current user: public

If you have questions about the server, please let us know.

Query: 3ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst SMSNANPFFSQSLAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQYGVSRDTMLIDYDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTNPEGDHATEQRVRREIFALCERFPIYLast
1 -124.0003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model  100  1SMSNANPFFSQSLAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQYGVSRDTMLIDYDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTNPEGDHATEQRVRREIFALCERFPIY 425
2 -119.0004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  61  2......NIFNNNLHETDKEINEIIKHEKLRQSSVIELIASENFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAHAVTSTTHKTLRGPRGGLILSNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNNED-NSALEQQVLNEVTKLIELFPFY 419
3 -118.0004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  55  2RGSGSMIFDKEDYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVSGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDK-----PEVLERIRGDVKVLTDAFPLY 422
4 -116.0003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  53  8AQTQGPGSMSAPLAEVDPDIAELLAKELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEHVDVVENLARDRAKALFGAEFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYENGFYGVDPATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQ-QYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAPDVAKVSGGTDVHLVLVDLRDSPLDGQAAEDLLHEVGITVNRNAVPNDPRPPMVTSGLRIGTPALATRGFGDTEFTEVADIIATALATGSS------VDVSALKDRATRLARAFPLY 430
5 -116.0005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  57  2.....AMFANISISEFDPELAQAIASEDERQEAHIELIASENYCSPAVMEAQGSKLTNKYAEGYPGKRYYGGCEFVDVIEQMAIDRAKELFGADYANVQPHAGSQANSAVYLALLNPGDTVLGMSLAHGGHLTHGAKVSFSGKTYNAVQYGLNAETGEIDYEEVERLALEHKPRMIVAGFSAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAGVYPNPVQIADVTTTTTHKTLRGPRSGLILAKANEIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDFKAYQQQVVKNAQAMAEVFIARGYDVVSGGTDNHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSPFVTSGIRIGTPAVTTRGFGEAEVRELAGWIADVIDSKGD-----EKVIADVKAKVEAVCAKFPVY 417
6 -116.0005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  52  3........MAYFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTFPSVMEAMGSILTNKYAEGYPNKRYYGGCEVVDKIESLAIERAKKLFNCQFANVQAHSGSQANNAVYHALLKPYDKILGMDLSCGGHLTHGAKVSLTGKHYQSFSYGVN-LDGYIDYEEALKIAQSVKPEIIVCGFSAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTNEHAHPFPHCHVVSSTTHKTLRGPRGGIILTNDEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEFKAYAKLVKSNMQVLAKALKEKNHKLVSGGTSNHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSPFVTSGIRIGSAALSARGMGAKEFEIIGNKISDILNDINN-----VSLQLHVKEELKAMANQFPVY 413
7 -116.0003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  53  3.........AMSLEMFDKEIFDLTNKELERQCEGLEMIASENFTLPEVMEVMGSILTNKYAEGYPGKRYYGGCEFVDEIETLAIERCKKLFNCKFANVQPNSGSQANQGVYAALINPGDKILGMDLSHGGHLTHGAKVSSSGKMYESCFY-GVELDGRIDYEKVREIAKKEKPKLIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAGEHPSPFPYAHVVSSTTHKTLRGPRGGIIMTNDEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEWKVYAKQVRTNAQVLANVLMDRKFKLVSDGTDNHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSPFITSGLRLGTPALTARGFKEKEMEIVSNYIADILDDVNN-----EKLQENIKQELKKLASNFIIY 412
8 -116.0001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  56  4........REMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGID-ATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRVGTPAITRRGFKEAEAKELAGWMCDVLDSIND-----EAVIERIKGKVLDICARYPVY 416
9 -115.0002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  58  2..........VSTLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPS---------EALREEVRRLALAHPM. 406
10 -114.0003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  57  5..........SYITKQDKVIAEAIEREFQRQNSNIELIASENFVSEAVMEAQGSVLTNKYAEGYPGRRYYGGCEFVDVTESIAIDRAKALFGAEHVNVQPHSGPQANMAVYLVALEMGDTVLGMNLSHGGHLTHGAPVNFSGKFYNFVEYGVDKDTERINYDEVRKLALEHKPKLIVAGASAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAGLHPNPVEYADFVTTTTHKTLRGPRGGMILCKEEYKKD-IDKTIFPGIQGGPLEHVIAAKAVAFGEALENNFKTYQQQVVKNAKVLAEALINEGFRIVSGGTDNHLVAVDVKGSILTGKEAEETLDSVGITCNKNTIPFDQEKPFVTSGIRLGTPAATTRGFDEKAFEEVAKIISLALKNSKD-----EEKLQQAKERVAKLTAEYPLY 414
11 -113.0004p3m_A mol:protein length:429 Serine hydroxymethyltransferase  ali model follow..  53  4........RDMNIADYDPELWQSITDEVQRQEDHIELIASENYTSPRVMEAQGSQLTNKYAEGYPGKRYYGGCEYVDVAESLAIERAKSLFGADYANVQPHSGSQANAAVYQALCAPGDTILGMSLAHGGHLTHGSHVSFSGKMYNAVQYGITPETGILDYAEIERLAVEHKPTMIIAGFSAYSGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLGGPRGGLILAKANAIEKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEFAVYQQQVLDNAKAMVKSFLARGYKIVSGGTENHLFLVDLIAQDITGKEADAALGNAHITVNKNSVPNDPRSPFVTSGLRIGTPALARRGVNAQQSAELALWMCDVLDAIKDEAKLATT-ITAVKVKVAALCKACPVY 420
12 -112.0001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  59  2..........KYLPQQDPQVFAAIEQERKRQHAKIELIASENFVSRAVMEAQGSVLTNKYAEGYPGRRYYGGCEYVDIVEELARERAKQLFGAEHANVQPHSGAQANMAVYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFSGVQYNFVAYGVDPETHVIDYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFA-KQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESPFVTSGIRIGTAAVTTRGFGLEEMDEIAAIIGLVLKNVGS-----EQALEEARQRVAALTDPTSRS 410
13 -112.0004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  57  1.MASMFDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLN-ENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINS-AIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPED-----AATIERVRAQVAELTKRFPVY 417
14 -112.0001eji_A mol:protein length:478 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  48  10..ASHEKMLSQPLKDSDAEVYSIIKKESNRQRVGLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYGGTEFIDELEMLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKIFFESMPYKVYPETGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKYELESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEFKIYQLQVLANCRALSDALTELGYKIVTGGSDNHLILMDLRSKGTDGGRAEKVLEACSIACNKNTCPGDK-SALRPSGLRLGTPALTSRGLLEEDFQKVAHFIHRGIELTLQIQSHMASAVATLREEVENFASNFSL. 472
15 -112.0006fl5_A mol:protein length:471 Serine hydroxymethyltransferase, cytosolic  ali model follow..  48  5.WSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPNGAIMGLDLPDGGHLTHGFMTSATSIFFNSMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDR-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGAAVQALREEVESFASLFPL. 467
16 -111.0001bj4_A mol:protein length:470 PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)  ali model follow..  48  5.WSSHDAMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMISATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDR-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGAAVQALREEVESFASLFPL. 467
17 -111.0005z0y_A mol:protein length:470 Serine hydroxymethyltransferase  ali model follow..  41  8..PEHKQMVEGHLAETDPEVNQIIKDEVDRQKHSIVLIASENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHLDGVNVQTLSGSPANLQVYQAIMKPHDRLMGLDLPHGGHLSHGYQTSAVSTYFETMPYRVDLETGIIDYDMLEKTAVLYRPKVLVAGTSAYCRLIDYKRMREIADKVGAYLVVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKQYQEQVLKNAKALENEFKRLGYKLVSDGTDSHMVLVSLKDKDIDGARIETVCENINIALNKNSIPGDRSA-LVPGGVRIGAPAMTTRGASEEDFVKIANYIDKSVQYAKKVQSEGSDEITQLKNEISAWAGEFPLS 469
18 -110.0005x3v_A mol:protein length:496 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  45  18..ANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNRYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVTSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGD-RSAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAQRLANLRQRVEQFARAFPM. 477
19 -110.0003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  55  1..SNAMLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGID-ESGKIDYDEMAKLAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNIND-----EATIERVKAKVLDICARFPVY 419
20 -106.0006ccz_A mol:protein length:455 Serine hydroxymethyltransferase  ali model follow..  48  1....SNAFLDYGLSEADPDVHAIINKEKDRQFRSLELIASENFTSKAVMEAVGSCLTNKYSEGLPGKRYYGGNEHIDELEILCQQRALAAFDKWGVNVQPLSGSPANFAVYTAILKPHDRIMGLDLPHGGHLSHGFMVSGTSIYFESMPYRLDESTGVIDYDMLEKTAALFRPKLIIAGASAYPRDIDYARFRKIADSVGAFLMMDMAHVSGLIAASVLADPFEFVDIVTTTTHKSLRGPRGGMIFFKKDAVESAINNAVFPGLQGGPHNHTIGGLAVCLKYAQSPDFKNYQNQVVANCRALANRLVEHEYKLVSGGSDNHLVLVDLRPSGIDGARVEKILDMASITLNKNSVPGDK-SALVPGGIRIGSPAMTTRGLGEKEFELIADLIHEGVRISLEAKSLVGDKVSNLRRKVEALATQYPIP 453
21 -106.0004oyt_A mol:protein length:442 Serine hydroxymethyltransferase, putative  ali model follow..  37  2.......FNNEPLEQIDKELHDILADEEKRQRETINLIASENLTNGAVRECLGNRVSNKYSEGYPKKRYYGGNDFIDKIEELCQKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDMFESCNSQGYVDLDAVREMALSFKPKVIICGYTSYPRDIDYQQFRQICDEVNAYLFADISHISSFVACNILNNPFLHADVVTTTTHKILRGPRSALIFFNKKGIEQKINSAVFPSFQGGPHNNKIAAVACQLKEVHSPAFKEYTQQVLLNSKALAKALISKQIDLVTNGTDNHLIVVDLRKFSITGSKLQETCNAINVSLNKNTIPSDV-DCVSPSGVRIGTPAMTTRGAKEKDMEFIADVLARAIKITVDLQEQGNAQLQQLKQEVVTWAGALPF. 441
22 -105.0006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  45  21GEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSSATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGTRSGLIFYRKYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDR-SAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAQRLANLRQRVEQFARAFPM. 482
23 -105.0004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  36  29..FTPGMFNNDPLQKYDKELFDLLEKEKNRQIETINLIASENLTNTAVRECLGDRISNKYSEGYPHKRYYGGNDYVDKIEELCYKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDLFESCNSEGYVDMESVRNLALSFQPKVIICGYTSYPRDIDYKGFREICDEVNAYLFADISHISSFVACNLLNNPFTYADVVTTTTHKILRGPRSALIFFNKKGIDQKINSSVFPSFQGGPHNNKIAAVACQLKEVNTPEFKEYTKQVLLNSKALAECLLKRNLDLVTNGTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDV-DCVSPSGIRIGTPALTTRGCKEKDMEFIADMLLKAILLTDELQQKNNPKIDELKKEVVQWAKNLPF. 473
24 -104.0001ls3_A mol:protein length:483 Serine Hydroxymethyltransferase  ali model follow..  47  15..SSHEQMLAQPLKDSDAEVYDIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEHIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMAYKVNPDTGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGD-KSALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTVQIQDDTGRAVRALRQEVESFAALFPLP 478
25 -102.0004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  34  2...........EYSDVPKFIRDVSIKQHEWMRESIKLIASENITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVETLCIELSKELFKAEHANVQPTSGVVANLAVFFAETKPGDKLMALSVPDGGHISHWKVSAAGIRGLKVINHPFDPEEMNIDADAMVKKILEEKPKLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAGKQFQDPLEGAEYLMGSTHKTFFGPQGGVILTTK-ENADKIDSHVFPGVVSNHHLHHKAGLAIALAE-MLEFGEAYAKQVIKNAKALAQALYERGFNVLCDFTESHQVIIDIEDIEFSASELAKMYEEANIILNKNLLPWDDNNSDNPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDKEK--------PEKVREDVKEFAKEYSTI 413
26 -20.4005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  17  38....................YKNLTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGRL---DEVTCPPIKDFLEDIAKFLNMDCARP-THGAREGKFIVMHAICKEGDYVVLDKNA---HYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNKNVGLILLTDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKE----KADFIVASGHKSMAASAPCGILAFSEEFSDKITKTSEKFLGCTSRGLPIVTLMASFPHVVE---VKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIK----------ETPVLDEIAKKDKRRGFFFYDELKKRGIGGIRAGVTKMSVYGLEWEQVEYVVNAIKEIVESCK........................... 411
27 -19.6003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  10  5..........EARRAHEHLIRLLLEQGKCPEDG------DESTLELFLHELAVMDSNNFLGNCGVGER--AGSSLLNKITNSLVLKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPECLHSTTACFA---RLEELAVICANYDIPHVVNNAY--GLQSSKCMHLIVGRIDAFVQSLDKNFMVPGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLNA----AAAIGMKMQDVDLFIKRLDKCLNIVRKEQTRA..................... 450
28 -19.6003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  16  3AMQEILSQLNKEIEGLKKAITSPQNAEIKVGEKEVLNFCANNYLGPALIKTAQTVV-EQYGFGMASVRFICGTQ---TIHKELEKDISEFLGTDDTIL---SCFDANGGLFETLLGPEDAIIS---DELNHASIIDGIRLCKAQRYRYKNN--------AMGDLEAKLKEARFKLIATDGSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENEYCGVADRVDILTGTLGKALGGASGGYT-SGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHP---IIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMG---KARIRVQMSAV-----TQQQLDRAIEAFGQVGKK............................. 395
29 -19.3002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  15  54.............................................................................PIHDFIHNQLPKFLGCDVARV---GAREAKFAVMHSLAKKDAWVV---MDENCHYSSYVAAERAGLNIALVPKTDYPD-YAITPENFAQTIEETKKRLITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKE----GADFIVGSGHKSMAASGPIGVMGMKEEWAEIVKNKEVELLGCTARGATIITLMASF-PHVRERIKRWDEE-VEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEV-GGRFFLYRELKSRKIHGIKPGLT--------------RYFKLSTYGLSDEEVDYVLNAFKEIIE.............................. 368
30 -19.3002hzp_A mol:protein length:501 Kynureninase  ali model follow..  12  51KCHPTDERVALHLDEEDKDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESI-VGLMKDIVGANEKEIALMNALTVNLHLLMLSFPKRYKILLEAKAFSDHYAIESQLQLHGLNIEESMRMIEETLRIEDILEVIEKEGD-SIAVILFSGVHFYQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHD----GVDFACWCSYKYLNAGAGGIGAFIHEKHAHTIKPALVGWFISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHNVVNIITPSHVEERGCQLTITFSVPNKDVFQELEKRGVVCDKRN----------PNGIRVAPVPLYN---SFHDVYKFTNLLTSILDSAETKN........................ 495
31 -19.3005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  12  14ELPLQQKADAAQTVTGPLPFGNSLLKEFVLDPAYRNL----NHGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLDESRAAVANLLKVPVETVNATMGVNTVLRNIVWSADGKDEILYFDTIYGACIDYVIEDKRGIVSSRCIPLIYPAEDDDV-VAAFRDAIKKSRPRLAVIDSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDLKITE----DPDFLISNCHKWLFTPRGCAVFYVPVRNQHLIRSTLPTS-VGTVDNSPFFCVAIKWREEVLGGEERIMEYMTKLAREGGQKVAEIGTRVLENSTGTLIIALPFVVGEDPKAPVKLTEKEEKDVEGLYEIPHEEANMAFKW-ARLSAQVYL----EMSDFEWAGKTLKELCERVAKGEYKESALEVDLQGDHGLSAWSHPQF 499
32 -19.0003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  24ARRSHEHLIRLLLEKDESTLELFLHELAIMDSNNFNCGVGEREGRVASALVARRHYRFIHGIGRSGD---AGSSLLNKITNSLVLDIIKLAGVHTVA----MSLTLCFLTLRHKRPKAKYII---WPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCIHSTTSCFA---RLEELAVICANYDIPHIVNNAY--GVQSSKCMHLIVGRIDAFVQSLDKNFMVPGGAIIAGFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYNERLLHTPHNPISLAMTLKTLDEHRTQLGSMLFTRQVSGARVVPLGSMQTVSGYTFRGFMSHAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKESDDNYDKTEDVDIEEMALKL. 488
33 -19.0001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  15  1.......MAKRIVEPFRIKMVEKIRVPSREERNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLK----DKAKELFNYDYI-IPAHQGRGAENILFPVLLKYKQKEGKFDTTAAHVELNGCKAINIVTEKAFDSETYDDWKGDFDIKKLKENIAQHGADNIVAAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCNATIKEVIFDMYKYADALTMSAKKDPLLNIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYP-TGGHAVFVDCKKLVPQ-AVINALYLESGVRAVEIGSFLLGRDPATGE-MRLTIAR-----YTNDHMDYIADALIGLKEKFATLKGLEFEYEPPV---LRHFTARLPI. 466
34 -18.9005i90_A mol:protein length:427 PvdN  ali model follow..  15  20LLSAAQSLRAEGVPSDAGNKWKALRQQFDLDPQYLHFANFLLTSHPRPVREAIERLRVRFDRN-PGEAVDWHREEIWKYEDEARAWAGRYFAVQPGQV---STTDGLAAIYGGLVQPGKEILTSSHEHYSTYTLEYRHKRMGTQVREFPLFKDPHRVSADLSSIAAQIRP-QTRVLGMTWVQSGVKLPIREIGKLVRELNQIYVVDGVHGFGVEDVSFAD----DCDYFIAGTHKWLFGPRGGVIIARSEQLQEHLVPSIPTFSRGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGEHKVRLVTPTSPELSSFTFFRVEGRDCEAVAKHLMAHRVISDAVD---------VGPVVRLAPSLLN----DEAEIDRVLEILAPQL............................... 426
35 -18.8001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  15  46..............................SNDYLGLSHHPQIIRAWQQGA------EQFGIGSGGSGHVSGYS---VVHQALEEELAEWLGYSRALL---SGFAANQAVIAAMMAKEDRIAADRLS---HASLLEAASLSPSQLRRFAHN--------DVTHLARLLASPCPGQMVVTEGVFSMD-PLAEIQQVTQQHNGWLMVDDAHGTGVIGRGSCWLQKVKPELLVVTFGKGF-GVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSA---IQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAG---TARLRLTLTA----AHEMQDIDRLLEVLHGN................................ 383
36 -18.8001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  11  7FERSRKGRRGLKLVKAVPKAEDLIPKEHLREVRHYTGLSRRQVGVDTTFYPLGSRLFADLHPYQDPRTAQGALRLMWELGEY----LKALTGMDAITLEPAAGAHGELTGILIIRAYHED--VVLVPDSAHGSNPATASMAGYQVREIPS---GPEGEVDLEALKRELGPHVAALMLTNPNTLLFERRILEISRLCKEAGVQLYYDGANLNAIMG--WARPGDMGFDVVHLNLHKTF-GPGSGPVGVKAHLADFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEFVAQPPEGFRALDLAKGLLELG-------HPPTVYFPLIVKEALMVEPTETE----AKETLEAFAEAMGALLKKPKEWLENAPYSTPVRRLD-ELRANKHPKL 468
37 -18.7002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  19  10.....................................LRSDTVTKPT------EEMRKAMAQAEVGDDVYGEDPTINELE----RLAAETFGKEAA-LFVPSGTMGNQVSIMAHTQRGDEVIL---EADSHIFWYEVGAMAVLS--VMPHPVPGKNGAMDPDDVRKAIRPPRTSLIAIENTRVVPLENIKEICTIAKEHGINVHIDGARIFNASIA--VKEYAGYADSVMFCLSKGLCAPVGSVVVGDR----DFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKED--ENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANA----------VSDTEIRL----VTHKDVSRNDIEEALNIFEKLFRK............................. 347
38 -18.6002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  10  59................DEKIKLFLKFLSMMDTDKDPKSVRIGEREARTYSKIHEELSSGFCHGVDPQPKASGASIMYALTNKILESFFKQLGVHAIATPISTGMSISLCLSAARKKYGSNVVIYPYA--SHKSPIKAVSFVGMNMRLVETVLDGDRVYVPVEDIENAIKKEIELCVLSTLTFFPP--DIVEIAKICENYDIPHIINGAYAIQNNLEKLKKAFKYRVDAVVSSSDKNLLTPIGGLVYSTDAEFIKEISLS----YPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDTGGKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHDY---IVMNAAIGVRTEDIVNSVSKLEKIL............................... 449
39 -18.4001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  16  52..............................ANNYLGLANHPDLIAAAKAGM------DSHGFGMASVRFICGTQ---DSHKELEQKLAAFLGMEDAIL---SCFDANGGLFETLLGAEDAIIS---DALNHASIIDGVRLCKAKRYRYANN--------DMQELEARLKEAREHVLIATDGVFSMD-NLKGVCDLADKYDALVMVDDSHAVGFVGENEYCDVMGRVDIITGTLGKALGGASGGYT-AARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAG-SELRDRLWANARQFREQMSAAGFTLAGADHA---IIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKG---QARIRTQMSA----AHTPEQITRAVEAFTRIGKQ............................. 396
40 -18.4001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  18  1........MNYPAEPFRIKSVETVSMIPRDERNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGFTTTRYHQEKNGAVFVDIVRDEAHDAGLNIAFKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTAAHGIKVFYDATRCVENAYAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYSYGGLAGRDMEAMAIGLREAMQ---YEYIEHRVKQVRYLGDKLKAAGVPIVEP-VGGHAVFLDARRFCEHLTQDERSMERGIISAGRNNVTGEHHRPKLE--VRLTIPR-----YTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPKQ---LRFFTARFYI. 456
41 -18.4002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  15  46..............................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN--------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCN-NEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTI----RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY............................. 383
42 -18.3004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  13  49..LKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFVYSGEEKLTELLVKAYGDFAWSNPLH-------PDIFPGLRKIEAEIVRIACSLFNGDSCGCVTSGGTESILMACKAYFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPL---TKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAG-VKGVTSISADTHKYGYAPKGSLVLYSDKKYRNY-GIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIGIFVFG---NPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP---------PSIHF---CITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIRNMVAELSSVF-LY 493
43 -18.2005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  12  7.........................................QFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERAS----EYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVIC---SETAHVETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALKRKPRVVTITQATVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHC---AQLLALLVSDLPGVELMFPVEANGVFLQM------PEHAIEALRAKGWRFYTFI---------GSGGARF----MCSWDTEEERVRELAADIRSIITA............................. 346
44 -18.1003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  18  13..KIVEELKAKGLYAYFRPIQSKQDTEVKIDGRRVLMFGSNSYLGTRIIKAAQDAL-EKYGTGCAGSRFLNGTL---DIHVELEEKLSAYVGKEAAIL---TGFQSNLGPLSCLMGRNDYILL---DERDHASIIDGSRLSFSKVIKYGHN--------NMEDLRAKLSRLPEKLICTDGSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKSHFGLNDDVDLIMGTFSKSL-ASLGGFVA-GDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNE-PEHIEKLWKNTDYAKAQLLDHGFDLGATESP---ILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAE---ESLIRFSLMAT-----TYDQIDEAIEKMVKVFKQ............................. 391
45 -18.1003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  15  60..............................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN--------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCN-NEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTI----RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY............................. 397
46 -18.0002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  17  51..............................TYNYMGMTFDPDVIAAGKQAL------DEFGSGTTGSRVLNGTY---QGHKACEDALKEFYGTEHAIV---TGYQANLGMISTLAGKGDYIIL---DADSHASIYDGCWLGDAEIVRFRHN--------SVEDLDKRLGRLPAKLVVLEGSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHEEAGVEADVDFVVGTFSKSV-GTVGGFCVSN-HPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHA-GDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAV-ILTDMAQAVALWQGLLEAGLYVNTARPPATPAG---MFLLRCSLCAE-----SDEQVEQILGMFESAGRA............................. 394
47 -18.0001v72_A mol:protein length:356 Aldolase  ali model follow..  13  11.........................................GFSSDNIAGASPEVAQALVKHSSGQAGPYGTDELTAQVK----RKFCEIFERDVEVFLVPTGTAANALCLSAMTPPWGNIYC---HPASHINNDECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKQPACVSITQASIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVS-AEMTWKAGVDALSFGATKNGVLAAEAIVLFNT----SLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDDWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDSAMIDALLKAGFGFYH---------------RWGPNVVRF----VTSFATTAEDVDHLLNQVRLAADRTQE.......................... 355
48 -18.0002vyc_A mol:protein length:755 BIODEGRADATIVE ARGININE DECARBOXYLASE  ali model follow..  13  128.....VAAMTRYRQQLLPPLFSALMKYSDIHEYSWAA-PGHQGGVGFTKTPAGRFYHDYYGENLFRTDMGIERTSLGSLLD-SEKYAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---VDRNCHKSIEQGLMLTGAKPVYMVPSRNRYPQEMQPETLQKKISESKPSYCVVTNCTY---YNAKEAQDLLEKTSDRLHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGRGFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR..................................................................................................................... 463
49 -17.9001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  14  17.........................................SFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAA----RLIGELLERPDADV-ISGGTQTNLIACSLALRPWEAVIA---TQLGHISTHETGAIEATGHKVVTAP--CPDGKLRVADIESALHENIPKLVYISNTTQYTKQELEDISASCKEHGLYLFLDGARLASALSS-TLADIARLTDMFYIGATKAGGMFGEALIILND----ALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNFFELGAHSNKMAAILKAGLEACGIRLAWP-SASNQLFPILENTMIAELNNDFDMYTVEPLKDGTCI------------MRL----CTSWATEEKECHRFVEVLKRLVASTA........................... 359
50 -17.9001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  13  91NAREIETAVNNYEDSILPPFFKSLKEYVSRYLIQFDC-PGHQGGQYYRKHPAGREFYDFFGETVFRADLCNADVALGDLLI-AEKHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVL---FDRNNHKSYNSALAMAGGRPVYLQTNRNPYGGIYDSDFDEKKIRELAAKAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRNPEDPGIIVVQSVHKQQAGSQTSQIHKKDSHIKKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKGSMFRPFVPPVVNGKKWEDGDTEDMANNIDYWRFEKGAKWHAYEGYGDNQYYVDPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDHGIIPEKTPAKMNNLITQLLQLQRLI... 566
51 -17.8005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  18  48..............................SNDYLGLAAHPQLIAAIAEGA------QRYGAGSGGSHLLGGHS---RAHAQLEDDLAEFVGGFVENARALTGYMANLATLTALAGRGTTLFS---DALNHASLIDGARLSRADVQIYPHC--------DTDALSAMLEASDVKVIVSDTSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQAQAALRSPNLISIGTLDKAA-GVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEGDARRAHLQQLIGRTRAMLKATPWLPVDSHTA---VQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTG---TSRLRISLSA----AHSQADLDRLEAGLQQLGAK............................. 394
52 -17.8003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  15  4.....................................LRSDTVTRPS------RAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTHNGKVYLKEAWEFTRERNLALHVDGARIFNAVVA--LKEITQYCDSFTICLSKGLGTPVGSLLVGNR----DYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQED--DNAAWMAEQLREAGADVMR--QDTNMLFVRVGEENAA--ALGEYMKARNVLINASPI------------VRL----VTHLDVSREQLAEVAAHWRAFLA.............................. 332
53 -17.8006MME Entity 1(prereleased)  ali follow..  18  1........MNYPAEPFRIKSVETVSMIPRDERNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTEAHGIKVFYDATRCENKSIAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYSYGGLAGRDMEAMAIGLREAMQ---YEYIEHRVKQVRYLGDKLKAAGVPIVEP-VGGHAVFLDARRFCEHLTQDERSMERGIISAGRNNVTGEHHRPKLE--VRL---TIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLKFIYEPKQ---LRFFTARFYI. 456
54 -17.7005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  19  46..............................SNDYLGLAAHPKLVAAFAEGA------QRYGSGSGGSHLLGGHS---RAHAKLEDELAGFAGGFSDAPRALTGYMANLAAVTALAGKDATIFS---DALNHASLIDGTRLSRATVQVYPHA--------DTATLGALLEACQTKLIVTDTSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQAAAALRSPHLVYVGTLGXAA-GVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEGDARRAHLAALIERTRALLRRTRWQPVDSHTA---VQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAG---TSRLRISLSA----AHSFDDLARLETALLRASEEA............................ 393
55 -17.7005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  11  22.....ASAERHDLPKYKLAKHALEPREADRNSRLNLATFCQTYMEPEAVELMKDTLEKNAID-------KSEYPRTAEIENRCVNIIANLWHASFTGTSTIGSSEACMLAGLAMLDLTAHQPNIVISAGYQVCWEKFCVYWDIDMHVVP--MDDDHMSLNVDHVLDYVDDYTIGIVGIQYDDLARLDAVVERYNRTTKFPVYIHVDAA-SGGFYTPFIEPELLNNVISINASGHKYGLVYPGGWVIWRDQQYLPK-GELPTMAINFSHSASQLIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGFSLINDGHELPLICYELTADSDREWTLYDLSDRLLMKGWQVPTYPLPKNMTDRVIQRIVVRADFGMSMAHDFIDDLTQAIHDLDQAHIVFHSDPQPKKYGFTH............ 468
56 -17.7002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  20  71..............................TYNYMGMTFDPDVIAAGKEAL------EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN--------SVEDLDKRLGRLPKKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSKSV-GTVGGFVVSN-HPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAV-MLEDQEQAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICAE-----TPAQIQTVLGMFQAAGRA............................. 414
57 -17.5004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  16  16..SNAMLNLQDKYTQYQRDNLLRELTPFIKDDSIIDFTTSDNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYT---DETQQFEHEFAKFINYPRAIF---SGFMANLAIYSTLFSKHDSIFADKYI---HASIIDGIKLSQAKLRRYKHQ--------QLSQLQDIYDGKS---FITTEGVFSTSGSITQLDKLAKITPEKLIVDEAHSFGVLGINSFRISYKNCLICVFPLGKAF-GGVGAVVCTT-EAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENV-NDNRARLQQNITFFNELCDAKDLELVS--KDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKD---QAILRFSLHSN-----TFDQIQQALEIISKEVKY............................. 387
58 -17.4003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  11  25.....TSLPRFKMPENSIPKEAAYQIINDELMLDGNASFVTTWMEPECDKLIMSSINKNYVD-------MDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVGVGSSEAIMLAGLAFKRKWQNKRKAEGVQVCWEKFARYFE--VELKEVKLSEGYYVMDPQQAVDMVDENTICVAILGSTLNGEFEDVKLLNDLLVEKNKETGWDT-HVDAASGGFIAP--LPLVKSINVSGHKYGLVYAGGWVIWRNKEDLPE-ADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTEFNIVSKDEGVPLVAFSLKSSCHTEFEISDMLRRYGWIVPAYTMPPNAQHITV---LRV----VIREDFSRTLAERLVIDIEKVMRELDELPSRVIHKISLGQEKSESNSDN.... 468
59 -17.4004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  19  87..............................TYNYMGMTFDPDVIAAGKEAL------EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN--------SVEDLDKRLGRLPAKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSASV-GTVGGFVVSN-HPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAV-MLEDQEQAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICAE-----TPAQIQTVLGMFQAAGRA............................. 430
60 -17.4003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  12  3..........RNMQEKGVSEKEILEELKKYRSLDLKYEDGNGSMCSNVLPITRKIVDIFLETNLGDPGLFKG---TKLLEEKAVALLGSLLNNKDAGHIVSGGTEANLMALRCIKNSKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPI---KEDYTIDEKFVKDAVEDYDVDGIIAGTTELGTIDNIEELSKIAKENNIYIHVDAAFGGLVIPFLDDKYKKKGVDSITIDPHKMGHCPIPGGILFKDIGYKRYLTETRQATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPI-----LNIVAIEDEDYKEVCKKLRDRGIYVSVCNCV---------KALRIVVMPHIKREHIDNFIEILNSIKRD................................. 397
61 -17.3005xx1_A mol:protein length:756 Arginine decarboxylase  ali model follow..  13  129.....VAAMTRYRQQLLPPLFNALMKYSDIHEYSWAA-PGHQGGVGFTKTPSGRFYHDYYGENLFRSDMGIERTTLGSLLD-SEKNAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---LDRNCHKSIEQGLILTGAKPVYMVPSRNRYPQEMQPETLQKKISASKPSYSVVTNCTY---YNAKEAQDLLAKTSDRIHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGRGFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR..................................................................................................................... 464
62 -17.3002aeu_A mol:protein length:374 Hypothetical protein MJ0158  ali model follow..  13  61...............................................................................EKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKPKKVIHYL-PELPGHPSIERSCKIVNAKYFESD----------KVGEILNKIDKDTLVIITGSTMDLIELENFKKVINTAKNKEAIVFVDDASGARVRLLFNQPPALKGADLVVTSTDKLMEGPRGGLLAGKKELVDKIYIEGTKFGLEAQPP--LLAGIYRALKNFNLERIRKAFERAKNFDLSKIEKLNKELINIVYERTPTGFVIKRVYKDDTINIKKLIEIGFNLLKNYGIITITVAGMPGASKSLRIDLTSRDAERIDDNYIKAIVESIKMAFKS............................. 374
63 -17.3004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  15  4.....................................LRSDTVTRPS------RAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVA--LKEITQYCDSFTICLSKGLGTPVGSLLVGNR----DYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQED--DNTAWMAEQLREAGADVMR--QDTNMLFVRVGEENAA--ALGEYMKARNVLIN------------ASPIVRL----VTHLDVSRAQLAEVAAHWRAFLAR............................. 333
64 -17.2003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  16  9.....................................LRSDTVTQPT------DAMRQCMLHAEVGDDVYGEDPGVNALE----AYGADLLGKEAA-LFVPSGTMSNLLAVMSHCQRGEGAVL---GSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPDTPTRLVCLENTVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVA--VRELVAPFDSVSICLSKGLGAPVGSLLVGSH----AFIARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADD--RRARQLAEGLAALGIRLDLAQVQTNMVFLQLTSGESA--PLLAFMKARGILFS------------GYGELRL----VTHLQIHDDDIEEVIDAFTEYLGA............................. 341
65 -17.1003n75_A mol:protein length:715 Lysine decarboxylase, inducible  ali model follow..  11  115..NKIKQTTDEYINTILPPLTKALFKYVREGKYTFCT-PGHMGGTAFQKSPVGSLFYDFFGPNTMKSDISISVSELGSLLD-AEQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTIL---IDRNCHKSLTHLMMMSDVTPIYFRPTRNAYQSEFQHATIAKRVKETPNAAVITNSTYDGLLYNTDFIKKTLDVKS--IHFDSAWVPYTNFSPIYEGKCGKVIYETQSTHKLLAASQASMIHVKGDVNEETFNEAYMMHTTTSPHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIKRHGFKNIDNEHDPIKVTLLTPGMEKDGTMSDFGISIVAKYLDEHGIVVEKTGPYN-------LLFLFSIGIDKTKALSLLRALTDFKRAFDLNLRVKNMLPSLYRED........... 577
66 -17.1002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  15  24..........IDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGPVVLAAMHEAL-EAVGAGSGGTRNISGTT---AYHRRLEAEIAGLHQKEAALV---SAYNANDATLSTLRVPGLIIYS---DSLNHASMIEGIKRNAGPKRIFRHN--------DVAHLRELIAAAAPKLIAFESSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRERDGLMHRIDIFNGTLAKAY-GVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALGMPI--IDHGSHIVPVVIGDPVHTKAVSDMLLSDYGVYVQPINFPTVPRG---TERLRFTPSPV-----DLKQIDGLVHAMDLLWAR............................. 399
67 -17.0005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  13  26...............................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMY------------QIMDEIKEGIQYVFQTRLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQ-RAVDIGERIGARVHPMTKDPGGH---YTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVNS---VASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRVTTVAVPAGYDWRDIVSYVIDHFDIEIMGG------LGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH............................. 391
68 -17.0004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  13  21...............................PNQLLLGPGPSNLPPRIMAAGGLQMIGHMSKEMY------------QIMDEIKEGIQYVFQTRLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQ-RAVDIGERIGARVHPMTKDPGGH---YTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDS---VASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRVTTVAVPAGYDWRDIVSYVMDHFDIEIMGG------LGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH............................. 386
69 -17.0004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  13  23...............................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMY------------QIMDEIKEGIQYVFQTRLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQ-RAVDIGERIGARVHPMTKDPGGH---YTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDS---VAFLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRVTTVAVPAGYDWRDIVSYVIDHFDIEIMGG------LGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH............................. 388
70 -16.9002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  14  21...............................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMY------------QIMDEIKEGIQYVFQTRLTLVISGSGHCALEAALVNVLEPGDSFLVGANGIWGQ-RAVDIGERIGARVHPMTKDPGGH---YTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDS---VASLGGTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRVTTVAVPAGYDWRDIVSYVMDHFDIEIMGG------LGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALVA............................. 386
71 -16.9004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  12  61SPQDILSAFDVDVEKCHFDFLSVTNDPEREFLVGRGDGKDSGALYAIHPKELTELLKEVYGATALTNPLHDKWPRINAMQAEVIRWCQNLFHGEGYGLLTHGGTTSIIEAMAAYRAKGIDYPEIVVPETAHAAFKKAAELTG--AILITVPVDKKTGAVNPNVMSSYITRNTAVMVSAPSFMNGIHDPISELGQLAKKKNVPFHVDAC-LGGFLTAFLDTS-VPGVTSISADLHKYGCCPKGSVCLFSEDSPALSVLYATPGILDGSTSGARVAEVYATLSYYGKNKYQEIAKSIIRLRNAIQKELTALDIYVYG---NPQWSILGFRSNTCNAHFIADELEKRGWKLNLLQNP---------DGFHL---CLTHVHTLVGSF--ETQFIKDLREAVIDVKNYPPGKKPSGNVKVYGAVGMMP.. 497
72 -16.9002ch1_A mol:protein length:396 3-HYDROXYKYNURENINE TRANSAMINASE  ali model follow..  12  17...............................PEKIMMGPGPSNCSKRVLTAMTNTVLSNFHAELF------------RTMDEVKDGLRYIFQTENRATMCVSAHAGMEAMLSNLLEEGDRVLIAVNGIWAE-RAVEMSERYGADVRTIEGPPDRP---FSLETLARAIELHQPKCLFLGDSSSGLLQPLEGVGQICHQHDCLLIVDA---VASLCGVPFYMDKWEIDAVYTGAQKVLGAPPGITPISISPKALDVIRNRRTKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKDPRHRVTGIMIPKGVDWWKVSQYAMNNFSLEVQGG------LGPTFGKAWRVGIMGECS---TVQKIQFYLYGFKESLKA............................. 382
73 -16.8001c7g_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  17  34................................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMIGDEAYAGSENFYHLE----KTVKELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGFHQEKNGATFVDIVRDEAHDASLNLPFKGD-----IDLNKLATLIKEKNIAYICLAVTV-VSMANMRAVHEMASTYGIKIFYDATRCVNVSIKDIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYSYGGLAGRDMEAMAIGLREAMQ---YEYIEHRVKQVRYLGDKLREAGVPIVEP-TGGHAVFLDARRFCPHLTQDQFPAQSLAASI------------YMETGVRSMERGIVSAGRSKETGENHRPKL-ETVRLTIPRRVYTYAHMDVVADGIIKLYQH.... 430
74 -16.8002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  13  18...............................PNKLLMGPGPSNAPQRVLDAMSRPILGHLHPET------------LKIMDDIKEGVRYLFQTNNIATFCLSGHGGMEATLCNLLEDGDVILIGHTGHWGD-RSADMATRYGADVRVVKSKVGQS---LSLDEIRDALLIHKPSVLFLGDSSTGVLQGLEGVGALCHQHNCLLIVDT---VASLGGAPMFMDRWEIDAMYTGSQKVLGAPPGITPVSFSHRAVERYKRRNTKIYHHTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYAKDRLSTVTTIKVPQGVDWLKAAQYAMKTYLVEISGG------LGPTAGQVFRIGLMGQN---ATTERVDRVLQVFQEAVAA............................. 382
75 -16.7001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  14  8..........LALDAQDS--LAPLRQQFALPEGVIYL-NSLGARPVAALARAQAVIAEEWGNGLIR--SWNSAGWRDLSERL-GNRLATLIGARDGEVVVTDTTSINLFKVLSAAPERRVIVTETSNPTDLYIAEGLADMLQQGYTLRLV--------DSPEELPQAIDQ-DTAVVMLTHVNYKYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQ----GADYAIGCTYKYL-GPGSQAFVWVSPQLCDLVPQPLSGWFCGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRELTLVTPREHAKR---HVSFEHPEGYAVIQALIDRGVIGDYRE----------PRIMRFGFTPLYT---TFTEVWDAVQILGEILDRKT------AQAQFQVRHSVT......... 416

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.