current user: public

If you have questions about the server, please let us know.

Query: 3f6t_A mol:protein length:533 Aspartate aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530
# Score Template Links and tools%idFirst GMDNSEEKKLEALGAFEISRKMLALAQKNEKSNIFLNAGRGNPNWIQTLARLAFVRLVQFGVTESKLTINNGIMAGYINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVANNYPVPDRCLVNTEKIINYFLQELSYKDANLAEQTDLFPTEGGTAAIVYAFHSLAENHLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHSYEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNPKLMIISDEVYGAFVPNFKSIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVLDPDKMKFIDRLCADSRSIGLYHTAGLSTPQQIMEALFSMTHLLTSTNGGSDDPYIDIARKLVSERYDQLHDAMQAPKDETDTNTHYYSLIDIYRLAEKIYGKEFRDYLTNNFEQVDFLLKLAEKNGVVLVDGVGFGAKPGELRVSQANLPTEDYALIGKQVLELLKEYYEEFKQNNLast
1 -150.0003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model  100  1GMDNSEEKKLEALGAFEISRKMLALAQKNEKSNIFLNAGRGNPNWIQTLARLAFVRLVQFGVTESKLTINNGIMAGYINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVANNYPVPDRCLVNTEKIINYFLQELSYKDANLAEQTDLFPTEGGTAAIVYAFHSLAENHLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHSYEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNPKLMIISDEVYGAFVPNFKSIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVLDPDKMKFIDRLCADSRSIGLYHTAGLSTPQQIMEALFSMTHLLTSTNGGSDDPYIDIARKLVSERYDQLHDAMQAPKDETDTNTHYYSLIDIYRLAEKIYGKEFRDYLTNNFEQVDFLLKLAEKNGVVLVDGVGFGAKPGELRVSQANLPTEDYALIGKQVLELLKEYYEEFKQNN 533
2 -120.0003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  38  2...SKDYQSLANLSPFELKDELIKIASGD-GNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYVGVGGLAKIEGIEGRFRYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHPDLMILTDDVYGTFADGFQSLFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDRLVADSRAVALNHTAGLSTPQQVQMTLFSLFALM-----DESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLIDLQDVTSKLYGEAFSKWAVKQSSTGDMLFRIADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRQMADELYAQYTQQG 530
3 -120.0002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  39  2...SKDYQSLAKLSPFELKDELIKIASSD-GNRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYVGVGGLAKIDGIEGRFRYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMGADAIPSESVNLFAVEGGTAAMAYIFESLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHPDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRLVADSRAVALNHTAGLSTPQQVQMALFSLFALM-----DEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKLYGEAFSEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRPSGRASLANLNEYEYAAIGRALRKMADELYAEYSGQ. 529
4 -118.0002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  39  2...SKDYRSLANLSPFELKDELIKVASGK-ANRLMLNAGRGNPNFLATTPRRAFFRLGLFAAAESELSYSYVGVGGLAKLDGIEGRFRFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLTVSEQIVRQYIVREMAGGAVPPESVDLFAVEGGTAAMAYIFESLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQPDLLILTDDVYGTFADEFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFALM-----DEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLIDLQNVTCRLYGEAFSQWAVQQSSTGDMLFRVADETGIVLLPGRGFGSDRPSGRASLANLNEYEYAAIGRALRRLADELYEQYKALG 529
5 -83.9003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  16  1..............................................AGHMKQRFIRQFTNLMSTSRPKVVANKYFTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALMVNQYSPTRGRPSLINSLIKLYSPIY---NTELKAENVTVTTGANEGILSCLMGL-----LNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINNTRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKH-NVVIISDEVYEHLYFTDSTLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDAL--------KIGYFEKMRQEYINKFKIFTSIFDEL------------------------------------GLPYTAPEGTYFVLVDFSKVKIPE-DYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKENLLRFAVCKD-DAYLENAVERLKLLKDYL........ 447
6 -83.6005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  17  57............................................................KPNDAETLSSSVDMSLSPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIREGRYTLNAGITELREAICRKLKEE---NGLSYAPDQILVSNGAKQSLLQAVLAV-----CSPGDEVIIPAPYWVSYTEQARLADATPVVIPTK--ISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHPRLLVLSDEIYEHIIYAPATHTSFMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAA-------LGLGKAGGETVAEMVKAYRERRDFLVKSLGDIKGVKI-----------------------------------SEPQGAFYLFIDFSAYYGSE-----AEGFGLINDSSSLALYFLDKFQVAMVPGDAFGD-DSCIRISYATSLDV-LQAAVEKIRKALEPLRAT..... 472
7 -83.1004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  20  1.......................................................................GPMDLSKRFNKNLNKIEVSMIRQFDQSISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDADHYTGMAGLLALRQAASAFVKEK--YHLTYNPDNEILVTIGATEALSASLTAI-----LEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTR---SNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKY-PIFVISDEVYAELTYTGESIAEYLPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAI----------EALTNGKDDALPMKEEYIKRRDYIIEKMEAM------------------------------------KFKIIKPDGAFYIFAKIPVAQGQ--------------DSFKFLQDFAKEKAVAFIPGVAFGYGEGYLRISYAASMET-IKEAMKRLKEFMEQYAD...... 393
8 -82.8001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  18  5............................................................................SRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKYAPPAGIPELREALAEKFRR---ENGLSVTPEETIVTVGGSQALFNLFQAI-----LDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETL--PEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEH-DFYLVSDEIYEHLLYEGESPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEA-------LTNQEASRAFVEMAREAYRRRRDLLLEGLTAL------------------------------------GLKAVRPSGAFYVLMDTSPIAP---------------DEVRAAERLL-EAGVAVVPGTDFAA-FGHVRLSYATSEEN-LRKALERFARVLGR......... 384
9 -82.8001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  18  1.........................................................................MKLAARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGRYGPAAGEPRLREAIAQKLQRD---NGLCYGADNILVTNGGKQSIFNLMLAM-----IEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTT--VETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEA-GLWVLSDEIYEKILYDDAQHLSIAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIA----------AYENSQDCVQEMLAAFAERRRYMLDALNAMPGLECP-----------------------------------KPDGAFYMFPSIAKTGR---------------SSLDFCSELLDQHQVATVPGAAFGA-DDCIRLSYATDLDT-IKRGMERLEKFLHGIL....... 388
10 -82.1004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  17  7............................................................................ARRLDGIDYNPWVEFVKLASE-----HDVVNLGQGFPDFPPPDFAVEAFQHAVSGDQYTKTFGYPPLTKILASFFGELL--GQEIDPLRNVLVTVGGYGALFTAFQAL-----VDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKLGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQH-DVVCITDEVYQWMVYDGHQHISIMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQ---LLFRQPSSYFVQFPQAMQRCRDHMIRSLQSV------------------------------------GLKPIIPQGSYFLITDISDFKRKM---PDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVDHYIRFCFVKD-EATLQAMDEKLRKWKVELENLYFQGK 430
11 -81.9001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  20  2..............................................................................ALSDRLELVSASEIRKLFDIAAGMKDVISLGIGEPDFDTPQHIKEYAKEALDKGHYGPNIGLLELREAIAEKLKKQ--NGIEADPKTEIMVLLGANQAFLMGLSAF-----LKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTY--EEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEH-DLIVISDEVYEHFIYDDARHYSIMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDER--------SWKAVEEMRKEYDRRRKLVWKRLNEM------------------------------------GLPTVKPKGAFYIFPRIRDT---------------GLTSKKFSELMLKEARVAVVPGSAFGAGEGYVRISYATAYEK-LEEAMDRMERVLKERK....... 387
12 -81.7001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  19  1....................................................................MGSDKIMVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGKYTDPRGIYELREGIAKRIGE---RYKKDISPDQVVVTNGAKQALFNAFMAL-----LDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETF--MSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKR-NFYIISDEVYDSLVYTDEFTVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALK----------ALEVDNSY---MVQTFKERKNFVVERLKKM------------------------------------GVKFVEPEGAFYLFFKVRG------------------DDVKFCERLLEEKKVALVPGSAFLK-PGFVRLSFATSIER-LTEALDRIEDFLNS......... 382
13 -80.8001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  15  1.............................................................MSSTSNETMHNKFDLPKRYQGSTKSVWVEYIQLAAQ-----YKPLNLGQGFPDYHAPKYALNALAAAANSNQYTRGFGHPRLVQALSKLYSQLV--DRTINPMTEVLVTVGAYEALYATIQGH-----VDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKTISSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKW-NVLCVSDEVYEHMVFEPFEHIRIMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFETE---LKRLKSPECYFNSISGELMAKRDYMASFLAEV------------------------------------GMNPTVPQGGYFMVADWSSLDSKV-----LTQETDARKDYRFTKWMTKSVGLQGIPPSAFYSEEDFVRYCFFKK-DENLQKAAEILRKWKGS......... 428
14 -80.1003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  13  9............................................................................KKLGTDNAPGQEVRQSAAGLEALIRGARPVDFSHGDVDAHTPGAFDLFSAGVQSGGAYTEYRGDLGIRDLLAPRLAAFT--GAPVDARDGLIITPGTQGALFLAVAAT-----VARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARY-GATVIADQLYSRLRYAGASYTHLRAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRG----------WFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFAR-----------------------------------TPQAGSYLFPRLPKL---------------AVAPAEFVKILRLQAGVVVTPGTEFSHTADSVRLNFSQDHEA-AVAAARRIVTLVERYRA...... 407
15 -80.0003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  16  5............................................................................NSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETDGYTVALGLPALRQRIARLYGEW---YGVDLDPGRVVITPGSSGGFLLAFTAL-----FDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTA--PENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQ-GASFISDEIYHGIEYEAKAVALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAAL-----------DCDAELQANLDVYKANRKLMLERLPKAGFTRI-----------------------------------APPDGAFYVYADVSDLTD---------------DSRAFAAEILEKAGVAVTPGLDFDPGAGTLRFSYARATAD-IEEGLDRLEAFMQARGE...... 384
16 -79.8001xi9_A mol:protein length:406 putative transaminase  ali model follow..  19  1......................................................................AGSIRASKRALSV-EYAIRDVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGYYGDSEGLPELRKAIVEREKR---KNGVDITPDDVRVTAAVTEALQLIFGAL-----LDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTI--EEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEY-EIPVISDEIYDLMTYEGEHISPGSDVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIA----------GLTGPMDYLKEYMKKLKERRDYIYKRLNEIPGIST-----------------------------------TKPQGAFYIFPKIEVGPWK--------------NDKEFVLDVLHNAHVLFVHGSGFGYGAGHFRAVFLPPIEI-LEEAMDRFEKFMKERLKE..... 400
17 -79.6004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  14  11............................................................TTENLYFEGAMSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTAGYCDSKGLYSARKAIMQHYQA---RGMRDVTVEDIYIGNGVSELIVQAMQAL-----LNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCD--ESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQH-NLIIFADEIYDKILYDDAEHHSIAPLLTITFNGLSKTYRVAGFRQGWMVLNGPKYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISE--------FITPGGRLYEQRNRAWELINDIPGVSC-----------------------------------VKPRGALYMFPKIDA------------KRFNIHDDQKMVLDFLLQEKVLLVQGTAFNPWPDHFRIVTLPRVDD-IELSLSKFARFLSGYHQ...... 424
18 -79.2005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  17  5............................................................................VALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNGYSVALGIPELRDAIAADYQRR---HGITVEPDAVVITTGSSGGFLLAFLAC-----FDAGDRVAMASPGYPCYRNILSALGCEVVEIPCG--PQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDAS-DVRLISDEVYHGLVYQGAPQTSCTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPE---------ATAEADGNLASYAINRSLLLDGLRRIGIDRL-----------------------------------APTDGAFYVYADVSDFTS---------------DSLAFCSKLLADTGVAIAPGIDFDTGGSFVRISFAGPSGD-IEEALRRIGSWLPS......... 387
19 -79.1001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  17  1....................................................................MTNNPLIPQSKLPQLGTTIFTQMSALAQQ-----HQAINLSQGFPDFDGPRYLQERLAHHVAQGQYAPMTGVQALREAIAQKTERLY--GYQPDADSDITVTAGATEALYAAITAL-----VRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ---PPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGH-EIFVISDEVYEHINFSQQGHASVLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALA----------DMLRAEPEHYLALPDFYRQKRDILVNALNES------------------------------------RLEILPCEGTYFLLVDYSAVSTL--------------DDVEFCQWLTQEHGVAAIPLSVFCADHKLIRLCFAKKEST-LLAAAERLRQL............ 386
20 -79.0002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  16  11............................................................................SDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYEN-EVVYYSHSAGIWELREAFASYYKRR---QRVDVKPENVLVTNGGSEAILFSFAVI-----ANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR--MEEGFAIP-QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERH-GLFLIVDEVYSEIVFRGESALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVG----------LLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRF-----------------------------------TKPSGAFYITAELP-----------------VEDAEEFARWMLTDFNTMVAPLRGFYLGKKEIRIACVLEKDL-LSRAIDVLMEGLKMFCSS..... 399
21 -79.0001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  19  1.........................................................................MRLHPRTEAAKESIFPRMSGLAQR-----LGAVNLGQGFPSNPPPPFLLEAVRRALRQDQYAPPAGLPALREALAEEFA---------VEPESVVVTSGATEALYVLLQSL-----VGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDL-TPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAH-DLFLISDEVYDELYYGERRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEAL--------KLARREGFYEALREGYRRRRDLLAGGLRAM------------------------------------GLRVYVPEGTYFLMAELPG---------------------WDAFRLVEEARVALIPASAFYLEKDLFRFAFCKTEEE-LHLALERLGRVVNSPREA..... 374
22 -79.0002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  17  1.........................................................................MATVSRLRPYATTVFAEMSALATR-----IGAVNLGQGFPDEDGPPKMLQAAQDAIAGGQYPPGPGSAPLRRAIAAQRRRHF--GVDYDPETEVLVTVGATEAIAAAVLGL-----VEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVP-DGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAA-NLVVITDEVYEHLVFDHARHLPLMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVA----------LALDTEDAWVAALRNSLRARRDRLAAGLTEI------------------------------------GFAVHDSYGTYFLCADPRPLGYD--------------DSTEFCAALPEKVGVAAIPMSAFCDPNHLVRFTFCKRDDT-LDEAIRRLSVLAERPATGVPRG. 403
23 -78.7005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  15  1..........................................................................ANAKRIEGLDSNVWVEFTKLAAD-----PSVVNLGQGFPDISPPSYVKEELSKAANMNQYTRGFGHPALVKALSCLYGKIY--QRQIDPNEEILVAVGAYGSLFNSIQGL-----VDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKH-DTLCISDEVYEWLVYTGHTHVKIMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWID---IKRMDDPECYFNSLPKELEVKRDRMVRLLNSV------------------------------------GLKPIVPDGGYFIIADVSSL-----GADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSEKLVRFCFIKK-DSTLDAAEEIFRAW............ 410
24 -78.2002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  18  3............................................................................SKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGHYTDSRGILELREKISELYKD---KYKADIIPDNIIITGGSSLGLFFALSSI-----IDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF----------TVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYEN-IPYIISDEIYNGLVYEGKCYFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKE---------TEREINSMIKEFDRRRRLVLKYVKDF------------------------------------GWEVNNPIGAYYVFPNIGE------------------DGREFAYKLLKEKFVALTPGIGFGSGKNYIRISYANSYEN-IKEGLERIKEFLNK......... 370
25 -76.8001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  15  8............................................................................MSNHAGLVFNPIRTVSDNA-KPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKENGYFPTVGSPEAREAVATWWRNSKEELKSTIVKDNVVLCSGGSHGILMAITAI-----CDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCR--PENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEEL-RLPLFSDEIYAGMVFKGKDPNATFTVPRVILGGTAKNLVVPGWRLGWLLYVDSFLEGLKRVGMLVCGPCTVVQAALGEA----------LLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAP-----------------------------------TMPRGAMYLMSRID-----------LEKYRDIKTDVEFFEKLLEEENVQVLPGTIFHA-PGFTRLTTTRPVEV-YREAVERIKAFCQRHAA...... 415
26 -76.5002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  14  3..............................................................SSSSGLVPRGSHMISNKLANIPDSYFGKTMGRK--IEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPEYGAFHGKEAFKQAIVDFYQRQY--NVTLDKEDEVCILYGTKNGLVAVPTCV-----INPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL---EPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGT-DTKIVHDFAYGAFGFDAKNPSENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIY----------ALNHYDDFLEEQSNVFKTRRDRFEAMLAKA------------------------------------DLPFVHAKGGIYVWLETP----------------PGYDSEQFEQFLVQEKSILVAPGKPFGEGNRYVRISLALDDQK-LDEAAIRLTELAYLYE....... 398
27 -76.2002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  13  2...................................................................MAESRPARRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDYSTSRGIPRLRRAISHWYRDRY--DVQIDPESEAIVTIGSKEGLAHLMLAT-----LDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLV--PGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQY-DVMVVHDLAYADIVYDGWKAPSIMKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIA----------ALEGDQQCVRDIARQYQQRRDVLVKGLREA------------------------------------GWMVENPKASMYVWAKIPEPYAHL-------------GSLEFAKKLLQDAKVSVSPGIGFGDGDDHVRFALIENRDR-LRQAVRGIKAMFRADGLLSPQRK 406
28 -75.0002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  15  3................................................................................RVPEPSVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTYCLKSCTLPFLEEAARWYEGRY--GVGLDPRREALALIGSQEGLAHLLLAL-----TEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL----REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKH-GLWLIHDNPYVDQVYEGEAPLPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVE----------ALKTPKEVVRGYARVYRERALGMAEALKGV-------------------------------------LSLLPPRATMYLWGRLP----------------EGVDDLEFGLRLV-ERGVALAPGRGFGGGKGFVRIALVRPLEE-LLEAAKRIREALD.......... 376
29 -74.6003ele_A mol:protein length:398 Amino Transferase  ali model follow..  17  1........................................................................GMVVNESMYQLGSVRSLFEYGKKRAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDYGYTSAQGDVETRAAIAEFLNNT---HGTHFNADNLYMTMGAAASLSICFRALTS----DAYDEFITIAPYFPEYKVFVNAAGARLVEVPAD---TEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKSPIFIIADEPYREIVYDGIKVPFVYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGACAPSLFQKMIVKCQ---------------GATGDINAYKENRDLLYEGLTRI------------------------------------GYHCFKPDGAFYMFVKALE-----------------DDSNAFCEKAKEE-DVLIVAADGFGC-PGWVRISYCVDREM-IKHSMPAFEKIYKKYNK...... 398
30 -73.9004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  14  5..............................................GMASMTGGQQMGRDLYDDDDKDRWTSFRRIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSGKYPPTVGADNLRQVVSTYWRRFCKSRQEALKWENVIITSGVSQAIVLALTAL-----CNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLD--PSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQH-QIPLISDEIYAEMVLNNGIFTSVADVPRLILGGTAKYQVCPGWRVGWSILIDPMWAVGMERLTQLIAGVNSICQEAIART---------LLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISM-----------------------------------EAPQASMFVMLKLN-----------LSYFQDLKSDMEFYEKLLDEENVQVLPGEIFGM-SGFLRATVSRPSAV-LNEAVDRIIEFCERHKK...... 438
31 -73.3003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  16  22............................................................................PSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDALDSGKYAPSIGFLSSREEIASYYHC----PEAPLEAKDVILTSGCSQAIDLCLAVL-----ANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLL--PEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQ-CVPILADEIYGDMVFSDCKYEPLADVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRSQRILGPCTIVQGALKSILCR---------TPGEFYHNTLSFLKSNADLCYGALAAIPGLRP-----------------------------------VRPSGAMYLMVGIE-----------MEHFPEFENDVEFTERLVAEQSVHCLPATCFEY-PNFIRVVITVPEVM-MLEACSRIQEFCEQHYH...... 420
32 -73.2003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  13  14........AVDNLNPYAVRGEIVIHAQRLQEQDEILYCNIGNPQSLGQQPVTFFREVLALC---------------------------------------DHPDLLQREEIKTLFSAISRAKQILAMIPGRAAYSHSQGIHGLRDAIASGIAS---RDGFPANADDIFLTDGASPGVHLMMQLL----IRNEKDGILVPIPQYPLYSASIALHGGALVPYYLN--ESTGWGLETSDVKKQLEINVRALVVINPGNPTGQVLAEENQYDIVKFCKNE-GLVLLADEVYQENIYVDNKKFHSFKPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVCSNITGQILASLVMNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITC-----------------------------------NEAEGAMYVFPQICLPQKAIEAAK----AANKAPDAFYALRLLESTGIVVVPGSGFGQGTWHFRCTILPQEDK-IPAVISRFTVFHEAFMSEYRD.. 490
33 -72.7003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  12  1............................................................GMNFPIDEKLIREKQNELHIKDLGMASIRDLVALVTNLKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGIYPNLDGLPELKQEASRFAKLFV---NIDIPARACVPTVGSMQGCFVSFLVAN-RTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLF--EYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKH-DVIVIEDLAYFGMDFRKDPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYRLRFGEALSSSALYALSSGATHSAQWGMAAMLKACNDNFRDSVIEYGRKARIMKKMFLDN--------------------------------NIVYDKDGNEPLADGFYFTVGY----------------KGMDSSKLIEKFVRYGMCAITLKTTGSKRNEAMRICTSLLPESQFPDLEKRLQMLNAE......... 436
34 -72.5003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  16  5............................................................................PSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDALDSGKYAPSIGYLSSREEVASYYHC----PEAPLEAKDVILTSGCSQAIELCLAVL-----ANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLL--PEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQ-CVPILADEIYGDMVFSDCKYEPMANVPILSCGGLAKRWLVPGWRLGWILIHDRRIRDGLVKLSQRILGPCTIVQGALKSILQR---------TPQEFYQDTLSFLKSNADLCYGALSAIPGLQP-----------------------------------VRPSGAMYLMVGIE-----------MEHFPEFENDVEFTERLIAEQSVHCLPATCFEY-PNFFRVVITVPEVM-MLEACSRIQEFCEQHY....... 402
35 -71.6003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  11  6.......................................RSTASGARSSTRSRRMTAVVQAVAQRAGTIDVQRNENFGKLRAGYLFPEIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAGYSGYGAEQGQGALREAVASTFYGHAG-----RAADEIFISDGSKCDIARIQ------MMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKN-GSILVYDAAYALYISNPDCPKTIYDEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQPE---------GLKEMNAMIKFYKENAQILKTTFTEM------------------------------------GFSVYGGDDAPYIWVGFPGK-----------------PSWDVFAEILERCNIVTTPGSGYGAGEGFVRASAFGSREN-ILEAVRRFKEAYGKRNAS..... 443
36 -71.4003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  13  7.........................LGTENLYFQSMTLESMNPQVKAV--EYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYLLDSPSFPEDAKARRILQACGGNSLYSASQGVNCIREDVAAYITRR--DGGVPADPDNIYLTTGASDGISTILKIL-----VSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLD--EENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEE-KLFLLADEVYQDNVYSPDCRFHSFKKELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQSREKESVLGNLAKKAKLTEDLFNQVPGIHC-----------------------------------NPLQGAMYAFPRIFIPAKAVEAAQ----AHQMAPDMFYCMKLLEETGICVVPGSGFGQREGHFRMTILPPVEK-LKTVLQKVKDFHINFLEKYA... 492
37 -70.5006DK6 Entity 1(prereleased)  ali follow..  13  10............................................................................KLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDEKGYGPEQGYDFLRNAIADNDYK---ARGLPIEADEIFISDGSKCDTGNIL------DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAG-KCTPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYAREN-GSVLLYDAAYEAFIQDPTIPHSIFRDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKRRHSTKFNGASYIVQKGAEALYTDE---------GKSQTKALIEHYMGNAALLVEACKNA------------------------------------GLSVFGGVNAPYVWVGCPA----------------GLTSWQMFDKMLNEANVVITPGSGFGAGEGYFRISAFNSRAN-VEEVCRRIAAL............ 410
38 -70.4004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  15  3..............................................................SSSSGLVPRGSHMSSLRPRREDPPVLEEWYRRH--LGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVVDSVSQGGEGVRRAIADRYAG--------GDADRVLVTHGSSEAIALTLNAL-----LHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGR--AVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAAT-GAVLVWDAATAEIAHRWEVLADPDGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAER----------AVRHADELIGARAAEARHNLAHLTGWMAAHEEL----------------------------------VRWTPPEGGVCALPVFRELERAAAGPQ---------EVERFCLELLERHRTLLVPGTAFGA-PHGARLGFGGPQED-FRAGLDGLSRFLRERAA...... 398
39 -70.2003jtx_A mol:protein length:396 aminotransferase  ali model follow..  12  1..........................................................................GMNTLLKQLKPYPFARLHEAMQGISPEGMEAVPLHIGEPKHPTPKVITDALTASLHEEKYPLTAGLPELRQACANWLKRR-YDGLTVDADNEILPVLGSREALFSFVQTV-----LNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC---PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKY-GFIIASDECYSEIYFDGNKPLGCLQQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAW-----------DDEQHVIDNRRLYQEKFERVIPILQQVFDVK-------------------------------------LPDASFYIWLKVPD-----------------GDDLAFARNLWQKAAIQVLPGRFLARGEGYVRIALVADVAT-CVKAAEDIVSLYR.......... 396
40 -70.2004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  13  27..............................................................FEMKKLGGSTKLVRNVNLEKLKNNYEINRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAGYRGYGLEQGNKTLRKAIAETFYRDLH-----VKSNEVFVSDGAQSDISRL------QLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPCGPPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTN-GSIIIFDSAYAAFIEDGSPRIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSS---------GGLKEIRSVNNYYKENRKILMDTLVSL------------------------------------GLKVYGGVNAPYLWVHFKGS-----------------KSWDVFNEILENTHIITVPGSGFGGGEEYLRISGFGRRDH-IVEASKRLQNFFNTRTKHFTYLS 450
41 -69.9002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  13  13..............................................................TPQEKIEYKTKVSRNSNMSKLQAGPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAGYSGYGAEQGAKPLRAAIAKTFYGGLG-----IGDDDVFVSDGAKCDISRLQ------VMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKN-GSIIVYDSAYAMYMSDDNPRIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPE---------GLEAMHKVIGFYKENTNIIIDTFTSL------------------------------------GYDVYGGKNAPYVWVHFPN-----------------QSSWDVFAEILEKTHVVTTPGSGFGGGEGFVRVSAFGHREN-ILEACRRFKQLYK.......... 426
42 -69.4003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  12  13............................................................................................RALLKEITPKKRGLDLGIGEPQFETPKFIQDALKNHTHSNIYPKSAFEESLRAAQRGFFKRRF---KIELKENELISTLGSREVLFNFPSFVLFD---YQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLT--KENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKH-DFILINDECYSEIYENTPPPSNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAW-----------LDDRHAEFFRNIYANNLKLARKIFKNTL----------------------------------------IYPYSFYVYLPVQ-------------------NGENFAKTLYQNEGIITLPALYLGRGADYVRLALVYDTPL-LEKPLEIIETYRENH........ 375
43 -69.3003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  14  1.........................................................................MKRNPHFVSLTKNYDLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARRGYGPDFGLPALRQKLSEDFYRGF------VDAKEIFISDGAKVDLFRLL------SFFGPNQTVAIQDPSYPAYLDIARLTGAKEI-IALPCLQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEH-EILILFDAAYSTFISDPSLPKSIFRFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGL------------SILPQLEAIHYYRENSDLLRKALLAT------------------------------------GFEVFGGEHAPYLWVKPTQA---------------NISDRDLFDFFLREYHIAITPGIGFGSGSGFVRFSSLGKRED-ILAACERLQMAPALQS....... 394
44 -68.9003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  17  1............................................................................GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQGTKYGWIEGSPAFKKSVSQLYTG--------VKPEQILQTNGATGANLLVLYSL-----IEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIE--EENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEV-GAYILSDEVYRSFSELDVPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQL----------ALAHYQEILERNRHILEENLAILDQWIEEEPLV-----------------------------------SYIRPAVVSTSFVKIA----------------VDMPMEDFCLQLLQEHGVLLVPGNRFER-DGYVRLGFACEQET-LIKGLEKLSQFLRRFDKE..... 374
45 -65.1001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  16  5............................................................................SRNATFNSHGQDSSYFLGWQEYEKNPYHIIQMGLAENAKNPEAAAFKKNGESIFAELFQDYHGLPAFKKAMVDFMAEI-RGNKVTFDPNHLVLTAGATSANETFIFCL-----ADPGEAVLIPTPYYPGFDRDLKWRTG-VEIVPIHCTSSNGFQITETALEEAYNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDK-GIHLISDEIYSGTAFSSPSFISVMWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGLVSSQTQHLLS--------AMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKS------------------------------------GISCLNGNAGLFCWVDMRHLLRS----------NTFEAEMELWKKIVYEVHLNISPGSSCHCTEGWFRVCFANLPERTLDLAMQRLKAFVGEYYNVPEVNG 440
46 -62.5001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  13  1...................................................................ILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLNPKGSICSEGIKSFKAANFQDYHGLPEFRKAIAKFMEKTR-GGRVRFDPERVVMAGGATGANETIIFCL-----ADPGDAFLVPSPYYPAFNRDLRWRTG-VQLIPIHCESSNNFKITSKAVKEAYNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQH-NIHLVCDEIYAATVFDTPQFVSIAKDLVHIVYSLSKDMGLPGFRVGIIYSFNDDVVNCARKMSSFGLVSTQTQYFLA--------AMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVV------------------------------------GIKCLKNNAGLFCWMDLRPLLRE----------STFDSEMSLWRVIINDVKLNVSPGSSFECQEGWFRVCFANMDDGTVDIALARIRRFVGVEK....... 428
47 -61.9006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  1.............................................................MGSSSSGLVPRGSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAEGLQATYEKRFTEAFFQLHRQPTA-----LVKNKTMLSYAASISTMVAGMFL-----KKERLAVTLIEPCFDNLYDVLANMDVPLYPID----ESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDH-DKLLLIDFCFASFTLFEPELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVRD---------SAADRLASVREVLTRNRECARKTLDGS------------------------------------ILEYQEPVVKSVAWFRVDH----------------PELTATDVHRLLSADGVYVLPGRYFYKGDAYVRMALAREPEM-FADAMALTRQVLDRHGR...... 407
48 -60.6005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  11  6............................................................................................QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNEVLWAESEQRPQIESEAHQAYFTLLGQHGYPAEPGRVLSCYSSSVSMEILARSL-----SASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHG-------ADLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEH-GTVLALDTSFRGFDAAAHAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREF---------SRDAADGGLADLHAFILHNRSVVRRALAGVEGVSFP-----------------------------------DPESRSSVE-------------------FAGRTGTEVWEEL-QRHHVFALPCRQFHDGDHMVRIALSRSTEP-LEKSVQVLRTVLET......... 375
49 -60.0003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  13  1........................................................................GMTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGNYDGPQGKTALLNALAVLLRETL---GWDIEPQNIALTNGSQSAFFYLFNLFAGRR--ADGSTKKVLFPLAPEYIGYADSGLEDDLFVNIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQH-NIPLVIDNAYGVPFPGFSEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMC-------EMIKRNDLLRLSETVIKPFYYQRVQQTIAIIRRYLS--------------------------------EERCLIHKPEGAIFLWLWFKDLP----------------ITTELLYQRLKARGVLMVPGHYFFPGHQCMRMNYVPEPDK-IEAGVKILAEEIERAWRE..... 416
50 -58.3003if2_A mol:protein length:444 Aminotransferase  ali model follow..  13  1........................................................................GMKFSKFGQKFQPTGISQLMDDLGDALKSDQPVNMLGGGNPAKIDADNDTGKANSSAIISNYSNPQGDSAFIDALVGFFNR---HYDWNLTSENIALTNGSQNAFFYLFNLFGGAFVSVDKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDYRVDFEALENLKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRY-DIPLIIDNAYGMPFPNIIYSDAHLDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIAT-------PLVANDRIKQLSDNEIKPFYQKQATLAVKLLKQALG--------------------------------DYPLMIHKPEGAIFLWLWFKDL---------------PISTLDLYERLKAK-GTLIVPSEYFFPGHECIRMSIAADEQT-LIDGIKVIGEVVRELYDN..... 443
51 -55.6002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  10  1..................................................................GAMNPLAQSLNEQLQQSNATAFAMLSDLGQNMAEAKSTTYNATIGMATNKDGKMFASSLDAMFNDFPYAPPQGIEELRDLWQQKMLRDN-PELSIDNMSRPIVTNALTHGLSLVGDLF-----VNQDDTILLPEHNWGNYKLVFNTRNG--ANLQTYPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKKGTKVIAVVDDAYYGLFYEDVYTQSLFTALPIRLDGATKEFFAWGFRVGFMTFGEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFDKEI---EQNIQTLKERYEVTKEVVYADQYHS------------------------------------HWQAYDFNSGYFMAIKVHDV-----------------DPEALRKHLIDKYSIGVIALNATD-----IRIAFSCVEKDDIPHVFDSIAKAIDDLR....... 430
52 -54.9003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  10  2..................................................................................VKLENSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVDLMSYFSDMTNPELEDAIKDLHGVV---GNAATEDRYIVVGTGSTQLCQAAVHAL-----SSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG-------------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDD-EAKVIHDFAYYWPHYTP---ITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKSESESENFFKYGREMMKNRWEKLREVVKESDAFTLPK-----------------------------------YPEAFCNYFGKSL-------ESYPAFAWLGTKEETDLVSELRRHKVMSRAGERCGSDKKHVRVSMLSREDV-FNVFLERLANMKLIKSID..... 390
53 -54.8001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  12  3...........................................TWTMKAAEEA-------AVANINCSEHGRAFLDGIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVSYFFNPVSNFIFELEKTIKELHEVV---GNAAAKDRYIVFGVGVTQLIHGLVISLSTATPDAPESKVVAHAPFYPVFREQTKYFD----------KKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRHAVI-----------KGCKSIYDMVYYWPHYTP---IKYKADEDILLFTMSKFTGHSGSRFGWALIKDESVYNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKTQKGTMRDLTFGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRR---------------------MRPPSPSYAWVKCEW------------------EEDKDCYQTFQNGRINTQNGVGFEASSRYVRLSLIKTQDD-FDQLMYYLKDMVKAKRKTPLIKQ 433
54 -51.8004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  14  1....................................................................SNAMPMTIKRATWNNGPDLAFDINNKANAAIEKREAVINAALGTLLDDKGKSVYDRLDEMDRSHIYAPIEGEKDYRKIVIDTLFGPYKPE----GYISAIATPGGTGAIRSAIFSY-----LDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDFANIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKKITLIVDVAYLEFAGDGDQQRKFFEKFVVVAFSMSKSHTAYGLRSGAAVGSKEIIEEFEASLAHSARCNWSNGTHAAQNI--------------------------------------LIELERAENKKIYEQELVDLRNMLKSRADVFVTAAKNKLTMIPYFGGFFTFIPT--------------------DKAFDIVKDLEKENIFTIPSAKGI------RVAICGVGEEKIPKLVQRLAFYTNK......... 412
55 -49.2003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  12  1...................................................................SNAMTSVAAKHAKGKKLKDVIFVTAGQADAKENGRENVVNGTLGEGNLVFLKTVKEEYLSLSDSEHYAPIAGIPDFLCAAEKECFGNFRPE----GHIRSIATAGGTGGIHHLIHNY-----TEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL----DEHNNFNHEAFQNRVNQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDRNNVIIGIDVAYLDYSGEKDEVRAFFNILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVTWSNICRPAMRTMANIVADPAKFKE-----EAERNCYYQLIRDRADIFKQEAAQV------------------------------------GLPMLPYRGGFFITIPTD-------------------SANAICEELKKEHIYVIALANGI-------RIAACGIPKCQMTGLAEKIYNAMKSLGK...... 417
56 -48.8003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  12  3.............................................................................QKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLGIIPQLQAVAEAEARLNAQPHGAYLPMEGLNCYRHAIAPLLFGADHPV-LKQQRVATIQTLGGSGALKVGADFLK---RYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWY--DEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKAR-ELIPFLDIAYQGFGAGMEEDAYAIRLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKA---TVRRNYSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVKVLSTEM-----------------------------------PERNFDYLLNQRGMFSYT-------------LSAAQVDRLREEFGVYLIASG---------RMCVAGLNTANVQRVAKAFAAVM........... 397
57 -48.4004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  12  1.........................................................................MAMFEHIDAYPGDPILTLNENFQKDPR--DQKVNLSIGIYDAEGRIPVMGAVREAEGPKPYLPMVGLAAYRDAVQSLVFG---ADHPARAAGRIALGGSGALKVGADFLKR-----YFPDSQVWLSDPSWENHRFIFERAGFTVNTYPY--YDEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEAR-ELLPFVDMAYQGFGAGLDADAFAVRVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLAG---AVRSNYSNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHV-----------------------------------SGEALTRYVKQRGMFTYT-------------LTESQVDALREVHGVYILRSG---------RMCVAGLNDSNVGIVADAIGKVLKSGA....... 402
58 -48.2001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  3.............................................................................GNLKPQAPDKILALMGEFRADPR--QGKIDLGVGVYDATGHTPIMRAVHAAETTKTYAGLSGEPEFQKAMGELILGD--GLKSETTATLATVGGTGALRQALELARM-----ANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYF--DAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKT-GALPLIDLAYQGFGDGLEEDAAGTRPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAF---LNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLS-----------------------------------GSDRFGFVAEHRGMFSRL-------------ATPEQVKRIKEEFGIYMVGDS---------RINIAGLNDNTIPILARAIIEVG........... 393
59 -47.2003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  3.............................................................................ENITAAPADPILGLADLFRADER--PGKINLGQGVYKDETGKSVKKAEQYLLENENYLGIDGIPEFGRCTQELLFGKGSALINDKRARTATPGGTGALRVAADFLAK-----NTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY--YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK-GWLPLFDFAQQGFARGLEEAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDALRAI-----EQELTDMRQRIQRMRQLFVNTLQEK-----------------------------------------GANRDFSFIIKQNGMFSFS-------------LTKEQVLRLREEFGVYAVASG---------RVNVAGMTPDNMAPLCEAIVAVL........... 396
60 -47.0001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  12  3.............................................................................ENITATTADPILGLADLFRADER--PGKIDLGIGYKDETGKTPVLTSVKKAEQYKNYLGIDGIPEFGRCTQELLFGKGSALINDKRRTAQTPGGSGALRVAADFLAK-----NTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY--YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK-GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFALYNERVGACTLVAADSETVDRAFGQMKA---AIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKG-----------------------------------ANRDFSFIIKQNGMFSFS-------------LTKEQVLRLREEFGVYAVASG---------RVNVAGMTPDNMAPLCEAIVAVL........... 396
61 -46.3004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  12  2........................................................................AVGTFENITAAPADPILGLADLFRADER--PGKINLGIGVYDETGKTPVLTSVKKAETTKNYLGIDGIPEFGRCTQELLFG---KGSALINDKRARPGGTGALRVAADFLAK-----NTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY--YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK-GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDALRAI-----EQELTDMRQRIQRMRQLFVNTLQEKGANRD------------------------------------SFIIKQNGMFSFSGL------------------TKEQVLRLREEFGVYAVASG---------RVNVAGMTPDNMAPLCEAIVAVL........... 400
62 -46.2004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  13  5..............................................................TLEAQTQGPGSMSLFSAVELAPRDPILGLNEAFNADTR--PTKVNLGVGVYTNEDGKIPLLRAVRDALPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTAALGGTGALKIGADFLRT-----LNPKAKVAISDPSWENHRALFDMAGFEVVAYPY--YDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKAR-RLVPFLDIAYQGFGESIEADAAAVRLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKR---VIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAG-----------------------------------IERDFSFINAQRGMFSYS--------------TSAQVDRLREEFGIYAVSTG---------RICVAALNTRNLDVVANAIAAVLK.......... 414
63 -45.8002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  3.............................................................................ENITTAPADPILGLADLLRADER--PGKIDLGMGVYDETGKTPVLTSVKKAEQTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTATPGGTGALRVAADFLAK-----NTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK-GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAI-----EQELTDMRQRIQRMRQLFVNTLQEK-----------------------------------------GANRDFSFIIKQNGMFSFS-------------LTKEQVLRLREEFGVYAVASG---------RVNVAGMTPDNMAPLCEAIVAVL........... 396
64 -45.7002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  3.............................................................................ENITTAPADPILGLADLLRADER--PGKIDLGMGVYNDETGKTPVLTSVKKATTKNYLGIDGIPEFGRCTQELLFG---KGSALINDKRARPGGTGALRVAADFLAK-----NTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYY--DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK-GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKA---AIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKG-----------------------------------ANRDFSFTIKQNGMFFFG-------------LTKEQVLRLREEFGVYAVASG---------RLNVAGMTPDNLAPLCEAIVAVL........... 396
65 -45.6004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  1...............................................................................MAMGKPDPILGLGQDFRMDPA--KRKVNLSIGVYDDADQPFVLECVKQATLGMDYAPVTGIASFVEEAQKLCPTCAALRDGRIASCQTLGGTGALRIGGDLLNRF-----VANCNRIYGPDVGYPNHESIFAKAGMELTPYSYY--DPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRR-NHIPFVDMAYQGFATGQLDHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLAL---LIRPMYSNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACG-----------------------------------SVHDWSHIERQVGMMAYT-------------LTREQVELLRSEYHIYMTLNG---------RAAVSGLNSTNVEYVSQAIHNVTK.......... 390
66 -45.2005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  11  2..........................................................................SWWTHVEMGPPDPILGVTEAFKRDTN--SKKMNLGVGAYRDDNPSVRKAEAQIAAKNLEYLPIGGLAEFCKASAELAENSEVLKSGRFVTVQTISGTGALRIGASFLQRF-----FKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYY--DPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKR-NLFAFFDMAYQGFASGDGDHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKI---LIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEG-----------------------------------STHNWQHITDQIGMFCFT--------------KPEQVERLIKEFSIYMTKDG---------RISVAGVTSSNVGYLAHAIHQVTK.......... 401
67 -45.0004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  1..................................................................MAMGTLEAQTQGPGSMGKPDPILGLGQDFRMDPA--KRKVNLSIGVYDDADQPFVLECVKQATLGMDYAPVTGIASFVEEAQKLCPTCAALRDGRIASCQTLGGTGALRIGGDLLNRF-----VANCNRIYGPDVGYPNHESIFAKAGMELTPYSYY--DPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRR-NHIPFVDMAYQGFATGQLDHLVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLAL---LIRPMYNNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACG-----------------------------------SVHDWSHIERQVGMMAYT--------------TREQVELLRSEYHIYMTLNG---------RAAVSGLNSTNVEYVSQAIHNVTK.......... 403
68 -44.5003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  11  2..........................................................................SWWTHVEMGPPDPILGVTEAFKRDTN--SKKMNLGVGAYRDDNGKPYVLPSVRKALDKEYLPIGGLAEFCKASAELAENNEVLKSGRFVTVQTISGTGALRVGASFLQRF-----FKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRY--YDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKK-NLFAFFDMAYQGFASGDGDHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKI---LIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEG-----------------------------------SSHNWQHITDQIGMFCFT-------------LKPEQVERLTKEFSVYMTKDG---------RISVAGVTSGNVGYLAHAIHQVTK.......... 401
69 -43.8001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  11  3.............................................................................ENITAAPADPILGLADLFRADER--PGKINLGIGVYDETGKTPVLTSVKKAEQYKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTATPGGTGALRVAADFLAK-----NTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY---DAENHTLDFDALINSLQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEK-GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKA---AILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKG-----------------------------------ANRDFSFIIKQNGMFSFS-------------LTKEQVLRLREEFGVYAVASG---------LVNVAGMTPDNMAPLCEAIVAVL........... 396
70 -43.3001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  11  3.............................................................................ENITAAPADPILGLADLFRADER--PGKINLGIGLYYDETGKIPVLTSVKKAEQKLYLGIDGIPEFGRCTQELLFG---KGSALINDKRARTAQSGALRVAADFLAK-----NTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY---DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK-GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKA---AIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKG-----------------------------------ANRDFSFIIKQNGMFSFS-------------LTKEQVLRLREEFGVYAVASG---------RVNVAGMTPDNMAPLCEAIVAVL........... 396
71 -42.8003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  13  13............................................................................................RNTMKWTRYGQGVLPLWVAESDFSTCPAVLQAITDAVQREAFGYQPDGSLLSQATAEFYADRYG----QARPEWIFPIPDVVRGLYIAIDHFT-----PAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT------GGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRY-DARVLVDEIHAPLVFDGQGVSDTAASVCITITAPSKAWNIAGLKCAQIIFSNPSD----------------------------------------------AEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKRIPITPMQATYLMWIDFRDT------------------EGSPSEFFIEKAKVAMNDGAWFGDGTGFCRLNFAT-SREVLEEAIDRMAKAVSHH........ 376
72 -42.8004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  14  2........................................................................AVGTFENITAAPADPILGLADLFRADER--PGKVDLGIGYKDETGKTPVMTSVKKAETTKTYLGLDGLPEFGRCTQELL---FGKGSALINDKRAAQTPGGSGALRVAADFLA---KNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAY---DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEK-GWLPLIDFAYQGFGRGLEEDAEGLRKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKA---AIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVNTLQEKG-----------------------------------ANRDFSFIIKQNGMFSFS-------------LTKEQVLRLREEFGVYAVASG---------RVNVAGMTPDNMAPLCEAIVAVL........... 400
73 -42.5003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  1..................................................................................MQPVLVFKLTADFREDPDPRKVNLGVGACHPWVLPVVKKVEQKIANDNSLEYLPILGLAEFRSCASRLALGDDSPAGGVQSLGGTGALRIGADFLARWYNGT-----NNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKR---GFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHR-FLFPFFDSAYQGFASGNLEYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEK---IVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALK-----------------------------------TPGTWNHITDQIGMFSFT--------------NPKQVEYLVNEKHIYLLPSGRINSGLTTKNLDYVA---TSIHEAVTKIAENLYFQSDYKDDDD 415
74 -41.9003ez1_A mol:protein length:423 Aminotransferase MocR family  ali model follow..  14  2...............................................................................MTKEASRPALDLARQAYEAFKARGLNLNMQRGQPADASNGLLTVLGAEDVRMNYPGGVAGLPSARALFAGYLDVKAENNNSSLELQGLVLTFALLHGV-----RGSTGPWLSQTPKMIVTVPGYDRHFLLLQTLGFELLTVDMQSD------PDVDAVERLAGTDPSVGILFVPSNPGGETISLEKARRLAGLQAAAPDFTIFADDAYRVHHLVEEDRAEPVPDRAFVFASTSKITF-AGAGLGFVASSEDNIRWLSKYLGAQSIGPNKVEQARHVKFLTEYPGGLEG-------------------------------------------LMRDHAAIIAPKFRAVDEVLRAELGETLPKGGYFISLDTAEPVADR------------------VVKLAEAAGVSLTPAGATDPHNRNLRLAPTRPPVEEVRTAMQVVAACIRLATEEYRAGH 423
75 -41.7001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  12  3.............................................................................ENITTAPADPILGLADLLRADER--PGKIDLGMGVYNDETGKSVKKAEQYLLENENYLGIDGIPEFGRCTQELL---FGKGSALINDKRARPGGTGALRVAADFLAK-----NTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAY---DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEK-GWLPLFDFAYQGFARGLEEDAEGLRKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQMKA---AIRVNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKG-----------------------------------ANRDFSFTIKQNGMFFFG-------------LTKEQVLRLREEFGVYAVASG---------RLNVAGMTPDNLAPLCEAIVAVL........... 396

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24