003if2_A mol:protein length:444 Aminotransferase  ali model follow..  11  11FTQPTGISQLMDDLGDALKSDQPVNMLGGGNPAKIDA--NDNDTGKANSSAIISMANYSNPQG------DSAFIDALVGFFNRHYDWNLTSENIALTNGSQNAFFYLFNLFGGAKSVDKSILLPLTPEYIGYSDVHVEGQHFAAVLPHNLPALKEGRIGAICCSRPTNPTGNVMAHLAEIAKRYDIPLIIDNAYGMPFPDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAK-VIEAVSAMNAVVNLAPTRFGAAIATPLVA-------NDRIKQLSDNEIKPFYQKQATLAVKLLKQA-PLMIHKPEGAIFLWLWFKDLP----------STLDLYERLKAKGTLIVPSEYFFPGHECIRMSIAADEQTLIDGIKVIGEVVRELYDN. 443
59 -51.4003euc_A mol:protein length:367 Histidinol-phosphate aminotransferase 2  ali model follow..  14  9LIERIIRDDVRAMGAYHVPDSHGLVKLDAMENPYRLPPALRSELAARLGE---------VALNRYPVPSSEALRAKLKEVMQVP-----AGMEVLLGNGSDEIISMLALAAARPGAK----VMAPVPGFVMYAMSAQFAGLEFVGVPLRLAAMAEHQPAIVYLAYPNNPTGNLFADMEAIVRACRSLVVVDEAYQPFSWMSRLTDFGNLLVMRTVSK-LGLAGIRLGYVAGDPQWLEQLDK---VRPPYNVNVLTEATALFALE-----------HVAVLDEQAAQLRAERSRVAEGMAAHGGVTV--------------FPSAANFLLARVPDAAQTFDRLLARKVLIKNVSKMHPLANCLRVTVSTPEEN-AQFLEAFAASLQD..... 367
60 -51.3003fkd_A mol:protein length:350 L-threonine-O-3-phosphate decarboxylase  ali model follow..  13  15.....................SEIVNFSTTVWTDGDKDHLEKHLVENL-----------NCIRHYPEPDAGTLRQMLAKRNS------VDNNAILVTNGPTAAFYQIAQAF------RGSRSLIAIPSFAEYEDACRMYEHEVCFYPSDIGEADFSNMDFCWLCNPNNPDGRLLTEILRLLNDPDTTFVLDQSYVSFIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVAA---FSTPWAVNALAIEAAKFILI-----------HPAQFTLPIRKWQRNTVDFITALNRLDGVEVHPSGTTFFL-----------LRLKKGTAAELKKYMLEEYNMLIRDASNFGLDESYVRITTQRPAQN-QLFIKALETFLEKYE... 343
61 -51.2003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  17  16.....................DNPIRINFNENPLGMSPKAQAAARDAV-----------VKANRYAKNEILMLGNKLAAHHQ------VEAPSILLTAGSSEGIRAAIEAYASLEAQ----LVIPELTYGDGEHFAKIAGMKVTKVKMLAAVAAYSGPSIVYLVNPNNPTGTITDVIEPWIASANTMFIVDEAYAEFVNDPITQGAENIILLKTFSKIHAMAGMRVGYAVAHPTVIALMGR---YVAGEKINFSGVDAALASMN-----------DSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNFVFHQLV--------------VPLKDYQTHMADAGVLIGRAFP----DNWCRISLGTPQEM-QWVADTMREFRKK..... 351
62 -51.2004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  15  36.....................KIAARIGANESGFGPAPSVLLAIRQAA-----------GDTWKYADPENHDLKQALARHLG------TSPANIAIGEGIDGLLGQIVRLVVEAGAP----VVTSLGGYPTFNYHVAGHGGRLVTVPYALAAVGRENAPLVYLANPDNPMGSWWERVVAFAQAETTLLVLDEAYCETA-IESLIDKPNVIRARTFSKAYGLAGARIGYTLSTPGTAQAFDK---IRNHFGMSRIGVAAAIAALA-----------DQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDASY----------ARAIVDRLMSDHGIFIRMPGVAPL-NRCIRISTAPDAEM-DLLAAALPEVIRSLAAT. 376
63 -51.0002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  10  83IEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-----GCNYPVPPRM------LNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDK----VAIGMPVFTPYIEIPELAQYALEEVAIELDKLKDPAIKIFFCVNPSNPPSVKLERVRNIVAEHDLMILTDDVYGTFADDFFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFD-LALDKLQESEKVALDHRYRSLLPDVRSLKFIDALMDEADEYKHTLKQLIRRRETTLYRELGMPPLR-DENAVDYYTLIDLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADE.... 521
64 -50.6003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  11  83IEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL-----GCNYPVPPRM------LNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMSMKVNGLLKAGDK----VAIGMPVFTPYIEIPELAQYALEEVAIELDKLKDPAIKIFFCVNPSNPPSVKLERVRKIVAEHDLMILTDDVYGTFADGFFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFD-LALGRLPESEKTALDDRYRSLLPDVRSLKFLDALMDESDQYKHTLKQLIRRREATLYRELGTP-PQRDENAVDYYTLIDLYGEAFSKWAVKQSSTGDMLFRIADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRLRQMADELYAQ. 525
65 -50.1003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  12  10..KFTRHSGITRLMEDLNDRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGADALCNYDGPQG------KTALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFAGRRAD-GSTKKVLFPLAPEYIGYADSGLEDDLFVSAREHLHIGEETGMICVSRPTNPTGNVLMKLDRLANQHNIPLVIDNAYGVPFPGIIFSENPNIILCMSLSK-LGLPGSRCGIIIANDKTI-TAIANMNGIISLAPGGMGPAMMCEMIKRND--------LRLSETVIKPFYYQRVQQTIAIIRREERCLIHKPEGAIFLWLWFKDLP---------ITTELLYQRLKARGVLMVPGHYFFPGHQCMRMNYVPEPDKIEAGVKILAEEIERAWRE. 416
66 -48.7001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  13  33................EVHNTNGIIQMGLAENAKNPEAAAFKKNGESIFA---ELALFQDYHG------LPAFKKAMVDFMAEINKVTFDPNHLVLTAGATSANETFIFCLADPGEA----VLIPTPYYPGFDRDLKWRTGTALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTLYLLLSFVEDKGIHLISDEIYSGTAFSS-SEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGL--VSSQTQHLLSAMLSDKK---------KNYIAENHKRLKQRQKKLVSGLQKSG-ISCLNGNAGLFCWVDMRHLLRSN---TFEAEMELWKKIVYEVHLNISPGSSCHCEPGWFRVCFANPERTLDLAMQRLKAFVGEYYN.. 434
67 -47.9001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  12  31................PLKNPNGVIQMGLAENQLNPKGSICSEGIKSFK----AIANFQDYHG------LPEFRKAIAKFMEKTRGVRFDPERVVMAGGATGANETIIFCLADPGDA----FLVPSPYYPAFNRDLRWRTGKAVKEAYENAQKSNIKVKGLILTNPSNPLGTTLKSVLSFTNQHNIHLVCDEIYAATVFDT-YCNKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMSSFGL--VSTQTQYFLAAMLSDEK---------DNFLRESAMRLGKRHKHFTNGLEVVG-IKCLKNNAGLFCWMDLRPLLRES---TFDSEMSLWRVIINDVKLNVSPGSSFECEPGWFRVCFANMDDGVDIALARIRRFVGVEK... 428
68 -43.5002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  12  14.LQQSNATAFAMLSDLSAEAKSTTYNATIGMATNKDGKMFASSLDAMFNLTPDEIFPYAPPQGI------EELRDLWQQMLRDNPELSIDNSRPIVTNALTHGLSLVGDLFVNQDDT----ILLPEHNWGNYKLVFNTRNGANLQT-VEALQSYNKDKVIMILNYPNNPTGYTPTTIVEAIKATKVIAVVDDAYYGLFYTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFDKEIEQN---IQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMA-----------IKVHDVDPEALRKHLIDKYSIGVIALNATD-----IRIAFSCEKDDIPHVFDSIAKAIDDLR... 430
69 -41.7004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  15  12.TWNNGPDLAFDINNKANAAREAVINAALGTLLDDKGK-LPSVYDRLDEMDRSHIASYAPIEG------EKDYRKIVIDTLFGPYKPE-GYISAIATPGGTGAIRSAIFSYLDEGDP----LICHDYYWAPYRKICEEFGRNFKTFEF-DEGIRDSDRIASLINSPNNPTGYSLDEVITFLKEKKITLIVDVAYLEFAGDGFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGSSKEIIEEFEASLAHSARCNWSNGTHAAQNILIELERA-ENKKIYEQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGF--------------FTFIPTDKAFDIVKDLEKENIFTIPSAKGI------RVAICGGEEKIPKLVQRLAFYTNKK.... 413
70 -41.5003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  5.ITAAPADPILGLADLFRADEPGKINLGQGVYKDETGK-VKKAEQYLLENETTK--NYLGIDG------IPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKR----VWVSNPSWPNHKSVFNSAGLEVREYAINSLNEAQAGDVVLFHGCCHNPTGIDPQTLAQLSVEKGWLPLFDFAQQGFARRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADAFSQMKAAIYANYSNPPAHGASVVATILSNDALRAIWEQE----LTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFS-----------FSGLTKEQVLRLREEFGVYAVASG---------RVNVAGTPDNMAPLCEAIVAVL....... 396
71 -40.6002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  12  5.ITTAPADPILGLADLLRADEPGKIDLGMGVYDETGKTPVLTSVKKAEQLENETTKNYLGIDG------IPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKR----VWVSNPSWPNHKSVFNSAGLEVREYAINSLNEAQAGDVVLFHGCCHNPTGIDPQTLAQLSVEKGWLPLFDFAYQGFARGAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQE----LTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFS-----------FSGLTKEQVLRLREEFGVYAVASG---------RVNVGMTPDNMAPLCEAIVAVL....... 396
72 -39.9004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  12  9.ITAAPADPILGLADLFRADEPGKINLGIGVKDETGKTPVLTSVKKAEQLENETTKNYLGIDG------IPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKR----VWVSNPSWPNHKSVFNSAGLEVREYAINSLNEAQAGDVVLFHGCCHNPTGIDPQTLAQLSVEKGWLPLFDFAYQGFARGLFAAMHKELIVASSYSKNFGLYNERVGACTLVAADAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQE----LTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFS-----------FSGLTKEQVLRLREEFGVYAVASG---------RVNVGMTPDNMAPLCEAIVAVL....... 400
73 -39.8004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  13  7.IDAYPGDPILTLNENFQKDPDQKVNLSIGIYDAEGRIPVMGAVREAALQRDSGPKPYLPMVG------LAAYRDAVQSLVFGADHPARAAGRIALGGSGALKVGADFLKRYFPDSQ----VWLSDPSWENHRFIFERAGFTVNTYPLAAIDALPARSIVLLHACCHNPTGVDLEKLIDVIEARELLPFVDMAYQGFGAGLLARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDVLGQLAGAVRSNYSNPQTYGAKVVAAVLG----------TPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKQR-----GMFTYTGLTESQVDALREVHGVYILRSG---------RMCVAGNDSNVGIVADAIGKVLKSGA... 402
74 -39.4003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  11  13.KGKKLKDVIFVTAGQAQADRENVVNGTLGEGNLVFLKTVKEEYLSLSDS---EHVGYAPIAG------IPDFLCAAEKEC-FGNFRPEGHIRSIATAGGTGGIHHLIHNYTEPGDE----VLTADWYWGAYRVICSDTGRTLVTYSL-NELAAKQTNVVVIFNTPNNPTGYSIDSILNFLKDNNVIIGIDVAYLDYSGEK-LPKEILTCVCYSLSKGFTMYGQRVGAMIGISDEFFEVNKSTSRATWSNICRPAMRTMANIVADPAKFKEYEAE----RNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGF--------------FITIPTDSANAICEELKKEHIVIALANGIRIACGIPKCQMTGLAEKIYNAMKSLGKL........ 418
75 -39.2003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  11  5.VDAYAGDPILTLMERFKEDPRSLYYNEDGIIPQLQAVAEAEA---RLNAQPHGASLYLPMEG------LNCYRHAIAPLLFGADHPVLKQQRVIQTLGGSGALKVGADFLYFPESG----VWVSDPTWENHVAIFAGAGFEVSTYPLATLKTLQAGSIVLLHPCCHNPTGADLDAVIEILKARELIPFLDIAYQGFGAGMIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDVLGQLKATVRRNYSSPPNFGAQVVAAVLN----------DEALKASWLKEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQR-----GMFSYTGLSAAQVDRLREEFGVYLIASG---------RMCVAGNTANVQRVAKAFAAVM....... 397

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.