current user: public

If you have questions about the server, please let us know.

Query: 3cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst MTKITLSDLPLREELRGEHAYGAPQLNVDIRLNTNENPYPPSEALVADLVATVDKIATELNRYPERDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFLDAAAEIIKLNLSAWSHPQFEKLast
1 -120.0003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model  100  1MTKITLSDLPLREELRGEHAYGAPQLNVDIRLNTNENPYPPSEALVADLVATVDKIATELNRYPERDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFLDAAAEIIKLNLSAWSHPQFEK 376
2 -113.0004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  59  7.HPVTLDDLPLRADLRGKAPYGAPQLAVPVRLNTNENPHPPTRALVDDVVRSVREAAIDLHRYPDRDAVALRADLAGYLTAQTGIQLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRANDFGLDVDVAVAAVVDRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIVDEAYGEFSSQPSAVSLVEEYPSKLVVTRTMSKAFAFAGGRLGYLIATPAVIDAMLLVRLPYHLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDANFVLFGEFADAPAAWRRYLEAGILIRDVGIPGYLRATTGLAEENDAFLRASARIATDLVPVTRSPVGAP 381
3 -101.0003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  30  1.....MSLIPLRQNIASMKGYIPGYQASWIKLNTNENPYPPSPEVVKAILEELGPDGAALRIYPSASSQKLREVAGELY------GFDPSWIIMANGSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTGDFRIAGFPE-----RYEGKVFFLTTPNAPLGPSFPLEYIDELARRCAGMLVLDETYAEFAE-SNALELVRRHE-NVVVTRTLSKSYSLAGMRIGLAIARPEVIAALDKIRDHYNLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPDDGKRVYDGLYARKVLVRHFLLAHGMRISIGTREEMEQTLAALKEIGE............. 353
4 -99.6003euc_A mol:protein length:367 Histidinol-phosphate aminotransferase 2  ali model follow..  33  6..DPSLIERIIRDDVRAMGAYHVPDSHGLVKLDAMENPYRLPPALRSELAARLGEV--ALNRYPVPSSEALRAKLKEVMQVPAG-----MEVLLGNGSDEIISMLALAAARPGAKVMAPVPGFVMYAMSAQFAGLEFVGVPLRADFTLDRGAMLAAMAEHQPAIVYLAYPNNPTGNLFDAADMEAIVRAAQGLVVVDEAYQPFAQ-ESWMSRLTDFG-NLLVMRTVSK-LGLAGIRLGYVAGDPQWLEQLDKVRPPYNVNVLTEATALFALEHVAVLDEQAAQLRAERSRVAEGMAAHGVTVFPSAANFLLARVP-DAAQTFDRLLARKVLIKNVSLANCLRVTVSTPEENAQFLEAFAASLQD............ 367
5 -94.8002f8j_A mol:protein length:347 Histidinol-phosphate aminotransferase  ali model follow..  33  10..........LDLIAKRAYPYETEK-RDKTYLALNENPFPFPEDLVDEVFRRLNSD--ALRIYYDSPDEELIEKILSYLDTD---FLSKNNVSVGNGADEIIYVMMLMF----DRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLRIP------EVNVGEGDVVFIPNPNNPTGHVFEREEIERILKT-GAFVALDEAYYEFHG-ESYVDFLKKYE-NLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMFAKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEKERLLEHLRTKNVAVRSF--REGVRITIGKREENDMILRELEVF............... 340
6 -94.6003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  21  4..........FNEFLNNLSNYEPGKDKEVIKLASNENPFGTPPKAIECLRQNAN----KAHLYPDDSMIELKSTLAQKY------KVQNENIIIGAGSDQVIEFAIHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITHNLDEFKKLYETH-KDEIKLIFLCLPNNPLGECLDASEATEFIKGVNELVVIDAAYNEFASFKEPCELIKEFD-NVLYLGTFSKLYGLGGLRIGYGIANANIISAFYKLRAPFNVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDENSTDLSEKLLKKGIIIRNLK--NAIRITIGTSYENEKFFTEFDKILR............. 365
7 -94.6001fg3_A mol:protein length:356 HISTIDINOL PHOSPHATE AMINOTRANSFERASE  ali model follow..  30  1MSTVT-ITDLARENVRNLTPYQSARRNGDVWLNANEYPTAVEFQLTQQ----------TLNRYPECQPKAVIENYAQYA------GVKPEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTLDNWQLDLQGISDKL--DGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGIVVADEAYIEFCPQASLAGWLAEYP-HLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVIAPYPLSTPVADIAAQALSPQGIMRERVAQIIAEREYLIAALKEIPCQVFDSETNYILARF-KASSAVFKSLWDQGIILRDQNLSGCLRITVGTREESQRVIDALRAE............... 354
8 -94.1004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  29  1.....MVTARLRPELAGLPVYVPGKTPGAIKLASNETVFGPLPSVRAAIDRATD----TVNRYPDNGCVQLKAALARHL----GPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLT-DHTFDLYAMLATV-TDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPALIAIDEAYVEYIRDGMRPDSLGRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDKVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSRTQDFVEQAADARIVVRPY-GTDGVRVTVAAPEENDAFLRFARRWRSDQKLAAA...... 359
9 -93.1003ffh_A mol:protein length:363 Histidinol-phosphate aminotransferase  ali model follow..  23  3.......AMKWKKSLAGLSSYKPGKRTKITKLSSNENPLGTSKKVAAIQANSSV----ETEIYPDGWASSLRKEVADFY------QLEEEELIFTAGVDELIELLTRVLLDTTTNTVMATPTFVQYRQNALIEGAEVREIPLLQDGEHDLEGMLNAI-DEKTTIVWICNPNNPTGNYIELADIQAFLDRVPSLVVLDEAYIEYVTPEKHEKLVRTYK-NLIITRTFSKIYGLASARVGYGIADKEIIRQLNIVRPPFNTTSIGQKLAIEAIKDQAFIGECRTSNANGIKQYEAFAKRFKVKLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSLGFPTAVRITIGKEEDNSAVIALLEKLL.............. 363
10 -92.2003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  24  2............MSVGEAMDTEVRAAAQAVCLAFNENPEAVEPRVQAAIAAAAA----RINRYPFDAEPRVMRKLAEHF------SCPEDNLMLVRGIDECFDRISAEF--SSMRFVTAWPGFDGYRARIAVSGLRHFEIGLTDDLLLDPNDLAQV---SRDDCVVLANPSNPTGQALSAGELDQLRQRAG-KLLIDETYVDYSSFR--ARGLAYGE-NELVFRSFSKSYGLAGLRLGALFGPSELIAAMKRKQWFCNVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEANFVLVENA-AGERTLRFLRERGIQVKDAGLHHHIRISIGREEDNDRLLAALAEYSDHS........... 337
11 -91.0003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  26  2................ETQPESAAFTDNPIRINFNENPLGMSPKAQAAARDAVV----KANRYAKNEILMLGNKLAAHH------QVEAPSILLTAGSSEGIRAAIEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDNWAFDIEGLKAAVAAYGPSIVYLVNPNNPTGTITPADVIEPWIASKPAMFIVDEAYAEFVNDPSISPMITQGAENIILLKTFSKIHAMAGMRVGYAVAHPTVIALMGRYVAGEKINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNFVFHQLVVPLKDYQTHMADAGVLIGRAPADNWCRISLGTPQEMQWVADTMREFRKKS........... 352
12 -88.5004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  20  1FQSMSAFS-RFTPLIQSLPASVPFVGKIAARIGANESGFGPAPSVLLAIRQAAG----DTWKYADPENHDLKQALARHL------GTSPANIAIGEGIDGLLGQIVRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADDR-EDLEGLLAAVGRENAPLVYLANPDNPMGSWWPAERVVAFAQALPELLVLDEAYCETAPRDPPIESLIDKP-NVIRARTFSKAYGLAGARIGYTLSTPGTAQAFDKIRNHFGMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDRAIVDRLMSDHGIFIRMPPLNRCIRISTAPDAEMDLLAAALPEVIRSLAAT........ 376
13 -81.6003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  20  1..........MYQKFKGGDLMIHGGDRELLDYSSNINPLGIPKSFLNNIDEGIK----NLGVYPDVNYRRLNKSIENYL------KLKDIGIVLGNGASEIIELSISLF----EKILIIVPSYAEYEINAKKHGVSVVFSYLDENMCIDYEDIISKI--DDVDSVIIGNPNNPNGGLINKEKFIHVLKLAEETIIIDEAFIEFTGDPSFVGEIKNYS-CLFIIRAMTKFFAMPGIRFGYGINNKEIAAKIKAKQNPWNINCFAEMAAINCLKDTNYIEESLLWIKKERKRFIEELNKIGFRVFSPHANFVLCRLENSGEKLYDSLLKEDIVIRRCC-DSFVRFAIKDEKKNTKFLRALKGVENN............ 360
14 -80.7003fkd_A mol:protein length:350 L-threonine-O-3-phosphate decarboxylase  ali model follow..  23  13........................LSSEIVNFSTTVWTDGDKDHLEKHLVENLN----CIRHYPEPDAGTLRQMLAKRN------SVDNNAILVTNGPTAAFYQIAQAF--RGSRSLIAIPSFAEYEDACRMYEHEVCFYPSNEDIGEAD--------FSNMDFCWLCNPNNPDGRLLQRTEILRLLNDHPDTFVLDQSYVSFTTEEVIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLGVEVHPSGTTFFLLRLKKAAELKKYMLEEYNMLIRDAS-ESYVRITTQRPAQNQLFIKALETFLEKYEG......... 344
15 -80.2001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  22  11.............NIREPATVLGISPDQLLDFSANINPLGMPVSVKRALIDNLD----CIERYPDADYFHLHQALARHH------QVPASWILAGNGETESIFTVASGL--KPRRAMIVTPGFAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSNLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAMARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLTVYPGRANYLLLRCEREDIDLQRRLLTQRILIRSCA-SRYYRVAIRSAAQNERLLAALRNVLTGIAPA........ 363
16 -54.2003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  16  1.....MVKLENSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMSYCWFLEPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEGD----------AWGFDKKGPYIELVTSPNNPDGTIR--ETVVNRPDDDEAKVIHDFAYYWPHYTP-----ITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKKMVIVNSIGVSKESQVRTAKILNSENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKEETDLVSELRRHKVMSRAGE-KKHVRVSMLSREDVNVFLERLANMKLIKSID........ 390
17 -46.5001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  21  18.............AVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYA--PPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETEEGFVPDPERVRRAI-TPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSS--SPDTIAQWATLEALASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLPIAPDEVRAAERLLEAGVAVTDFAAFGHVRLSYATSEENRKALERFARVLGR............ 384
18 -46.4002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  19  12.............VVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTT--YGYLKSCTLPFLEEAARWYEGRYGVGLDPREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLREDGLADLKAVPEGV-WREAKVLLLNYPNNPTGAVADWGYFEEALGLARKWLIHDNPYVDYEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGDFNQYAGVLRMGVEALKPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEDDLEFGLRLVERGVALAP-GGKGFVRIALVRPLEELEAAKRIREALD............. 376
19 -45.8003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  17  21........................PKKRGLDLGIGEPQFETPKFIQDALKNHTH----SLNIYPKSAFESLRAAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPS--LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKILINDECYSEIYENTPPPSLLEEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRA-YTSANAIQKASEAAWLDDRHAEFFRNIYANNLKLARKIFKNT---LIYPYSFYVYLPVQNGENFAKTLYQNEGIITLP---ADYVRLALVYDTPLEKPLEIIETYREN............ 374
20 -45.7002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  15  7.GLVPRGSHMISNKLANIPDSYEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPEN--QKYAFHGKEAFKQAIVDFYQRQYNVTLDKEEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEPPYLPDWSKVDSQI-IDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGKIVHDFAYGAFDAKNPSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTNAGMFGALQDAAIYALNHDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVTPPGYDSEQFEQFLVQEKSILVAPGKNRYVRISLALDDQKDEAAIRLTELAYL............ 396
21 -44.9003ele_A mol:protein length:398 Amino Transferase  ali model follow..  20  35..........................ENVYDFSIGNPSIPAPQIVNDTIKELVTDDSVALHGYSAQGDVETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADTEFQIDFDALEERI-NAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKFIIADEPYREIVYDGIKVPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAA-VCAPSLFQKMIVKCQG----ATGDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMF-LEDDSNAFCEKAKEEDVLIDGFGCPGWVRISYCVDREMKHSMPAFEKIYKK............ 395
22 -44.6005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  15  6............QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELPVLWAESEQRPVQQIESEAHQAYFTLLG-QHGYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGADLSAEL----LSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEVLALDTSFRGFDAHYDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDIGVSPLILALIREFSRDDGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVERVGRTGTEVWEELQRHHVFALP---DHMVRIALSRSTEPEKSVQVLRTVLETR........... 376
23 -44.5003jtx_A mol:protein length:396 aminotransferase  ali model follow..  20  2..........MNTLLKQLKPYSAPEGMEAVPLHIGEPKHPTPKVITDALTASLHEL----EKYPLTAGLELRQACANWLKRRDGLTVDADEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANCPAPFNPDWRSISEEV-WKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKIIASDECYSEIYFDGQAAAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRT-SAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGDDLAFARWQKAAIQVLP---EGYVRIALVADVATVKAAEDIVSLYR............. 396
24 -44.3001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  21  1MALSDRLELVSASEIRKLFD-IAAGMKDVISLGIGEPDFDTPQHIKEYAKEALDKGLTHYG--PNIGLLELREAIAEKLKKQNGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTEDEFRLNVDELKKYV-TDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEIVISDEVYEHFIYDDASIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQM--CPVTFIQYAAAKALRSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFDTGLTSKKFSELMLKEARVAVVPGSEGYVRISYATAYEKEEAMDRMERVLKE............ 385
25 -44.2004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  19  29.......................SDIPDVLKLTLGEPDFATPKHIKEAAKRAIDADESHYT--GMAGLLALRQAASAFVKEKYHLTYNPDEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTRSNFVLTPEMLEEAIEGEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKFVISDEVYAELTTGESHVSIAEYLPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQ--AATTSVQFAAIEALTNKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIF-QGQDSFKFLQDFAKEKAVAFIPGVEGYLRISYAASMETKEAMKRLKEFMEQ............ 390
26 -44.2002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  19  1MGSDKIMDVFSDRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYE----NKPEVVYYHSAGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERFLIVDEVYSEIVFRGEFASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKQGRLAPPLLEQIGSVGLLNDDSFFDFVRETYRERVETVLKKLEEHG--TKPSGAFYITAELPEDAEEFARWMLTDGFYLTPGLGKKEIRIACVLEKDLSRAIDVLMEGLKMFCSSRIS..... 402
27 -44.0001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  18  1MRLHPRTEAAKESIFPRMSGLAQRL--GAVNLGQGFPSNPPPPFLLEAVRRALGRQ----DQYPPAGLPALREALAEEFA------VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDEGFRLDLSALEKAL-TPRTRALLLNTPMNPTGLVFGERELEAIARLARAFLISDEVYDELYYGERPRRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQSFSAPTPLQAGVAEALKREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLM-AELPGWDAFRLVEEARVALLEDPPKDLFRFAFCKTEEEHLALERLGRVVNSPREAEGGAVS.. 380
28 -44.0002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  17  4.KRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGKTHYT--DSRGILELREKISELYKDKYKADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDFTVE--------LEEALSDKTKAIIINSPSNPLGEVIDRE-IYEFAYENIPYIISDEIYNGYEGKCYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLSAPTISQYAALKAFEKEREINSMIKEFDRRRRLVLKYVKDFGWEVNPIGAYYVFPNIGEDGREFAYKLLKEKFVALTPGIKNYIRISYANSYENKEGLERIKEFLNK............ 370
29 -43.9003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  17  6.SSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETDALGYT--VALGLPALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPV--PADFAGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQASFISDEIYHGIEYEAKAVTAL-ELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMCAPHASQVAALAALDCDAELQANLDVYKANRKLMLERLPKAG--APPDGAFYVYADVSDDSRAFAAEILEKGLDFDPERGAGTLRFSYARATADEEGLDRLEAFMQA............ 381
30 -43.5001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  20  22.............ELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVKYT--DPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETSKNFQPSLEEVEGLL-VGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKYIISDEVYDSYTDEFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQS--CINTVAQYAALKALEVDN--SYMVQTFKERKNFVVERLKKMGVKFVPEGAFYLFFKVRGDDVKFCERLLEEKKVASAFLKPGFVRLSFATSIERTEALDRIEDFLNS............ 382
31 -43.4001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  15  34.......................AAQYKPLNLGQGFPDYHAPKYALNALAAAANSPDPLANQYRGFGHPRLVQALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKADWVLDNNELEALF-NEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKLCVSDEVYEHMVFEPFRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQVYTCATPIQEAIAVGFETECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVDARKDYRFTKWMTKSVGLQGIPPSAEDFVRYCFFKKDENQKAAEILRKWKGSS........... 429
32 -43.4003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  18  30.QRAGTIDVQRNENFGKLRA-EKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLAEGYSGYAEQGQGALREAVASTFYGH--AGRAADEIFISDGSKCDIARI-QMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCFPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKILVYDAAYALYISNPDCPKTIYEIPEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCGASNIVQAGGLACLQPEKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIFPGKPSWDVFAEILERCNIVTTP---EGFVRASAFGSRENLEAVRRFKEAYGKRNAS........ 443
33 -43.0005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  15  21.......................AADPSVVNLGQGFPDISPPSYVKEELSKAA--FIDNMNQYRGFGHPALVKALSCLYGKIYQRQIDPNEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSDWTFDPRELESKF-SSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKLCISDEVYEWLVYTGHTHVKIATLPERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQFYTCATPLQAALAEAFWIECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIDEPYDYKFVKWMTKHKKLTAIPVSAEKLVRFCFIKKDSTDAAEEIFRAW............... 410
34 -43.0004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  17  7.GLVPRGSHMSSLRPRREDPHLGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVVMDDS--VSQGGEGVRRAIADRYA-----GGDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGVRDGEIDPDVLAGLV-TPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAAVLVWDAATAEIAHRWEVLADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRTTLFLSPLVELVAERAVRHDELIGARAAEARHNLAHLTGWMAAHE--TPPEGGVCALPVFREEVERFCLELLERRTLLTAFGAPHGARLGFGGPQEDRAGLDGLSRFLRERAAGR....... 400
35 -42.8003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  15  32.NTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALD--IPMVNQYPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPIGEEWTIDFEQFEKAI-TSKTKAVIINTPHNPIGKVFTREELTTLGNICVKVIISDEVYEHLYFTDSFTRIATLSPQLTLTVGSAGKSFAATGWRIGWVLSLNELLSYAAKAHTCFASPSPLQEACANSINKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLNKGKDFRISHWLINELGVVAIPPTEENLLRFAVCKDDAYENAVERLKLLKDY............ 446
36 -42.8006DK6 Entity 1(prereleased)  ali follow..  17  11.LKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDELGSTFKGYPEQGYDFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYNGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYAREVLLYDAAYEAFIQDPTIPHSIFEIEDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQ-GASYIVQKGAEALYTDKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVCPAGLTSWQMFDKMLNEANVVITPGSEGYFRISAFNSRAN--VEEVCRRIAA............. 409
37 -42.5003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  17  23..........QSAAGLEALIRGAPIEGRPVDFSHGDVDAH-EPTPGAFDLFSAGVQSGGVQAYEYRGDLGIRDLLAPRLAAFTGAPVDADGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDTRAGLDLTGLEEAF-KAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARTVIADQLYSRLRSYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQASLRAAGYSQAVLRGWFDEPGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFKLAVAPAEFVKILRLQAGVVVTPG-ADSVRLNFSQDHEAVAAARRIVTLVERYRA......... 407
38 -42.4003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  14  28..........IRDLVALVTNLEKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVA--SIYPNLDGLELKQEASRFAKLFVNIDIPARACVPTVGSMQSFLVANRTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLRKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKIVIEDLAYFGMDFRKDYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDALSSGATHSAQWGMAAMLDGEYNFRDSVIEYGRKARIMKKMFLDNGFNIVPLADGFYFGYKGMDSSKLIEKFVRYGMCAITLKTNEAMRICTSLLPESPDLEKRLQMLNAEG........... 437
39 -42.0002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  20  12.ARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQR--EDTHGYTSRGIPRLRRAISHWYRDRYDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLGIDFFNELERAIRES-IPKPRMMILGFPSNPTAQCVELDFFERVVALAKQMVVHDLAYADIVWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSDYGTFTPLQVAAIAALEDQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVW-AHLGSLEFAKKLLQDAKVSVSPGIDDHVRFALIENRDRRQAVRGIKAMFRADGLLSPQRKVDS 409
40 -42.0002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  18  57...........................QVISLGIGDTTEPIPEVITSAMAKKAHELSEGYSGYAEQGAKPLRAAIAKTFYG--GLGIGDDDVFVSDGAKCDISRL-QVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKIIVYDSAYAMYMSDDNPRSIIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCGASNISQAGALACLTPEEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVFPNQSSWDVFAEILEKTHVVTTP---EGFVRVSAFGHRENLEACRRFKQLYK............. 426
41 -41.7005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  18  1MTDRVALRAGVPPDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYS--VALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDARLISDEVYHGLVQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFCPPVLSQIAAVSAFTPEAEADGNLASYAINRSLLLDGLRRIGIDRLTDGAFYVYADVSDDSLAFCSKLLADGIDFDTARGGSFVRISFAGPSGDEEALRRIGSWLPSQ........... 388
42 -41.6004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  15  1.....MAKQLQARRLDGIDYVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLSSNWQLDPMELAGKF-TSRTKALVLNTPNNPLGKVFSREELELVASLCQQVCITDEVYQWMVYDGHQHISIASLPERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQVFHCPTQSQAAVAESFERSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLIDEPYDRRFVKWMIKNKGLVAIPVSIDHYIRFCFVKDEATQAMDEKLRKWKVELENLYFQGKGGR 433
43 -41.6006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  10  29.............DLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAE---EGLQATYEKRFTEAFFQLHRQP--TALVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVFYDVDRIYPELER-RVRTDALFLVDPNNPTGFSLLREEVVRFCKDHDKLLLIDFCFASFTLFEDMYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHT-LNVSPFVLNMLTQYVRDADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAHPELTATDVHRLLSADGVYVLP---DAYVRMALAREPEMADAMALTRQVLDR............ 404
44 -41.5001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  18  1...MTNNPLIPQSKLPQLGTSALAQQHQAINLSQGFPDFDGPRYLQERLAHHVAQ---GANQYPMTGVQALREAIAQKTERLYGYQPDADDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPHFRVDWQEFAALL-SERTRLVILNTPHNPSATVWQQADFAALWQAIAGFVISDEVYEHINQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQTFSVNTPAQLALADMLREPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLSTLDDVEFCQWLTQEHGVAAIPLSVHKLIRLCFAKKESTLAAAERLRQL............... 386
45 -41.0001xi9_A mol:protein length:406 putative transaminase  ali model follow..  22  19.............DVVLPARELEKKGIKVIRLNIGD-DFQPPEHMKEAYCKAIKE---GHNYYDSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTEEDWQPDIDDIRKKI-TDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEPVISDEIYDLMTYEGEHISPGSTKDVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRRIRLCPNTPAQFAAIAGLTPMDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIF-PWKNDKEFVLDVLHNAHVLFVHG-AGHFRAVFLPPIEIEEAMDRFEKFMKERLKE........ 400
46 -40.8002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  18  1MATVSRLRPYATTVFAEMSALATRI--GAVNLGQGFPDEDGPPKMLQAAQDAIAG---GVNQYPGPGSAPLRRAIAAQRRRHFGVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLGRGFALDADALRRAV-TPRTRALIINSPHNPTGAVLSATELAAIAEIAVAVVITDEVYEHLVARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQSYVGGAPFQPAVALALDEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCGYDDSTEFCAALPEKVGVAAIPMSANHLVRFTFCKRDDTDEAIRRLSVLAERPATGVPRG.... 403
47 -40.4003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  16  27..........................VSISSLTLEE-LFALSGTNPEDFYKKLQGTKLNYG--WIEGSPAFKKSVSQLYT-----GVKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEEWLPDLEKLRQLI-RPTTKMICINNANNPTGAVMDRTYLEELVEIASEYILSDEVYRSFSELD--VPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRTMICAGVFDDLVAQLALAHQEILERNRHILEENLAILDQWIEEELVSYIRPAVVFVKIAVDMPMEDFCLQLLQEGVLLNRFERDGYVRLGFACEQETIKGLEKLSQFLRR............ 370
48 -40.3004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  16  71...........................QLISLGTGDTTEPIPEQITSHMSNFAHGLSEGYRGYLEQGNKTLRKAIAETFYRD--LHVKSNEVFVSDGAQSDISRL-QLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTIIIFDSAYAAFIEDGSPRSIIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSGASNIAQAGGLACLSSLKEIRSVNNYYKENRKILMDTLVSLGLKVYGVNAPYLWVHFKGKSWDVFNEILENTHIITVPGSEEYLRISGFGRRDHVEASKRLQNFFNTRTKHFTYLSSTS 453
49 -40.3001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  16  17.............IIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGKTRYG--PAAGEPRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTETQFKVSPEQIRQAI-TPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEWVLSDEIYEKILQHLSIGAASPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQG--NVCTFAQYGAIAAYESQDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFKTGRSSLDFCSELLDQHQVAAAFGADDCIRLSYATDLDTKRGMERLEKFLHG............ 386
50 -40.1004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  19  28.SKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGN-PAPFGFDAPDEILVDVIRNLPTAQGYDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCSSDWFPDLDDIRAKI-TPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQIIFADEIYDKILYDDAEHHSIAPLAPDTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEMRLCANVPAQHAIQTALQSISEFITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFNIHDDQKMVLDFLLQEKVLL-NWPWPDHFRIVTLPRVDDELSLSKFARFLSG............ 421
51 -40.1001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  16  36........................NTNGIIQMGLAENQL--KNPEAAAFKKNGESIFAELALFQDYHGLAFKKAMVDFMAEGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRGVEIVPIHCSNGFQITETALEEAYQELRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDHLISDEIYSGTASSPSFISVMEEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGVSSQTQHLLSAMLSDKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWNTFEAEMELWKKIVYEHLNISP-TEPGWFRVCFANLPERDLAMQRLKAFVGEYYNVPEVNGGSQ 443
52 -39.5005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  18  86.............VITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIRE---GFTRYLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTSNNFLLDPKDLESKL-TEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKLVLSDEIYEHIIYAPASFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQG--GASSIAQKAGVAALGLGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFGLINDSSSLALYFLDKFQVADAFGDDSCIRISYATSLDVQAAVEKIRKALEPLRATVS...... 474
53 -39.3001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  18  30.......................PSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEDSQECNGYPTVGSPEAREAVATWWRNELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCENDWEADLDEIRRLK-DDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEEPLFSDEIYAGFKGKDPNATFTSETTVPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGM--PCTVVQAALGEALLNPQEHLDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMDIKTDVEFFEKLLEEENVQVTIFHAPGFTRLTTTRPVEVREAVERIKAFCQRHAA......... 415
54 -38.9003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  17  35.............AIVDNMKVKPNPNKTMISLSIGDGNLPTDPEVTQAMKDALDS--GKYNGYPSIGFLSSREEIASYYHCP-EAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLEKSWEIDLKQLEYLI-DEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARPILADEIYGDFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLGPCTIVQGALKSILCRGEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMEFENDVEFTERLVAEQSVHCTCFEYPNFIRVVITVPEVMLEACSRIQEFCEQHYHC........ 421
55 -38.7003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  21  30.......................NPQHTVINLSIGDTTQPLNASVAEAFASSIARSPTTCRGYPDFGLPALRQKLSEDFYRGF---VDAKEIFISDGAKVDLFRLL-SFFGPNQTVAIQDPSYPAYLDIARLTGAKEIPCLQENAFFPEFPE------DTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIELILFDAAYSTFISDPSLPKSIFEIPFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTGASIPAQEAGVAGLSILPQ-LEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWQANISDRDLFDFFLREYHIAITPGISGFVRFSSLGKREDLAACERLQMAPAL............ 392
56 -38.6003if2_A mol:protein length:444 Aminotransferase  ali model follow..  15  2MKFSKFGQKFTQPTLMDDLGDALKSDQPVNMLGGGNPAKIDAVNELNDTGKANSSAIISMANYSNPQGDAFIDALVGFFNRHYDWNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEYRVDFEALLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRPLIIDNAYGMPFPNIIYSDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLTRFGAAIATPLVANDRIKQLSDNEIKPFYQKLKQALGDYPLMIHKPEGAIFLWDLPISTLDLYERLKAKGTLIVP---HECIRMSIAADEQTIDGIKVIGEVVRELYDNK....... 444
57 -38.2003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  17  18.............AIVDNMKVKPNPNKTVISLSIGDGNLPTDPEVTQAMKDALDS--GKYNGYPSIGYLSSREEVASYYHCP-EAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLEKSWEIDLKQLESLI-DEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERPILADEIYGDFSDCKYEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLGPCTIVQGALKSILQRQEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMEFENDVEFTERLIAEQSVHCTCFEYPNFFRVVITVPEVMLEACSRIQEFCEQ............ 400
58 -38.1003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  18  29........................RTPGAIMLGGGNPAHIPAMQFQTLLTDMVEKAADALCNYGPQGKTALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFVSAEGQFKYHVDFEHLHI-GEETGMICVSRPTNPTGNVITDEELMKLDRLANQPLVIDNAYGVPFPGIIFSEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLGGMGPAMMCEMIKRNDLLRLSETVIKPFIAIIRRYLSEERCLIHKPEGAIFLWDLPITTELLYQRLKARGVLMVP-HTHQCMRMNYVPEPDKEAGVKILAEEIERAWREG....... 417
59 -37.9001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  15  34........................NPNGVIQMGLAENQL-IKRNPKGSICSEGIKSFKAIANFQDYHGLEFRKAIAKFMEKTRGVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRGVQLIPIHCENNFKITSKAVKEAYENIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHLVCDEIYVSIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSNDDVVNCARKMSSFGLVSTQTQYFLAAMLSDDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWSTFDSEMSLWRVIINDVKLNVSPG-PGWFRVCFANMDDGDIALARIRRFVGVEK.......... 428
60 -37.5004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  18  57......................SRSTKSNLRLSIGDGNLKTPDIVTEAMVDVVRS--GKFNGYPTVGADNLRQVVSTYWRRFCQTALKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLSKSWECDLRAAAGMV-DSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQPLISDEIYAEMVLNNGIFTSVADFDTPRLILGGTAKYQVCPGWRVGWSILIDDWAVGMERLQLIAGVNSICQEAIARTLLKTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMDLKSDMEFYEKLLDEENVQVEIFGMSGFLRATVSRPSAVNEAVDRIIEFCERHKK......... 438
61 -37.5001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  11  55.........................QGCSADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFFNPVSELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNANYVNVSNPEQYIEMVTSPNNPEGLLRHAVI--------GCKSIYDMVYYWPH-----YTPIKYKADEDILLFTMSKFTGHSGSRFGWALIDESVYNNLLNYMTTEGTPRETQLRSLKVLKERDLNTFGFKKLRERWVNITALLDQSDRRMRPPSPSYAWVKCEWEEDKDCYQTFQNRINTQNFEASRYVRLSLIKTQDDDQLMYYLKDMVKAKRKTPLIKQ... 433
62 -37.3003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  13  48...............................IHDEEGNLVFLKTVKEEYLSLSDS---EHVGYPIAGIPDFLCAAEKECFGNFRPE-GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLDEHNNFNHEAFQNRVNEQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDIIGIDVAYLDYSGERAFFNKFSHLPKEICVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNNICRPAMRTMANIVADEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTDSANAICEELKKEHIYV--IALANGIRIAACPKCQMTGLAEKIYNAMKS............ 414
63 -36.7004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  15  23..........INNKANAAIEKYGREAVINAALGTLLDDKGKIIALPSVYDRLDEMDRSHIASYPIEGEKDYRKIVIDTLFGPYKPE-GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFTDDFAFNIDVYKEAIDESDRIASLINSPNNPTGYSLSDEEWDEVITFLKETLIVDVAYLEFAGDRKFFEKFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGSKEIIEEFEAARCNWSNGTHAAQNILIELEREQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPTDKAFDIVKDLEKENIFT--IPSAKGIRVAICGEEKIPKLVQRLAFYTNKK........... 413
64 -35.8003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  13  77YINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVANNYPV----PDRCLVNTEKIINYFLQELSYKDAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLKNDWEIEPNEIEKLK-DPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKMIISDEVYGAFV---NFKSIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLD-LRQLHKRYSSVVLCADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLNNFEQVDFLLKLAEKNGVVLVD---PGELRVSQANLPTEALIGKQVLELLKEYYEEFKQNN... 533
65 -35.7002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  16  1.GAMNPLAQSLNEQLQQSNAQSAEAKSTTYNATIGMATNKDGKMFASSLDAMFNDLTDEIFPYPPQGIEELRDLWQQKMLRDNP---NMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQT-FDKDGHYTTDSLVEALQSKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKAIAVVDDAYYGLFYEDTALTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKEVLEAKVSGPLPTQSAVKHVLKNNKQFDKEIEQNIQTKEVVYADQYHSHWQAYDFNSGYFMA-HDVDPEALRKHLIDKYSIGVIALNATDIRIAFSEKDDIPHVFDSIAKAIDD............ 428
66 -35.5003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  14  104..........................GKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPV----PPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMSMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIALNWQYPDSELDKLK-DPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEMILTDDVYGTFAD--GFQSLFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLP-KTALDDRYRSLLPDDESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLKQSSTGDMLFRIADETGIVLLP-SDRPSGRASLANLNEYAAIGRALRQMADELYAQYTQQGNKR 533
67 -35.3003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  13  85..........................PDLLQREEIKTLF-SADSISRAKQILAMIPGRATGAYHSQGIHGLRDAIASGIASRDGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESWGLETSDVKKQLEDANVRALVVINPGNPTGQVLAEENQYDIVKFCKNVLLADEVYQEYVDNKKFHSFKKEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASYKAEKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFNKAPDAFYALRLLESTGIVVVP---TWHFRCTILPQEDKPAVISRFTVFHEAFMSEYRD..... 490
68 -35.0002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  12  103..........................GKSLSYVRDQLGLDPAAFLHEMVDGILG------CNYPVPPRMTVSEQIVRQYIVREAVPPESVDLFAVEGGTAAMSLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIDNGWQYSDAELDKLK-DPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAELILTDDVYGTFAD--EFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLQQSSTGDMLFRVADETGIVLLP-SDRPSGRASLANLNEYGRALRRLADELYEQYKALGKEK... 532
69 -35.0003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  14  14..............LGLADLFRADERPGKINLGQGETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYAENHTLDFDALINSLNQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVELPLFDFAQQGFARGLEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMNPPAHGASVVATILSNEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKMFSFSGLTKEQVLRLREEFGVYAVASG-----RVNVGMTPDNAPLCEAIVAVL.............. 396
70 -34.9004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  15  1MAMFEHIDAYPGDPILTLENFQKDPRDQKVNLSIGIFDAEGRIPVMGAVREAETALQRD-KPYPMVGLAAYRDAVQSLVFGADHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYEATGGLKFDAMLAAIDPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEALPFVDMAYQGFGAGLDAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIGLRDHVSGEALMFTYTGLTESQVDALREVHGVYILRSG-----RMCVANDSNVGIVADAIGKVLKSGA.......... 402
71 -34.3003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  17  92...................................DSPSFPEDAKKRARRILQACGGNSLGSYASQGVNCIREDVAAYITRRGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEEWALNVNELRRAVQEADPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEFLLADEVYQDYSPDCRFHSFKKVLYEELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMD-SREKESVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFQMAPDMFYCMKLLEETGICVVP---TYHFRMTILPPVEKKTVLQKVKDFHINFLEKYA...... 492
72 -34.1004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  16  10..............LGLGQDFRMDPAKRKVNLSIGVRDDADQPFVLECVKQATLGTNMD---YPVTGIASFVEEAQKLCFGPTCAALRDGRILGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYPATKGLNLAGMLECLDKEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRIPFVDMAYQGFATGQ-VPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLELKACGSVHDWMMAYTGLTREQVELLRSEYHIYMTLNG-----RAAVGLNSTNEYVSQAIHNVTK............. 390
73 -34.1004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  11  3VGTFENITAAPADPILGLDLFRADERPGKINLGIGVYKETGKTPVLTSVKKAEQYLLEN-KNYGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYAENHTLDFDALINSLNEAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVELPLFDFAYQGFARGLEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMNPPAHGASVVATILSNEQELTDMRQRIQRMRQLFVNTLQEKGANFSFIIKQNGMFSFSGLTKEQVLRLREEFGVY----AVASGRVNVGMTPDNAPLCEAIVAVL.............. 400
74 -33.9002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  14  105...........................KSLSYVRDQLGLDPAAFLHEMVDGILGCNYPV----PPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAISLNWQYPDSELDKLK-DPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEMILTDDVYGTFAD--DFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQ-KVALDHRYRSLLPDDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLKQSSTGDMLFRIADETGIVLLP---RPSGRASLANLNEYYAAIGRALRKMADELYAEYSGQAQN 532
75 -33.9004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  17  16MSLFSAVELAPRDPILGLEAFNADTRPTKVNLGVGEDGKIPLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVLGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYAKTNGVNFDGMLAALNGPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKAVPFLDIAYQGFGESIEAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLRLKAAGIERDFMFSYSGLTSAQVDRLREEFGIYAVSTG-----RICVANTRNLDVVANAIAAVLK............. 414

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.