current user: public

If you have questions about the server, please let us know.

Query: 3dyd_A mol:protein length:427 Tyrosine aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MSSGVDLGTENLYFQSMWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYYHCPEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQHYHCLast
1 -110.0003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model  100  1MSSGVDLGTENLYFQSMWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYYHCPEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQHYHC 421
2 -105.0003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  94  1.................WNVRPSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPTVFGNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYYHCPEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILQRTPQEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLIAEQSVHCLPATCFEYPNFFRVVITVPEVMMLEACSRIQEFCEQHY.. 402
3 -102.0004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  35  15MGRDLYDDDDKDRWTSFRRIASSKHAQRTLQPLNNLTD-NMKPSRSTKSNLRLSIGDPTVDGNLKTPDIVTEAMVDVVRSGKFNGYPPTVGADNLRQVVSTYWRRFCEALKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDTNVPRLILGGTAKYQVCPGWRVGWSILIDPMNVA-GDWAVGMERLTQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSYFQDLKSDMEFYEKLLDEENVQVLPGEIFGMSGFLRATVSRPSAVLNEAVDRIIEFCERHKK. 438
4 -96.4001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  39  2...............SSWDVSMSNHAGLVFNPIRTVSDNAK-PSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDFTSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYVDPHGNG-PSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYRDIKTDVEFFEKLLEEENVQVLPGTIFHAPGFTRLTTTRPVEVYREAVERIKAFCQRHAA. 415
5 -94.3004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  22  12......TENLYFEGAMSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPF-GFDAPDEILVDVIRNLPTA--QGYCDSKGLYSARKAIMQHYQARGRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHA-KGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSSEFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRF-NIHDDQKMVLDFLLQEKVLLVQGTAFNWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQ. 424
6 -91.6005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  20  56....AKPNDAETLSSSVDMSLSPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEP----DFDTPKVVAEAGINAIREGF-TRYTLNAGITELREAICRKLKEEGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHTSFASLDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQ------GQVSSGASSIAQKAGVAALGKAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYGSEINDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLQAAVEKIRKALEPLRAT 472
7 -91.6001xi9_A mol:protein length:406 putative transaminase  ali model follow..  28  3..................SIRASKRALSVEYAIRDVVLPARELEKKGIKVIRLNIGDPVKF-DFQPPEHMKEAYCKAIKEGH-NYYGDSEGLPELRKAIVEREKRKGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEG-EHISPGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPENK-LSEVREAIDRLARIRLCPNTPAQFAAIAGL-TGPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGPW---KNDKEFVLDVLHNAHVLFVHGSGFGGAGHFRAVFLPPIEILEEAMDRFEKFMKERLK. 399
8 -90.6001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  22  3....................LAARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEP----DFNTPKHIVEAAKAALEQGK-TRYGPAAGEPRLREAIAQKLQRDGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAAEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQ------GHSTSNVCTFAQYGAIAAY-ENSQDCVQEMLAAFAERRRYMLDALNAMPGLECPKPDGAFYMFPSIAKTG----RSSLDFCSELLDQHQVATVPGAAFGADDCIRLSYATDLDTIKRGMERLEKFLHGI... 387
9 -89.5001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  23  1.............MGSDKIMVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEP----DFPTPEPVVEEAVRFLQKGE-VKYTDPRGIYELREGIAKRIGERKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQ------SHTTSCINTVAQYAALKALEVDNSY----MVQTFKERKNFVVERLKKM-GVKFVEPEGAFYLFFKVR-------GDDVKFCERLLEEKKVALVPGSAFLKPGFVRLSFATSIERLTEALDRIEDFLNSR... 383
10 -88.2005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  21  4....................RVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQP----SAGAPEPVRAAAAAALHLNQ-LGYSVALGIPELRDAIAADYQRRGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCA-WQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTG------NFTICPPVLSQIAAVSAFTPEATAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDFT----SDSLAFCSKLLADTGVAIAPGIDFDGGSFVRISFAGPSGDIEEALRRIGSWLPSQ... 388
11 -87.8001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  25  4....................LSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEP----DFDTPEHVKEAARRALAQGK-TKYAPPAGIPELREALAEKFRREGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVA--PEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVS------SQSTTSPDTIAQWATLEALTEASRAFVEMAREAYRRRRDLLLEGLTAL-GLKAVRPSGAFYVLMDTSPIA----PDEVRAAERLL-EAGVAVVPGTDFAAFGHVRLSYATSEENLRKALERFARVLGR.... 384
12 -86.2003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  18  2..................SLKNSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQP----GTGAPRGAVEALAKSLETDA-LGYTVALGLPALRQRIARLYGEWGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAV---TALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQ------NMFICAPHASQVAALAALD--CDAELQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVSDLT----DDSRAFAAEILEKAGVAVTPGLDFDGAGTLRFSYARATADIEEGLDRLEAFMQARGEG 385
13 -86.0002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  23  1...................MLSKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEP----DFNTPKPIVDEGIKSLKEGK-THYTDSRGILELREKISELYKDKKADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF--------TVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEGKCYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQ------NLFISAPTISQYAALKAFEKETEREINSMIKEFDRRRRLVLKYVKDF-GWEVNNPIGAYYVFPNIG-------EDGREFAYKLLKEKFVALTPGIGFGGKNYIRISYANSYENIKEGLERIKEFLNK.... 370
14 -85.8003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  20  13...TNLMSTSRPKVVANKYFTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFF----SYSPPQFAIKEAQKALDIPMVNQYSPTRGRPSLINSLIKLYSPINTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSEIGQLTLTVGSAGKSFAATGWRIGWVLSLNAEL-----LSYAAKAHTRICFASPSPLQEACANSINDAKIGYFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIPEKGKDFRISHWLINELGVVAIPPTEFYAENLLRFAVCKDDAYLENAVERLKLLKDYL... 447
15 -85.3001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  23  3....................LSDRLELVSASEIRKLFDIA----AGMKDVISLGIGEP----DFDTPQHIKEYAKEALDKGL-THYGPNIGLLELREAIAEKLKKQGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQM------YNATCPVTFIQYAAAKALKDERSKAVEEMRKEYDRRRKLVWKRLNEM-GLPTVKPKGAFYIFPRIRDTG----LTSKKFSELMLKEARVAVVPGSAFGGEGYVRISYATAYEKLEEAMDRMERVLKERKL. 388
16 -84.6002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  22  1...........MGSDKIMDVFSDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQP----DLKTPEVFFERIYENKPE--VVYYSHSAGIWELREAFASYYKRRRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIP-QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEFASALSI--ESDKVVVIDSVSKKFSACGARVGCLITRNEE------LISHAMKLAQGRLAPPLLEQIGSVGLL-NLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPV------EDAEEFARWMLTDETTMVAPLRGFYGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCSS 399
17 -83.2002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  18  10....................RFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNP----DGPTPPHIVEKLCTVAQREDTHGYSTSRGIPRLRRAISHWYRDRDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQVGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIK------SYHDYGTFTPLQVAAIAAL-EGDQQCVRDIARQYQQRRDVLVKGLREA-GWMVENPKASMYVWAKIPEPYAH--LGSLEFAKKLLQDAKVSVSPGIGFGGDDHVRFALIENRDRLRQAVRGIKAMFRADGLL 401
18 -83.1003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  18  3...............SIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGARPVDFSHGDVDA--HEPTPGAFDLFSAGVQSGG-VQAYTEYRGDLGIRDLLAPRLAAFGAPVDADGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDDETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEADAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQA------IVSLRAAGYSQAVLRGWF-DEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAV----APAEFVKILRLQAGVVVTPGTEFSTADSVRLNFSQDHEAAVAAARRIVTLVERYR.. 406
19 -82.6004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  19  5....................LSKRFNKNLNKIEVSMIRQFDQSISDIPDVLKLTLGEP----DFATPKHIKEAAKRAIDADE-SHYTGMAGLLALRQAASAFVKEKHLTYNPDEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDT-RSNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEY-LPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQ------YLVTAATTSVQFAAIEAL-TNGKDDALPMKEEYIKRRDYIIEKMEAM-KFKIIKPDGAFYIFAKIPVAQ----QDSFKFLQDFAKEKAVAFIPGVAFGGEGYLRISYAASMETIKEAMKRLKEFMEQYAD. 393
20 -82.5004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  19  5...................LQARRLDGIDYNPWVEFVKLAS-----EHDVVNLGQGFP----DFPPPDFAVEAFQHAVSGDMLNQYTKTFGYPPLTKILASFFGELGQEIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQ------NSVFHCPTQSQAAVAESFERQPSSYFVQFPQAMQRCRDHMIRSLQSV-GLKPIIPQGSYFLITDISDFKRKDEPYDRRFVKWMIKNKGLVAIPVSIFYFDHYIRFCFVKDEATLQAMDEKLRKWKVELENL 425
21 -80.9001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  18  1......MSSTSNETMHNKFDLPKRYQGSTKSVWVEYIQLAA-----QYKPLNLGQGFP----DYHAPKYALNALAAAANSPDANQYTRGFGHPRLVQALSKLYSQLDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQ------NCVYTCATPIQEAIAVGFEKSPECYFNSISGELMAKRDYMASFLAEV-GMNPTVPQGGYFMVADWSSLDSKDARKDYRFTKWMTKSVGLQGIPPSAFYGEDFVRYCFFKKDENLQKAAEILRKWKGS.... 428
22 -80.9002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  18  3.......SSSSGLVPRGSHMISNKLANIPDSYFGKTMGRK--IEHGPLPLINMAVGIP----DGPTPQGIIDHFQKALTIPENQKYGAFHGKEAFKQAIVDFYQRQNVTLDKEEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL-EPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQ------THTNAGMFGALQDAAIYAL-NHYDDFLEEQSNVFKTRRDRFEAMLAKA-DLPFVHAKGGIYVWLET-----PPGYDSEQFEQFLVQEKSILVAPGKPFGGNRYVRISLALDDQKLDEAAIRLTELAYLYE.. 398
23 -80.3001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  21  8....................PQSKLPQLGTTIFTQMSALAQ-----QHQAINLSQGFP----DFDGPRYLQERLAHHVAQG-ANQYAPMTGVQALREAIAQKTERLGYQPDADDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMAL-QPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQ------YLTFSVNTPAQLALADML-RAEPEHYLALPDFYRQKRDILVNALNES-RLEILPCEGTYFLLVDYSAVST---LDDVEFCQWLTQEHGVAAIPLSVFCADKLIRLCFAKKESTLLAAAERLRQL....... 386
24 -80.3002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  20  3....................TVSRLRPYATTVFAEMSALAT-----RIGAVNLGQGFP----DEDGPPKMLQAAQDAIAGG-VNQYPPGPGSAPLRRAIAAQRRRHGVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQ------YLSYVGGAPFQPAVALAL-DTEDAWVAALRNSLRARRDRLAAGLTEI-GFAVHDSYGTYFLCADPRPL---GYDDSTEFCAALPEKVGVAAIPMSAFCDPALVRFTFCKRDDTLDEAIRRLSVLAERPATG 399
25 -80.3002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  23  3.........................RVPEPSVFLVVDEAKRKARERGVGLIDLSIGST----DLPPPEAPLKALAEALNDPTTYGYCLKSCTLPFLEEAARWYEGRGVGLDPREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL--REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVK------GVIDFNQYAGVLRMGVEAL-KTPKEVVRGYARVYRERALGMAEALKGV--LSLLPPRATMYLWGRL-----PEGVDDLEFGLRLV-ERGVALAPGRGFGGKGFVRIALVRPLEELLEAAKRIREALD..... 376
26 -80.2005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  17  2....................NAKRIEGLDSNVWVEFTKLAA-----DPSVVNLGQGFP----DISPPSYVKEELSKAAFIDNMNQYTRGFGHPALVKALSCLYGKIQRQIDPNEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQ------NSFYTCATPLQAALAEAFWDDPECYFNSLPKELEVKRDRMVRLLNSV-GLKPIVPDGGYFIIADVSSLGADDEPYDYKFVKWMTKHKKLTAIPVSAFCFEKLVRFCFIKKDSTLDAAEEIFRAW....... 410
27 -80.1001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  24  3....................LHPRTEAAKESIFPRMSGLAQ-----RLGAVNLGQGFP----SNPPPPFLLEAVRRALGR--QDQYAPPAGLPALREALAEEFA-----VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPRRLREFA--PERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQ------WTSFSAPTPLQAGVAEALKARREGFYEALREGYRRRRDLLAGGLRAM-GLRVYVPEGTYFLMAELPG----------WDAFRLVEEARVALIPASAFYPKDLFRFAFCKTEEELHLALERLGRVVNSPREA 374
28 -79.9004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  18  27.......FEMKKLGGSTKLVRNVNLEKLKNNYLFPEINLEHIEKHPNVQLISLGTGDT----TEPIPEQITSHMSNFAHGEGYRGYGLEQGNKTLRKAIAETFYRD-LHVKSNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELLYSNGFINDFHRIVTTSFNGASNIAQAGGLACLSSGGLKEIRSVNNYYKENRKILMDTLVSL-GLKVYGGVNAPYLWVHFKGS------KSWDVFNEILENTHIITVPGSGFGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTKH 445
29 -78.7003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  19  1.....................GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEEL-----FALSGTNPEDFYKKLQGTK-LNYGWIEGSPAFKKSVSQLYTG----VKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELDVP----SIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRD------YTMICAGVFDDLVAQLAL-AHYQEILERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVKIAVD-----MPMEDFCLQLLQEHGVLLVPGNRFERDGYVRLGFACEQETLIKGLEKLSQFLRRFDK. 373
30 -78.7003ele_A mol:protein length:398 Amino Transferase  ali model follow..  20  1...............GMVVNESMYQLGSVRSAIRELFEYGKAAIVGKENVYDFSIGNP----SIPAPQIVNDTIKELVTDYDLHGYTSAQGDVETRAAIAEFLNNTGTHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADTE-HFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFVTKY--YDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGARALGYVCAPSLFQKMIVKCQG------ATGDINAYKENRDLLYEGLTRI-GYHCFKPDGAFYMFVKALE------DDSNAFCEKAK-EEDVLIVAADGFGCPGWVRISYCVDREMIKHSMPAFEKIYKKYNK. 398
31 -78.2003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  17  26.......QAVAQRAGTIDVQRNENFGKLRAGPEIARRRKAHQEKNPDAKIISLGIGDT----TEPLPKYIADAMAKAAAREGYSGYGAEQGQGALREAVASTFYGHA-GRAADEIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYANGEHADWNRVMTTCFNGASNIVQAGGLACLQPEGLKEMNAMIKFYKENAQILKTTFTEM-GFSVYGGDDAPYIWVGFPGK------PSWDVFAEILERCNIVTTPGSGYGGEGFVRASAFGSRENILEAVRRFKEAYGKRNAS 443
32 -77.9006DK6 Entity 1(prereleased)  ali follow..  17  7..................NFLKLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDV----TEALPEAVRYAMHEAVDESTFKGYGPEQGYDFLRNAIADNDYKAGLPIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQALHHSTKFNGASYIVQKGAEALYTDEGKSQTKALIEHYMGNAALLVEACKNA-GLSVFGGVNAPYVWVGC-----PAGLTSWQMFDKMLNEANVVITPGSGFGGEGYFRISAFNSRANVEEVCRRIAAL....... 410
33 -77.4003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  19  41......AGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPLDSP----SFPEDAKKARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLL-----SVRLCPPVSGQAAMDIVVNPPVREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGGTYHFRMTILPPVEKLKTVLQKVKDFHINFLE. 489
34 -77.1002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  18  12...ATPQEKIEYKTKVSRNSNMSKLQAGYLFPEIARRRSAHLLKYPDAQVISLGIGDT----TEPIPEVITSAMAKKAHIEGYSGYGAEQGAKPLRAAIAKTFYG-GLGIGDDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLYSDGFAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSL-GYDVYGGKNAPYVWVHFPN------QSSWDVFAEILEKTHVVTTPGSGFGGEGFVRVSAFGHRENILEACRRFKQLYK..... 426
35 -76.8003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  14  2......MNFPIDEKLIREKQNELHIKDLGMASIRDLVALVTNLKATGTKFCRMEMGVP----GLPAPQIGIETEIQKLREGVASIYPNLDGLPELKQEASRFAKLFNIDIPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDYSHPPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLEESSALYALSSGATHSAQWGMAAMLKNDGEYNFRDSVIEYGRKARIMKKMFLDVYDKDGNEPLADGFYFTVGYKGM-----DSSKLIEKFVRYGMCAITLKTTGSRNEAMRICTSLLESQFPDLEKRLQMLNAE.... 436
36 -76.3004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  18  3.......SSSSGLVPRGSHMSSLRPRREDPPVLEEWYRRH--LGPDIHDISSSGVHPY----SFAEIRDVCRIPAADLDAVV-MDDSVSQGGEGVRRAIADRYAG----GDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADPG--ADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRD------RTTLFLSPLVELVAERAVRH-ADELIGARAAEARHNLAHLTGWMAAHEEVRWTPPEGGVCALPVFRELERAAAQEVERFCLELLERHRTLLVPGTAFGAPHGARLGFGGPQEDFRAGLDGLSRFLRERAAG 399
37 -75.7003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  21  3....................RNPHFVSLTKNADLQKRVAQFRLENPQHTVINLSIGDT----TQPLNASVAEAFASSIARLSCRGYGPDFGLPALRQKLSEDFYRGF--VDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYADGHIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ---LEAIHYYRENSDLLRKALLAT-GFEVFGGEHAPYLWVKPTQANI----SDRDLFDFFLREYHIAITPGIGFGGSGFVRFSSLGKREDILAACERLQMAPALQS.. 394
38 -75.5003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  19  2....GTDDDDKMAATVAVDNLNPKVLKCEYAVRGEIVIHAQRLQEQLKEILYCNIGNPQSLGSADSISRAKQILAMIPGRA-TGAYSHSQGIHGLRDAIASGIASRGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDKKFHSFKKIEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIY----KIASVNLCSNITGQILASLVMNASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICAAKAANKAPDAFYALRLLESTGIVVVPGSGFGGTWHFRCTILPQEDKIPAVISRFTVFHEAFMS. 486
39 -73.5003jtx_A mol:protein length:396 aminotransferase  ali model follow..  17  2....................MNTLLKQLKPYPFARLHEAMQGISPEGMEAVPLHIGEP----KHPTPKVITDALTASLHEL--EKYPLTAGLPELRQACANWLKRRYDGLTDNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQARSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYR------TYHGSAMSIPVQRASIAAWDD--EQHVIDNRRLYQEKFERVIPILQQV--FDVKLPDASFYIWLKVPD------GDDLAFARNLWQKAAIQVLPGRFLAGEGYVRIALVADVATCVKAAEDIVSLYR..... 396
40 -73.4003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  16  77.....................YINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTEL----GLNRDKVVAEWVNGAVANNY---PVPDRCLVNTEKIINYFLQEDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSVV----PYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAH------LDKVELRQLHKRYSSVVLDPDADSRSIGLYHTAGLSTPQQIMEALFSMTHLLTTDTNTHYYSLIDIYRDYLTNNFEQVDFLLKLAEKNGVVLVDGVGFGAPGELRVSQANLPTEYALIGKQVLELLKEYYE. 527
41 -73.2003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  18  2.........................MTFEPYPFERLRALLKEI-TPKKRGLDLGIGEP----QFETPKFIQDALKNHTHS--LNIYPKSAFEESLRAAQRGFFKRRKIELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPEACMLAGNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFR------AYLGYTSANAIQKASEAAWLD--DRHAEFFRNIYANNLKLARKIFKNTL-----IYPYSFYVYLPVQ--------NGENFAKTLYQNEGIITLPALYLGGADYVRLALVYDTPLLEKPLEIIETYRENH... 375
42 -69.2002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  16  58........AAAESELSYSYMTVGVGGLAKLDGIEGAEHRDQEGVKFLGKSLSYVRDQL----GLDPAAFLHEMVDGILG----CNYPVPPRMLTVSEQIVRQYIVRAVPPESVDLFAVEGGTAAMALRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSVC----PRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQ------------LPESAKKALDHRY-RSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALMDEADAYKSTGDMLFRVADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRRLADELYE 523
43 -68.3002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  15  57FAAAESELSYSYMTTVGVGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQL----GLDPAAFLHEMVDGILGC---NYPVPPRMLNISEKIVRQYIIREMGPSESVNLFAVEGGTAAMALKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAIC----PENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDK------LQESEKVALDHRYRSLLPDVRSEADEYKHTLKQLIRRRETTLYRELGMPPLRD-ENAVDYYTLIDLQSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRKMADELYA 524
44 -68.0001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  16  2..................RMLSRNATFNSHGQDSSYFLGWQEYEKNPYHIIQMGLAENQLCFDKNPEAAAFKKNGESIFAE-LALFQDYHGLPAFKKAMVDFMAENKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWTGVEIVPIHCTSSNGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKDQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSF----GLVSSQTQHLLSAMLSDK-KLTKNYIAENHKRLKQRQKKLVSGLQKS-GISCLNGNAGLFCWVDMRHLL-NTFEAEMELWKKIVYEVHLNISPGSSCHCPGWFRVCFALPERTLDLAMQRLKAFVGEYYNV 435
45 -67.9005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  11  6.....................................QLKENLTQWAYLALNSELNIA----DGHARQALSPGQQKIVNELP-VLWAESEQRPEAHQAYFTLLGQHGYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGA-----DLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAHYDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYS------DILLGVSPLILALIREFSRDAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVE-----------RTGTEVW-EELQRHHVFALPCRQFHGDHMVRIALSRSTEPLEKSVQVLRTVLETR... 376
46 -67.6006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  12  1......MGSSSSGLVPRGSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQR----QSASQQSIVSRLPQLWYEA--EEGLQATYEKRFTEAFFQLHRQP-TALVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPL--YPIDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMYESGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSV------LLNVSPFVLNMLTQYVRDSAADRLASVREVLTRNRECARKTLDGS-ILEYQEPVVKSVAWFRVDHP-----ELTATDVHRLLSADGVYVLPGRYFYGDAYVRMALAREPEMFADAMALTRQVLDRHGR. 407
47 -67.4003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  14  57FAAAESELSYSYMNTVGVGGLAKIEGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQL----GLDPAAFLHEMVDGILGC---NYPVPPRMLNISEKIVRQYIIREMGPSESVNLFAVEGGTAAMAMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSLFA----ICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGR------LPESEKTALDDRYRSLLPDVRSESDQYKHTLKQLIRRREATLYRELGT-PPQRDENAVDYYTLIDLQSKWAVKQSSTGDMLFRIADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRLRQMADELYAQ 525
48 -65.1001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  17  1...................ILSKLATNEEHGENSPYFDGWKAYLKNPNGVIQMGLAENQLCLDLNPKGSICSEGIKSFKA--IANFQDYHGLPEFRKAIAKFMEKTRVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRGVQLIPIHCESSNNFKITSKAVKEAYENKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEICNKDLVHIVYSLSKDMGLPGFRVGIIYSFND------DVVNCARKMSSFGL-VSTQTQYFLAAMLSDEKDNFLRESAMRLGKRHKHFTNGLEVV-GIKCLKNNAGLFCWMDLRPLL-STFDSEMSLWRVIINDVKLNVSPGSSFECPGWFRVCFANMDDGVDIALARIRRFVGVEK.. 428
49 -62.8003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  18  13............................RHSGITRLMEDLNDG-LRTPGAIMLGGGNPAH--IPAMQDYFQTLLTDMVESGKLCNYDGPQGKTALLNALAVLLRETGWDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVP-FPGIIFSEARPL-WNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIIS------LAPGGMGPAMMCEMIKRNDRLSETVIKPFYYQRVQQTIAIIRRYERCLIHKPEGAIFLWLWF-----KDLPITTELLYQRLKARGVLMVPGHYFFTHQCMRMNYVPEPDKIEAGVKILAEEIERAWR. 415
50 -62.5003if2_A mol:protein length:444 Aminotransferase  ali model follow..  16  3..................KFSKFGQKFTQPTGISQLMDDLGDALKSDQPVNMLGGGNPAK-----GNDNDTGKANSSAIIS-MANYSNPQGDSAFIDALVGFFNRHDWNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDGELENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIY--SDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVN------LAPTRFGAAIATPLVANDKQLSDNEIKPFYQKQATLAVKLLKQA-PLMIHKPEGAIFLWLWFKDLPI----STLDLYERLK-AKGTLIVPSEYFFAHECIRMSIAADEQTLIDGIKVIGEVVRELYD. 442
51 -58.5002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  13  2............AMNPLAQSLNEQLQQSNATAFAMLSDLGQNMAEAKSTTYNATIGMA----TNKDGKMFASSLDAMFNDDEIFPYAPPQGIEELRDLWQQKMLRDNPELSIDRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSLFTASNAILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKEVLEAKVKGLIRNISSGPLPTQSAVKHVLKNNKEQNIQTLKERYEVTKEVVYADQYH-SHWQAYDFNSGYFMAIKVHDV------DPEALRKHLIDKYSIGVIALNATD----IRIAFSVEKDDIPHVFDSIAKAIDDLR.. 430
52 -56.6003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  11  2...........................VKLENSRKPEKISNKNIPMSDFVVNLDHGDP----TAYEEYWRKMGDRCTVTIRDLMSYFSDMTEPELEDAIKDLHGVVNAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG-----------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHY-------TPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEV-----AKKMVEYIIVNSIGVSKESQVRTAKILNSESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPAFAKEETDLVSELRRHKVMSRAGERCGSKKHVRVSMLSREDVFNVFLERLANMKLIKSI. 389
53 -55.1004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  13  1.............SNAMPMTIKRATWNNGPDLAFDINNKANAAIEKREAVINAALGTLLDDKGKIIALPSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKPEGYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDNIDVYKEAIDEGIRDSDRIASLINGNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFSNLPRNLFVVVAFSMSKSHTAYGLRSGAAVGISSSKEIIEEFEASLAHSARCNWSNGTHAAQNILIELERAEEQELVDLRNMLKSRADVFVTAAKEN-KLTMIPYFGGFFTFIPT---------DKAFDIVKDLEKENIFTIPSAKGI-----RVAICVGEEKIPKLVQRLAFYTNK.... 412
54 -54.3003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  16  8...................AAKHAKGKKLKDVIFVTAGQAQAKENGRENVVNGTLG--DEEGNLVFLKTVKEEYLSLSDSEH-VGYAPIAGIPDFLCAAEKECFGNFRPEGHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL--DEHNNFNHEAFQNRVNQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNKSTSRTWSNICRPAMRTMANIVADPAEAERNCYYQLIRDRADIFKQEAAQV-GLPMLPYRGGFFITIPTD--------SANAICEELKKEHIYVIALANGIAACGIPKCQMTGLAEKIYNAMKSLGKL....... 418
55 -53.7001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  14  3......................GNLKPQAPDKILALMGEFRADPRQGK--IDLGVGVYK---DATGHTPIMRAVHAAEQTETTKTYAGLSGEPEFQKAMGELILGDGLK-TATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLSRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGM-FSRLGATPEQVKRIKEEFGIYMVGDS--------RINIALNDNTIPILARAIIEVG...... 393
56 -53.7001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  10  12...AEAVANINCSEHGRAFLDGIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDG----LFLEEYWKQHKEASAVHRMSYFFNPVSNFIFELEKTIKELHEVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYT-------PIKYKADEDILLFTMSKFTGHSGSRFGWALIKDESV-----YNNLLNYMTKNTEGTPRETQLRSLKVLKEVVRDLNTFGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRMRPVKCEWEEDKDCYQTFQNGRINTQNGVGFEASRYVRLSLIKTQDDFDQLMYYLKDMVKAKRKT 428
57 -53.7004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  14  3....................MFEHIDAYPGDPILTLNENFQKDPRDQK--VNLSIGIYF---DAEGRIPVMGAVREAETDSGPKPYLPMVGLAAYRDAVQSLVGADHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLAGAVRNYSNPQTYGAKVVAAVL-GTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKQRGM-FTYTGLTESQVDALREVHGVYILRSGRMCVAG-------LNDSNVGIVADAIGKVLKS.... 400
58 -53.6001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  13  3......................ENITATTADPILGLADLFRADERPGK--IDLGIG---VYKDETGKTPVLTSVKKAEQNETTKNYLGIDGIPEFGRCTQELLGKGSALINDKRATPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFALYNERVGACTLVAADSETVDRAFGQMKAAIRNYSSPPAHGASVVATIL-SNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGM-FSFSGLTKEQVLRLREEFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL...... 396
59 -53.6003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  3......................ENITAAPADPILGLADLFRADERP--GKINLGQGVYK--GKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIYNYSNPPAHGASVVATILSNDAEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL-------TKEQVLRLREEFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL...... 396
60 -53.0003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  14  3......................QKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLGII----PQLQAVAEAEARLNAQPHGA-SLYLPMEGLNCYRHAIAPLLGADHPVLKQQRVIQTLGGSGALKVGADFLYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRNYSSPPNFGAQVVAAVL-NDEALKASWLKEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGM-FSYTGLSAAQVDRLREEFGVYLIASG--------RMCVALNTANVQRVAKAFAAVM...... 397
61 -52.9004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  13  1................MAVGTFENITAAPADPILGLADLFRADERPGK--INLGIG---VYKDETGKTPVLTSVKKAEQNETTKNYLGIDGIPEFGRCTQELLGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANSNPPAHGASVVATILSNDAEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL-------TKEQVLRLREEFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL...... 400
62 -52.4004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  13  1...........MAMGTLEAQTQGPGSMGKPDPILGLGQDFRMDPAKRK--VNLSIGVYR---DDADQPFVLECVKQATLGTN-MDYAPVTGIASFVEEAQKLCFGPTCRIASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLALLIRPMYNNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGM-MAYTGLTREQVELLRSEYHIYMTLNGRAAVSG-------LNSTNVEYVSQAIHNVTK..... 403
63 -52.4005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  15  1..................SSWWTHVEMGPPDPILGVTEAFKRDTNSKK--MNLGVGAYR--GKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWAVIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRMYSNPPLNGARIAAAIL-NTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGM-FCFTGLKPEQVERLIKEFSIYMTKDGRISVAG-------VTSSNVGYLAHAIHQVTK..... 401
64 -52.3004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  14  1........................MAMGKPDPILGLGQDFR--MDPAKRKVNLSIGVYR---DDADQPFVLECVKQATLGTN-MDYAPVTGIASFVEEAQKLCFGPTCRIASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLALLIRPMYSNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGM-MAYTGLTREQVELLRSEYHIYMTLNG--------RAAVSLNSTNVEYVSQAIHNVTK..... 390
65 -52.0002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  12  3......................ENITTAPADPILGLADLLRADERPGK--IDLGMGVYN---DETGKTPVLTSVKKAEQNETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRNYSSPPAHGASVVATILSNDAEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL-------TKEQVLRLREEFGVYAVASGRVNVAG-------MTPDNMAPLCEAIVAVL...... 396
66 -51.8003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  15  1..................SSWWTHVEMGPPDPILGVTEAFKRDTNSKK--MNLGVGAYR--GKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRLYSNPPLNGARIAATIL-TSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGM-FCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK............ 401
67 -51.8002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  12  3......................ENITTAPADPILGLADLLRADERPGK--IDLGMGVYN--GKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGM-FFFGGLTKEQVLRLREEFGVYAVASGRLNVAG-------MTPDNLAPLCEAIVAVL...... 396
68 -51.6004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  13  1MAMGTLEAQTQGPGSMS---LFSAVELAPRDPILGLNEAFN--ADTRPTKVNLGVGVYT--GKIPLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLGDDSPLIAAGRVVLGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKRVIRNYSNPPTHGGAIVAAVL-ASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGM-FSYSGLTSAQVDRLREEFGIYAVSTG--------RICVALNTRNLDVVANAIAAVLK..... 414
69 -50.1001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  3......................ENITAAPADPILGLADLFRADERPGK--INLGIGVYDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGM-FSFSGLTKEQVLRLREEFGVYAVASG--------LVNVAMTPDNMAPLCEAIVAVL...... 396
70 -50.0001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  10  3......................ENITAAPADPILGLADLFRADERPGK--INLGIGLY----YDETGKIPVLTSVKKAEQETTKLYLGIDGIPEFGRCTQELLGKGSALINDKRARTGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGM-FSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL............. 396
71 -49.6003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  10  1...........................MQPVLVFKLTADFREDPDPRKVNLGVGACHP----WVLPVVKKVEQKIANDNSLN-HEYLPILGLAEFRSCASRLALGDDSPASLGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKR-GFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGM-FSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGTKNLDYVATSTKIAENLYFQSDYKDDDDK. 416
72 -49.2001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  12  3......................ENITTAPADPILGLADLLRADERPGK--IDLGMGVYN--GKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLGKGSALINDKRARPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGM-FFFGGLTKEQVLRLREEFGVYAVASG--------RLNVAMTPDNLAPLCEAIVAVL...... 396
73 -48.9004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  12  1................MAVGTFENITAAPADPILGLADLFRADERPGK--VDLGIG---VYKDETGKTPVMTSVKKALENETTKTYLGLDGLPEFGRCTQELLGKGSALINDKRARPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVNTLQEKGANRDFSFIIKQNGM-FSFSGLTKEQVLRLREEFGVYAVASG--------RVNVAMTPDNMAPLCEAIVAVL...... 400
74 -48.9002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  20  2...............DYTKYLAGRANWIKGSALADVMKKASELQKKGVKLISLAAGDPDP--ELIPRAVLGEIAKEVLEKPKSVMYTPANGIPELREELAAFLKKDHLEVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDG---MRVDLLEEKIKELKAKLIYTIPTNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKALDNEGRVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVLMQKQPID------FCAPAISQYIALEYLKRGEKYHLEGALLGYKEKRDIMLKALENLPNAEFTKPIAGMFVMFFL-----PEGADGISFANELMEREGVVVVPGKPFSGKNAIRLNFSPSKEEIPIGIKKLAKLYKEK... 404
75 -47.9003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  17  13.....................................RNTMKWTRYGQGVLPLWVAE-----DFSTCPAVLQAITDAVQREAF-GYQPDG--SLLSQATAEFYADRGYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDA----TGGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDG-QHTVAAGVSDTSVCITITAPSKAWNIAGLKCAQIIFSNP------SDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKIPGAKITPMQATYLMWIDFRDTTIEG-----SPSEFFIEKAKVAMNDGAWFGGTGFCRLNFATSREVLEEAIDRMAKAVSHHT.. 377

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.