current user: public

If you have questions about the server, please let us know.

Query: 3f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .
# Score Template Links and tools%idFirst GMRNMQEKGVSEKEILEELKKYRSLDLKYEDGNIFGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTKLLEEKAVALLGSLLNNKDAYGHIVSGGTEANLMALRCIKNIWREKRRKGLSKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPIKEDYTIDEKFVKDAVEDYDVDGIIGIAGTTELGTIDNIEELSKIAKENNIYIHVDAAFGGLVIPFLDDKYKKKGVNYKFDFSLGVDSITIDPHKMGHCPIPSGGILFKDIGYKRYLDVDAPYLTETRQATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPILNIVAIEDEDYKEVCKKLRDRGIYVSVCNCVKALRIVVMPHIKREHIDNFIEILNSIKRDLast
1 -119.0003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model  100  1GMRNMQEKGVSEKEILEELKKYRSLDLKYEDGNIFGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTKLLEEKAVALLGSLLNNKDAYGHIVSGGTEANLMALRCIKNIWREKRRKGLSKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPIKEDYTIDEKFVKDAVEDYDVDGIIGIAGTTELGTIDNIEELSKIAKENNIYIHVDAAFGGLVIPFLDDKYKKKGVNYKFDFSLGVDSITIDPHKMGHCPIPSGGILFKDIGYKRYLDVDAPYLTETRQATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPILNIVAIEDEDYKEVCKKLRDRGIYVSVCNCVKALRIVVMPHIKREHIDNFIEILNSIKRD 397
2 -93.7004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  24  57..KALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGDSCGCVTSGGTESILMACKAYRDLAFEK------GIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRN-TAMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVK-GVTSISADTHKYGYAPKGSSLVLYSDKKYRYQFFVDTDWQGGYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKIFVFGNPQLSVIALGSRDIYRLSNLMTAKGWNLNQLQFPPSIHFCILLHARKRVAIQFLKDIRESVTQ 453
3 -91.0005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  24  21..HEFPERGMPRERLLEELRSAVREDRKWESGRCSGTMYCGDHEFLNEAYGLFSHVNALQRDLCPSMNRMESEIVAMTVALLHGERACGALSLGGTESILNATLAYREKARAER-----GIERPRMIWPASAHPAFRKAAHLFGFDVTVAPIDPVTMQVDADFVRDAVDANTVMLVGSACNYPYGTIDPIGALSAIAVEKDVWLHVDGCLGGWMLPWGEALGYPDIPAFDFRLP-GVTSISADTHKFGYGPKGGSVLAWRDASFRHQYFLMTDWVGGVGSPGLTGSRSGGLIAATWAALRSLGREGYLARAKAIFETAFDMQAAVRAIPELRVLGK--PTFCFAFTSIYHVNDFMRQRGWRFNGLQHPDALHMCVGPQTQPGVAERFRQDLGEAVEH 427
4 -89.5003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  21  35.FPQLPSNGIPQDDVIEELNKLNDLIPHTEGKVSGAVYHGGDDHLQTIAYEKYCVANQLHPDVFPAVRKMESEVVSMVLRMFNAPSGCGTTTSGGTESLLLACLSAKMYALHHR-----GITEPEIIAPVTAHAGFDKAAYYFGMKLRHVELDPTYQVDLGKVKKFINKN-TVLLVGSAPNFPHGIADDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYKNLPLLDFRVP-GVTSISCDTHKYGFAPKGSSVIMYRNSDLRHQYYVNPAWTGGYGSPTLAGSRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENDLDIMGNPRYSVISFSSKNIHELSDRLSKKGWHFNALQKPVALHMAFT-RLSAHVVDEICDILRTTVQE 436
5 -89.0003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  22  30..FKMPENSIPKEAAYQIINDELMLDGNPRLNLASF-VTTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPTAVGVGTVGSSEAIMLAGLAFKRKWQNKRKAEGKPVDKPNIVTGANVQVCWEKFARYFEVELKEVKLEGYYVMDPQQAVDMVDEN-TICVAAILGSTLNGEFEDVKLLNDLLVEKNTPIHVDAASGGFIAPFLYP-------ELEWDFRLLVKSINVSGHKYGLVYAGIGWVIWRNKEDLEELIFHINYLGAQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTEFNIVSKDEGVPLVAFSLTEFEISDMLRRYGWIVPAYTMPPVLRVVIREDFSRTLAERLVIDIEKVMRE 443
6 -88.9005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  21  27..HDLPKYKLAKHALEPRERLVRDQLLDEGNSRLNLATFCQTEPEAVELMKDTLEKNAIDKSEYPRTAEIENRCVNIIANLWHAPEFTGTSTIGSSEACMLAGLAMKFAWRKRAKANGLTAHQPNIVISAGYQVCWEKFCVYWDIDMHVVPMDDHMSLNVDHVLDYVDDYTIMGITYTGQYDDLARLDAVVERYNRTTKFPVYIHVDAASGGFYTPFIEP-------ELKWDFRLNVISINASGHKYGLVYPGVGWVIWRDQQYLKELVFKVSYLGGEPTMAINFSHSASQLIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGFSLINDGHELPLICYELTLYDLSDRLLMKGWQVPTYPLPKIQRIVVRADFGMSMAHDFIDDLTQAIHD 447
7 -85.3003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  23  73..ARLPRAGLPRAEILAEIAAMGAAEPAWRDGYASGAVYEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDTVCGTVTSGGTESLLLAMKTYRDWARATK-----GITAPEAVVPVSAHAAFDKAAQYFGIKLVRTPLDADYRADVAAMREAITPN-TVVVAGSAPGYPHGVVDPIPEIAALAAEHGIGCHVDACLGGFILPWAERLGYPV---PPFDFRLGVTSVSADTHKYGYGAKGTSVILYRRPDLLYQYFIAADWPGGYFSPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPLKILGDPLWVIAVASDENIYQVMEEMAGRGWRLNGLHRPPAFHVALLRHTEPGVVDRFLADLQDAVAQ 472
8 -84.5005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  23  69..ARLPRAGLPRAEILAEIAAMGAAEPAWRDGYASGAVYEHHIAFLNEVYALQSQSNPLHPDLWPSTAKFEAEVVAMTAHMLGGDTVCGTVTSGGTESLLLAMKTYRDWARATK-----GITAPEAVVPVSAHAAFDKAAQYFGIKLVRTPLDADYRADVAAMREAITPN-TVVVAGSAPGFPHGVVDPIPEIAALAAEHGIGCHVDACLGGFILPWAERLGYPV---PPFDFRLGVTSVSADTHKYGYGAKGTSVILYRRPDLLYQYFIAADWPGGIASPTFAGSRPGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPLKILGDPLWVIAVASDENIYQVMEEMAGRGWRLNGLHRPPAFHVALLRHTEPGVVDRFLADLQDAVAQ 468
9 -82.7001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  18  30..KRFPLHEMRDDVAFQIINDELYLDGNARQNLAT-FCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKGTNTIGSSEACMLGGMAMKWRWRKRMEAA-GKPTDKPNLVCGPVQICWHKFARYWDVELREIPMPGQLFMDPKRMIEACDENT-IGVVPTFGVTYTGNYEFPQPLHDADTGIDIDMHIDAASGGFLAPFVAP-------DIVWDFRLRVKSISASGHKFGLAPLGCGWVIWRDEEALPELVFNVDYLGGQGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGYEFICTGRPDEGIPAVCTLYDLSERLRLRGWQVPAFTLGGVMRIMCRRGFEMDFAELLLEDYKASLKY 447
10 -82.3001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  18  30..KRFPLHEMRDDVAFQIINDELYLDGNARQNLAT-FCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKGTNTIGSSEACMLGGMAMKWRWRKRMEAA-GKPTDKPNLVCGPVQICWHKFARYWDVELREIPMRPGLFMDPKRMIEACDENT-IGVVPTFGVTYTGNYEFPQPLHDADTGIDIDMHIDAASGGFLAPFVAPD-------IVWDFRLRVKSISASGHKFGLAPLGCGWVIWRDEEALPQLVFNVDYLGGIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGYEFICTGRPDEGIPAVCTLYDLSERLRLRGWQVPAFTLGGVMRIMCRRGFEMDFAELLLEDYKASLKY 447
11 -81.7001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  16  44..ATAPQEPDTFEDILQDVEKIMPGVTHWHSPYFFAYFPTASSAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLQLPEGGGVIQGSASEATLVALLAARTKVASPGLTQGAVLEKLVAYASDQAHSSVERAGLIGGVKLKAIPSDGKFAMRASALQEALERDKPFFVVATLGTTSCCSFDNLLEVGPICHEEDIWLHVDAAYAGSAFICPEFRHLLNGVEF-------ADSFNFNPHKWLLVNFDCSAMWVKRRTLTGAFKLDPVYLTDYRHWQLPLGRR-FRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPFEVCAEVTLGLVCFRLKGNEALLERINSARKIHCRLRGQFVLRFAISRKVESGHVRLAWEHIRGLAAE 473
12 -81.4003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  16  44..AAAPQEPDTFEDIINDVEKIMPGVTHWHSPYFFAYFPTASSAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLELPKGGGVIQGSASEATLVALLAARTKVIHRLQAASPEMEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKPFFMVATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEF-------ADSFNFNPHKWLLVNFDCSAMWVKKRTLTGAFRLDPTYLTDYRHWQIPLGRR-FRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPFEICVEVILGLVCFRLKGNEALLQRINSAKKIHCHLRDKFVLRFAISRTVESAHVQRAWEHIKELAAD 473
13 -80.6004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  17  49..ESAPEDPDSWDSIFGDIERIMPGVVHWQSPHMHAYYPALTSSLLGDMLADAINCLGFTWASSPACTELEMNVMDWLAKMLGLPEGGGVLQSTVSESTLIALLAARKNKSEPDADESSLNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKPVFVCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEY-------ADSFTFNPSKWMMVHFDCTGFWVKDKYLQQTFSVNPIYLRDFMHWQIPLSRR-FRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPFEIPAKRHLGLVVFRLKGTENVLKEIAKAGRLFATIQDKLIIRFTVSQFTTRDDILRDWNLIRDAATL 477
14 -78.3003k40_A mol:protein length:475 Aromatic-L-amino-acid decarboxylase  ali model follow..  16  44..DAAPEKPEKWQDVMQDIERIMPGVTHWHSPKFHAYFPTANSAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAGGGVIQGTASESTLVALLGAKAKKLKEEWDEHTILGKLVGYCSDQAHSSVERAGLLGGVKLRSVQSEN-HRMRGAALEKAIEQDVPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGSAFICPEYRHLMKGIES-------ADSFNFNPHKWMLVNFDCSAMWLKDPSVVNAFNVDPLYLKDYRHWQIPLGRR-FRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSFELAAEINMGLVCFRLKGNEALLKRINGRGHIHAKIKDVYFLRMAISRFTQSEDMEYSWKEVSAAADE 470
15 -78.2002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase  ali model follow..  20  72...DLDNKNAPLKSVIDDVAEVAKNAIFTQHPDCIAHLHTPPLAVAAEAMIAALNQSMDSWDQASSATYVEQKVVNWLCDKYDLSEADGIFTSGGTQSNQMGLMLARDWIADKLSGH-DYADKLRIVCSKKSHFTVQKSASWMGLGVMTVDANADGTMDITKLDEVIAQAKPFAIVGTAGTTDHGAIDDLDFIADMAVKHDMWMHVDGAYGGALI-LSSHKSRLKGVER-------AHSISVDFHKLFYQTISCGALLVNDKSNFKFLLHHADYLPNLVDKSIATTKR-FDALKVFMTMQNVGPKALGDMYDHLLAQTLEVADMIRTNDFELLAEPSLSTVLFRATHNKALRLEALTRGIAVTIVDGKTALKFTINPCLTTSDFESLLSKINMLAVE 495
16 -78.0004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  21  60...TIPEAAATEATLLQAIRDMVDGSMNPANPGYIGHMDPMPAAILGDLVAAAVNNNMLSLEMSPSFSRLETLLLRAIAGLFGLGEAGGVLTSGGSLANLQALAVARNVADSVEPGITGLAQRPVIFASEAAHTSLQKAAMLLGLGVIPVRATADSRMDPEDLRARIDQARPFCVVATAGTTTTGNIDPLAEIGAIAREHGLWFHVDAAYGGALVFSERHRWRLAGIEQ-------ADSITFNPQKWLYVAKTCAMVLFRDAGLERAFRIPAPYMRNLGEIGVQGTRH-ADVVKLWLTLQHIGQQGYARLIDDGYRLAERVVEGVRQRPLRLAGEIDTNIVCFRGEPNAALQALLLREGKIFPVYRGGRWLRAVLNPYTTDAVIDAMFKQIDRFAGR 480
17 -77.3004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  19  71..VDVEKCHFDFLSVTNDSPEEFLVGRGDGKDSGALYAIHPKEELLKEVYGATALTNPL-HDKWPRINAMQAEVIRWCQNLFHGSKGYGLLTHGGTTSIIEAMAAYVIRARAK------GIDYPEIVVPETAHAAFKKAAELTGAILITVPVKKTGAVNPNVMSSYITRN-TAVMVGSAPSFMNGIHDPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSS------EPMDFRVGVTSISADLHKYGCCPKGTSVCLFSEDSPALSVYAALNWSGGLYATILDGSTSGARVAEVYATLSYYGKNKYQEIAKSIIRLRNAIQKELTALDIYVYGNPQWSILGFRSNNAHFIADELEKRGWKLNLLQNPDGFHLCLTHVLVGSFETQFIKDLREAVID 473
18 -77.0004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain protein  ali model follow..  20  63..IKIPEKGRPVNEVVSEMMNVYRYRGDANHPRFFSFVPGPASSWLGDIMTSAYNIHAGGSKLAPMVNCIEQEVLKWLAKQVGFTEPGGVFVSGGSMANITALTAARDNKLTDI-----NLHLGTAYISDQTHSSVAKGLRIIGITIRRIPTNSHFQMDTTKLEEAIETDKPFVVIGTAGTTNTGSIDPLTEISALCKKHDMWFHIDGAYGASVLLSPKYKSLLTGTGL-------ADSISWDAHKWLFQTYGCAMVLVKDIRLFHSFHVNPEYLKNTWDIGMELTRP-ARGLKLWLTLQVLGSDLIGSAIEHGFQLAVWAEEALNPKKWEIVSPAQMAMINFRYAPNEKISHRILESGYAATVLNGKTVLRICAHPEATQEDMQHTIDLLDQYGRE 482
19 -76.9005o5c_A mol:protein length:519 Putative decarboxylase involved in desferrioxamine biosynthesis  ali model follow..  21  75...DLDQSLGSNEAALEELKKYLRDAVWFHHPKYVAHLNCPVVSLLAEQIMAAVNSSVDTWDQSAGGTLIEQKVIDWTLSRIGLPAADGIFTSGGTQSNLMAMLLARDSWCAAHHPGHHDAAKWRVFTSKLSHFSIQKSMAILGLGVIPVDYDERYRMDVDCLKQEVQRCLPVAVVATSGTTDFGSIDPLGAISELCKHHGMWMHVDAAYGCGLLVSESHRPRLAGIEK-------ADSVTVDYHKSFFQTVSCGAFFVRDKHHLSHVTHHADYLNNLVNKSIQTTRR-FDALKMWLTLRVSGPMALGNAFDDILALTQIAHQLLNAHPIEVLHVPELTTQIFRYVPNTNIRKAVFRSGNAVTKVNGRQYLKFTLNPNTTAADIEDVIALIVHYGRE 507
20 -76.8002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  20  61...ELADQPQNLEEILMHCQTTLKYAIKTGHPRYFNQLSTGLDGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGDGIFSPGGAISNMYAMMIARFKMPEVKEKGMAALPRLIAFTSEHSHFSLKKGAAALGIGVILIKCDERGKMIPSDLERRILEAKPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAAWGGGLLMSRKHKWKLSGVER-------ANSVTWNPHKMMGVPLQCSALLVREEGMQNCNQMHASYLYDTGDKALQCGRH-VDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMVKPQHTNVCFWYIPAPVIKARMMEYGTTMVSYQKVNFFRMVINPAATHQDIDFLIEEIERLGQD 497
21 -76.5002jis_A mol:protein length:515 CYSTEINE SULFINIC ACID DECARBOXYLASE  ali model follow..  19  75...ELRSQGESQKQILERCRAVIRYSVKTGHPRFFNQLFSGLDALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVGWSSGDGIFCPGGSISNMYAVNLARYQRPDCKQRGLRTLPPLALFTSKECHYSIQKGAAFLGLGVRVVKADERGKMVPEDLERQIGMAEPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSVLLSQTHRHLLDGIQR-------ADSVAWNPHKLLAAGLQCSALLLQDTSLKRCHGSQASYLLDTGDKVVQCGRR-VDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREFELVMEPEFVNVCFWFVPAPVLKERMVKEGSMMIGYQRGNFFRVVVNSALTCADMDFLLNELERLGQD 508
22 -76.2006eeq_A mol:protein length:490 4-hydroxyphenylacetaldehyde synthase  ali model follow..  17  60..DKAPFHGESMEVILSDVNEIVPGLTHWQSPNFHAYFPASSSGLLGELLCSGLSVIGFTWSSSPAATELENVVVDWMAKMLNLPSGGGVLQANTCEAVLCTLAAARDKA--LNRVGDDQINKLVLYCSDQTHFTIHKGAKLIGIRIKSITTKKEFKLCPNDLRDAIRSDLPFYVCGTIGTTALGVVDPIKELGKVAREFDLWLHVDGAYGGSACICPEFQHYLDGVDL-------VDSISMNAHKWLLSNLDCCFLWLQSPNLIESLAAEANFLKDYKDWQISLSRR-FRAIKMWMVIRRYGVSNLIEHIRSDVSMAVRFEEMVAADDFEIVFPRKFALVCFKLSSTRELMERVNSSGKAYVQMGRIFFIRCVISSLTEERHVDNLWRLIQETAQS 487
23 -75.1006enz_A mol:protein length:530 Acidic amino acid decarboxylase GADL1  ali model follow..  20  89..LEMRDTGESQDKLLKLCQDVIHFSVKTNHPRFFNQLYAGLDSLAARIITEALNPSIYTYEVSPVFLLVEEAVLKKMIECVGWKEGDGIFNPGGSVSNMCAMNLARYRHPDIKEKGLSGLPRLILFTSAECHYSMKKAASFLGIGVYFVETDGRGKMIPEDLEKQIWQARPFLVCATSGTTVLGAFDPLDEIAEVCERHGLWLHVDASWGGSALVSRKHRRLLHGIHR-------ADSVAWNPHKMLMAGIQCSALLVKDKSLKKCYSAKATYLYDTGDKSIQCSRR-PDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREFKLLMEPEYTNVCFWYIPAPAIKEKMMKKGSLMLGYQKVNFFRQVVSPQVSREDMDFLLDEIDSLGRD 523
24 -74.6003vp6_A mol:protein length:511 Glutamate decarboxylase 1  ali model follow..  19  68...ELSDHPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWSSGDGIFSPGGAISNMYSIMAARYKYPEVKTKGMAAVPKLVLFTSEQSHYSIKKAGAALGFGVILIKCNERGKIIPADFEAKILEAKPFYVNATAGTTVYGAFDPIQEIADICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIER-------ANSVTWNPHKMMGVLLQCSAILVKEKGLQGCNQMHASYLFDTGDKAIQCGRH-VDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMVEPEHTNVCFWYIPAPKIKALMMESGTTMVGYDKANFFRMVINPAATQSDIDFLIEEIERLGQD 504
25 -74.3006eei_A mol:protein length:490 Tyrosine decarboxylase 1  ali model follow..  16  55..DSAPDHPETLDQVLDDVRAILPGVTHWQSPSFFAYYPSNSSGFLGEMLSAGLGIVGFSWVTSPAATELEMIVLDWVAKLLNLPEFMSKGNGGGVIQGSASEAVLVVLIAARRSVGKNALEKLVVYSSDQTHSALQKACQIAGIHVLTTDSSTNYALRPESLQEAVSRDLPFFLCANVGTTSSTAVDPLAALGKIANSNGIWFHVDAAYAGSACICPEYRQYIDGVET-------ADSFNMNAHKWFLTNFDCSLLWVKDQDLTLALSTNPEFLKDYKDWQIPLGRR-FRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDPFEIVTPRIFALVCFRLVPNRELLDAVNSSGKLFTALSGKIVLRCAIAPLTEEKHVKEAWKIIQEEASY 486
26 -73.2002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  14  50..RKIPENGIDDEKIKLFLKFLSMMDTDEREARTYSKIHEELSSCHGIGRSGNLVDPQPKASGASIMYALTNKILESFFKQLGLNVAIATPISTGMSISLCLSAARKKY------------GSNVVIYPYASHKSPIKAVSFVGMNVETVLDGDRVYVPVEDIENAIKKEIRPCVLSTLTFFPPRNSDDIVEIAKICENYDIPHIINGAYAIQNNYYLE--------KLKKAFKYRVDAVVSSSDKNLLTPIGGGLVYSTDAEFIKEIS-----------LSYPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLSGKFLDVESPIASCISVNSIAAKLYNLRVTGPRGIKKTDHDYIVMNAAIGVRTEDIVNSVSKLEKI... 448
27 -71.6006eew_A mol:protein length:500 Aromatic-L-amino-acid decarboxylase  ali model follow..  17  65..ETAPYLPEPLDDIMKDIQKIIPGMTNWMSPNFYAFFPATVSAFLGEMLSTALNSVGFTWVSSPAATELEMIVMDWLAQILKLPKFMFSGTGGGVIQNTTSESILCTIIAAREKLGPDSIGKLVCYGSDQTHTMFPKTCKLAGIYIRLIPTTVDFGISPQVLRKMVEDDVPLFLCATLGTTSTTATDPVDSLSEIANEFGIWIHVDAAYAGSACICPEFRHYLDGIER-------VDSLSLSPHKWLLAYLDCTCLWVKQPHLLRALTTNPEYLVDFKNWQIATGRK-FRSLKLWLILRSYGVVNLQSHIRSDVAMAKMFEEWVRSDSFEIVVPRNFSLVCFRLKPNKKLLDMLNSTGRVYTIVGGIYMLRLAVSSLTEEHHVRRVWDLIQKLTDD 495
28 -71.4006eem_A mol:protein length:512 Tyrosine/dopa decarboxylase  ali model follow..  15  63..ESAPYNPESIETILEDVTNIIPGLTHWQSPNYFAYFPSSGSGFLGEMLSTGFNVVGFNWMSSPAATELESIVMNWLGQMLTLPKSDGSSGGGGVLQGTTCEAILCTLTAARNKIGRENINKLVVYASDQTHCALQKAAQIAGINVRAIKTSKNFGLSPNSLQSAILADIPLFLCATVGTTSSTAVDPIGPLCAVAKLYGIWVHIDAAYAGSACICPEFRHFIDGVED-------ADSFSLNAHKWFFTTLDCCCLWVKDSDLVKALSTSPEYLKDYKDWQIALSRR-FRSMKLWLVLRSYGVANLRTFLRSHVKMAKHFQGLIGMDNFEIVVPRTFAMVCFRLKPNVKLLESVNASGKIYAVVGGVYMIRFAVATLTEERHVTGAWKVVQEHTDA 508
29 -66.8005hsi_A mol:protein length:634 Putative decarboxylase  ali model follow..  25  62..PAFKKTVGHMKTVLDQLSERIRTESWHSAGRYWGHMNSETLALLAYNYAMLWNGNNVAYESSPATSQMEEEVGQEFARLMGYDYGWGHIVADGSLANLEGLWYARNIKKRSARSGKNLQRLGKWLVPQTKHYSWMKAADIIGIGVVPVPIDSNYRMDIQALESIIRKYAILGVVGVAGSTEEGAVDGIDKIVALRQKLYFYLHVDAAYGGYARALFEVYAAYKAFDQ-------AESITIDPHKMGYVPYSAGGIVIQDIRMRDTISYFATYVFLLGAYILEGSKAGATAASVWAAHHTLNVTGYGKLEGASIEGAHRYYDFLKNLKVHPLISPDFNMVDYVLKEDSYVKGSLYGKEYIVSHTGKVTIIRASVMTMNQRENFDYFAPRIKKAIQA 611
30 -37.6001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  14  27.EDLIPKEEVDELTLVRHYTGLSRRQVGVDTTFYLGSCTMKYNPKLHEEAARLFAHPYQDPRTAQGALRLMWELGEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHEDRGE-----GRTRRVVLVPDSAHGSNPATASMAGYQVREIPSGPEGEVDLEALKRELGPHV-AALMLTNPNTLGLFERRILEISRLCKEAGVQLYYDGANLNAIMGWARPGDM------------GFDVVHLNLHKTFTVPHGGG-PVGVKAHLAPYLFYLDFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGEFVAQPPEGFRALDLAKGLLELGFHPPTVYFPLIVKVEPTETEAKETLEAFAEAMGALLKK 440
31 -30.9001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  14  17................................SFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAARLI----GELLERPDADVHFISGGTQTNLIACSLALRPWEA-------------VIATQLGHISTHETGAIEATGHKVVTACPDGKLRVADIESALHENRIPKLVYISNTTEVGTQQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLA------DIARLTDMFYIGATKAGGMF--GEALIILNDALKPNARHLIKQRGALM------AKGWLLGIQFEVLMKD-----FFELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPILENTAELNNDFDMYTVEPLK-DGTCIMRLCTSWATEEKECHRFVEVLKRLVAS 357
32 -30.5003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  14  21..GKCPEDGWDESTLELFLHELAVMDSN-REGRVASALVARRH---GIGRSGDISAVQPKAAGSSLLNKITNSLVLNVIKLAGVHSVACFVVPMATGMSLTLCFLTLRHKRPKAK---------YIIWPRIDQKSCFKSMVTAGFEPVVIEEGDELRTDLKAVEAKIQEEHILCLHSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLQSSKCMHLIQQGARVG-------RIDAFVQSLDKNFMVPVGGAIIAGFNEPFIQDIS-----------KMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLALQTPHNPISLAMTLKTKAVTQLGSMLFTRQVS-ADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNI 442
33 -28.9005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  15  7................................QFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERASEYFRNLF-----ETDCEVFFAFNGTAANSLALASLCQSYHS-------------VICSETAHVETDECEFFSNGSKLLTAASVNGKLTPQSIREVALKRPKPRVVTITQATEVGTVDELKAISATCKELGLNLHMDGA-------FTNACAFLGCSPAELTWKAGVDVLCFGGTKNGMAV--GEAILFFNRQLAEDFDYRCKQAGQLA------SKMRFLSAPWVGLLED-----WLRHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQMP-EHAIEALRAKGWRFYTFIGSGGARFMCSWDTEEERVRELAADIRSIIT. 345
34 -27.6004eb5_A mol:protein length:382 Probable cysteine desulfurase 2  ali model follow..  15  9......................................AKPVDERILEAMLPYMTESFGNPSSVHSYGFKAREAVQKVAKLVNGGGGTVVFTSGATEANNLAIIGYAMRNARKGKH---------ILVSAVEHMSVINPAKFLGFEVEYIPVGKYGEVDVSFIDQKLRDDTILVSVQHANN-EIGTIQPVEEISEVLAGKAA-LHIDATASVGQIEVDVEK-------------IGADMLTISSNDI-YGPKGVGALWIRKEAKLQPVIL-----GGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESYLNGPNNVNVRFSYIEGESIVLSLDMAGIQASTGSAHGTLLLTLGRYNTDEDVDRLLEVLPGVIER 372
35 -27.5001v72_A mol:protein length:356 Aldolase  ali model follow..  13  11................................GFSSDNIAGASPEVAQALVKHSSGQAGPYGTDELTAQVKRKFCEIF-----ERDVEVFLVPTGTAANALCLSAMTPPWGN-------------IYCHPASHINNDECEFFSNGAKLMTVDGPAAKLDIVRLRERTREKTQPACVSITQATEVGSIDEIEAIGDVCKSSSLGLHMDGS-------FANALVSLGCSPAEMTWKAGVDALSFGATKNGVLA--AEAIVLFNTSLATEMSYRRKRAGHLS------SKMRFLSAQI---DAYLTDDLWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDSAMIDALLKAGFGFYHDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADR 352
36 -26.8003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  15  5................................RYIDLRSDTVTQPTDAMRQCMLHAEVGDYGEDPGVNALEAYG----ADLLGKEAA--LFVPSGTMSNLLAVMSHCQRGEG-------------AVLGSAAHIYRYEAAVLGSVALQPVPMQADGSLALADVRAAIAPDFTPTRLVCLENTHNGKVPYLREMRELVDEHGLQLHLDGA--------LFNAVVASGHTVR-ELVAPFDSVSICLSKGLGAP--VGSLLVGSHAFIARARRLRKMVGGGM------RQAGILAQAGLFAL-----QQHVVRLADDHRRARQLAEGLAALPGIRLVQTNMVFLQLTSGESAPLLAFMKARGILF---SGYGELRLVTHLQIHDDDIEEVIDAFTEYLGA 341
37 -26.8005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  14  36............DKYKNLTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGRLDEVTCPPIKDFLEDIAKFLNMDCA--RPTHGAREGKFIVMHAICK-------------EGDYVVLDKNAHYTSYVAAERAKLNVAEVEEYPTYKINLEGYKEVIDNKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKE-------------VKADFIVASGHKSMAASAPCGILAFSE-EFSDKITKTSEKFPVKEIEMLGCTSRGLPIVTLMASFPHV---ERVKKWDEELKKTRYVVDELEKIGFKQLGIKEHDLIKFETPVLDEIAKKDKRRGFFIGGIRAGVTKEIKMS-GLEWEQVEYVVNAIKEIVES 409
38 -26.5003vax_A mol:protein length:400 Putative uncharacterized protein dndA  ali model follow..  16  22.....................................ATTRVDQRVADIVLHWMTAEFGNAGSRHEYGIRAKRGVEYLASTVSAEPDELIFTSGATESNNIALLGLAPYGERTGRR--------HIITSAIEHKAVLEPLEHLGFEVDFLTPGPSGRISVEGVMERLRPDTLLVSLMHVNN-ETGVIQPVAELAQQLRATPTYLHVDAAQG----------------KVPGDLTTPIDMISISGHKI-GAPKGVGALVTRRREEMDDERVPLEPIGGGQERKLRPGTLPVPLIMGLAEAAKIFEAEHAQWQVAAQDLRSRLLAGLASTSFQVNGDPHILNLSFEDVDAEAFLVTLKDRAMGLPEEAASKSLRFSWTPGQATDLDVEELARGVAKLKP 392
39 -26.4003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  15  39..GKCPENGWDESTLELFLHELAIMDSNNFLGNC---VGEREGRVASALVAR-ISAVQPKAAGSSLLNKITNSLVLDIIKLAGVHTVANFVVPMATGMSLTLCFLTLRHKRPKAK---------YIIWPRIDQKSCFKSMITAGFEPVVIENGDELRTDLKAVEAKVQEDCILCIHSTTSCFAPRVPDRLEELAVICANYDIPHIVNNAYGVQSSKCMHLIQQGARVG-------RIDAFVQSLDKNFMVPVGGAIIAGFNDSFIQEIS-----------KMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKYNERLLHTPHNPI-VVPLGSMQTVSGYTFRGFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKA 460
40 -26.1002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  13  52..................................................................TPPIHDFIHNQLPKFLGCDVA--RVTNGAREAKFAVMHSLAK-------------KDAWVVMDENCHYSSYVAAERAGLNIALVPKYPDYAITPENFAQTIEEGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKE-------------IGADFIVGSGHKSMAASGPIG-VMGMKEEWAEIVLRRSEKYKNKEVELLGCTARGATIITLMASFPHV--RERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPYEISKKAKGGRFFLYRELKSRKIHGIKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIEK 369
41 -26.0004isy_A mol:protein length:404 Cysteine desulfurase  ali model follow..  14  17.....................................MHPAAIEAMAAVQRTIGNASSLHTSGRSARRRIEEA--ELIADKLGARPSEVIFTAGGTESDNLAVKGIYWARRDA------EPHRRRIVTTEVEHHAVLDSVNWLGAHVTWLPTAADGSVSATALREALQSHDDVALVSVMANNEVGTILPIAEMSVVAMEFGVPMHSDAIQAVGQLPLDFGA-------------SGLSAMSVAGHKF-GGPPGVGALLLRRDVTCVPLMH-----GGGQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVEGVLAEIDDVCLNAGNAHFTFRGCEGDALLMLLDANGIECST-SARGSLRLSLGHTSVEADVDAALEVLPGAVAR 385
42 -25.8004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  15  14.....................................IDPRVKEFIISLMDKELNPSSAHSSGRFAKNLIEAQIATALGITLSSREYDITFTSSGTEGNNLIM---------------KNFYDGDIFISAIEHLSIYNHINY-APNIKVISVNTQGLVDLEHLEELLAQSNKKLVSIIMANNESGVLQDIAEIGKITKKYEAKFHSDLVQGFGRIPINIKA-------------LGLDFATISGHKI-GGGQGGAALISSSNFQITPMII-----GGGQEKSVRSGTENVLAIAGFGLASALRTDNISENYIKIKKLQENLEKKLKKYPNVNIVSPNTTLITIPNTDAQAKLIGFDLHNICVSS-EAKSSIRISLSHTNTVRDIEAFIEAFEEIYDV 371
43 -25.7001ecx_A mol:protein length:384 AMINOTRANSFERASE  ali model follow..  18  9.....................................ATTRVDDRVLEEMIVFYREKYGNPNSAHGMGIEANLHMEKVAKVLGVSPSEIFFTSCATESINWILKTVAETFEKRKRT---------IITTPIEHKAVLETMKYLGFKVKYVPVDSRGVVKLEELEKLVDEDTFLVSIMAANN-EVGTIQPVEDVTRIVKKKNTLVHVDAVQTIGKIPFSLEK-------------LEVDYASFSAHKF-HGPKGVGITYIRKGVPIRPLIH-----GGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPPNTLSVSFPNIRGSTLQNLLSGYGIYVSTSSAQGAIRISLCKYNTEEEVDYFLKKIEEILSF 375
44 -25.5005wt2_A mol:protein length:401 Cysteine desulfurase IscS  ali model follow..  19  11.....................................ATTRIDPKVKEIMDPFLRDHYGNPSSLHQFGTETHPAIAKLYKGINARDID-IITSCATESNNWVLKGVYFDECLKKGKN-------HIVTTVAEHPAVRSTCNFLGVEVTYLPINEHGSITAEQVREAITEKTALVSVMWANN-ETGLIFPIEEIGAICKEKGVLFHTDAVQAIGKIPVDVLK-------------ANADFLSFSAHKF-HGPKGIGGLYIRSGVGLTPLFH-----GGEHMNGRRSGTLNVPYIVGMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGPNTTLVSVRGIEGEAMLWDLNRSNIAASTGSAHTAIRLSLSRFNTEAEIDKTIEVFSQAAVR 379
45 -25.5003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  15  48......................................................NPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAANFYQKKGKH---------IITSKTEHKAVLDTCRQLGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHVNN-EIGVVQDIAAIGEMCRARGIIYHVDATQSVGKLPIDLSQ-------------LKVDLMSFSGHKI-YGPKGIGALYVRRKPRVR---IEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGPNILNVSFNYVEGESLIMALKDRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGR 392
46 -25.4001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  13  25..................................QGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTGCDIVL------------WGLDWHQGDEILLTDCEHPGVQAIAARFGITYRFFPVAANQGDAAAVLANHLGPKTRLVILSHL-LWNTGQVLPLAEIMAVCRRHQVRVLVDGAQSAGSLPLDFSR-------------LEVDYYAFTGHKWFAGPAGVGGLYIHGDCLGEGAKGEPTGWAEGGKRFEVATSAYPQYAGLLAALQLHQRQGTAEEYQAICQRSEFLWRGLNQLPHVHCLATQAGLVSFTVDGHRAIVQKLEEQRIYLRTIADPDCIRACCHYITDEEEINHLLARLADFG.. 389
47 -25.1002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  19  3.............................SDKIMIDLRSDTVTKPTEEMRKAMAQAEVGDYGEDPTINELERLA----AETFGKEAA--LFVPSGTMGNQVSIMAHTQRGDE-------------VILEADSHIFWYEVAVLSGVMPHPVP-GKNGAMDPDDVRKAIRPRTSLIAIENTHNRSGGRVENIKEICTIAKEHGINVHIDGA--------IFNASIASGVPVK-EYAGYADSVMFCLSKGLCAP--VGSVVVGDRDFIERARKARKMLGGGM------RQAGVLAAAGIIAL-----TKMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILKVNAHGFIEALRNSGVLANAV-SDTEIRLVTHKDVSRNDIEEALNIFEKLFRK 347
48 -24.9003gzc_A mol:protein length:440 Selenocysteine lyase  ali model follow..  16  33.....................................ATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAKDIINSLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTSKGVKGAKPHFITSSVEHDSIRLPLEHLVAAVTFVPVSKSGQTEVDDILAAVRPTTRLVTIMLANN-ETGIVMPVPEISQRIKALNILVHTDAAQALGKQRVDVED-------------LGVDFLTIVGHKF-YGPR-IGALYIRGLG--EFTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEERLEAEFGQKRIHPNTCNFSIRGPRLQGHVVLAQCRVLMASV-VARNALRLSVGRSTTRAEVDLVVQDLKQAVAQ 435
49 -24.8005usr_A mol:protein length:426 Cysteine desulfurase, mitochondrial  ali model follow..  15  29......................................TTPLDPRVLDAMLPYLINYYGNPHSR-ESEAAMERARQQVASLIGADPREIIFTSGATESNNIAIKGVARFYRSRKKH---------LITTQTEHKCVLDSCRSLGFQVTYLPVQKSGIIDLKELEAAIQPDTSLVSVMTVNN-EIGVKQPIAEIGRICSSRKVYFHTDAAQAVGKIPLDVND-------------MKIDLMSISGHKI-YGPKGVGAIYIRRRP----VRVEALQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNPGCINLSFAYVEGESLLMALKDRAIGTDEDLAHSSIRFGIGRFTTEEEVDYTVEKCIQHVKR 395
50 -24.4004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  17  1.................................MIDLRSDTVTRPSRAMLEAMMAAPVGDYGDDPTVNALQDYA----AELSGKEAA--IFLPTGTQANLVALLSHCERGEE-------------YIVGQAAHNYLFEAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDARTKLLSLENTHNGKVEYLKEAWEFTRKRNLALHVDGA--------IFNAVVAYGCELK-EITQYCDSFTICLSKGLGTP--VGSLLVGNRDYIKRAIRWRKMTGGGM------RQSGILAAAGMYAL-----KNNVARLQEDHDNTAWMAEQLREAGADVMQDTNMLFVRVGEENAAALGEYMKARNVLI---NASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR 333
51 -24.2003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  18  1.................................MIDLRSDTVTRPSRAMLEAMMAAPVGDYGDDPTVNALQDYA----AELSGKEAA--IFLPTGTQANLVALLSHCERGEE-------------YIVGQAAHNYLFEAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDARTKLLSLENTHNGKVEYLKEAWEFTRERNLALHVDGA--------IFNAVVAYGCELK-EITQYCDSFTICLSKGLGTP--VGSLLVGNRDYIKRAIRWRKMTGGGM------RQSGILAAAGIYAL-----KNNVARLQEDHDNAAWMAEQLREAGADVMQDTNMLFVRVGEENAAALGEYMKARNVLI---NASPIVRLVTHLDVSREQLAEVAAHWRAFLAR 333
52 -23.8003a9x_A mol:protein length:432 Selenocysteine lyase  ali model follow..  17  26.....................................ATTPLEPEVIQAVTEAMKEAWGNPSSSYVAGRKAKDIIN-LAKMIGGKPQDIIFTSGGTESNNLVIHSTVRCFHEQDQISPEEGTRPHFITCTVEHDSIRLPLEHLVAEVTFVPVSKNGQVEVEDILAAVRPTTCLVTIMLANN-ETGVIMPISEISRRIKALNVLVHTDAAQALGKRRVDVED-------------LGVDFLTIVGHKF-YGPR-IGALYVRGVG--KLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLVSENCETYEAHMRDIRDYLEERLEAEFGKRIH-PNTCNFSIQGSQLRGYMVLAQCQTLLASV-VARNAVRLSVGRSTTRAEVDLIVQDLKQAVNQ 427
53 -23.7005i90_A mol:protein length:427 PvdN  ali model follow..  14  30..EGVPSDAGNKWKALRQQFDLDPQYLHFANFLLTSHPRPVREAIERLRVRFDRNPGEAVDWHREEIWKYEDEARAWAGRYFAVQPGQVALTGSTTDGLAAIY------------GGLLVQPGKEILTSSHEHYSLEYRHKRMGTQVREFPLFKD-DEILSSIAAQIRPQTRVLGMTWV-QSGSGVKLPIREIGKLVRELNIIYVVDGVHGFGVEDVSFAD-------------FDCDYFIAGTHKWLFGPRGTGVIIARSEQLQEHLVPSIPTFSRADNFG-GGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGEHPKVRLVTPTSGFTFFRVEDCEAVAKHLMAHRVISDAVDVGPVVRLAPSLLNDEAEIDRVLEILAPQLA. 427
54 -23.6003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  14  47................................................................AIIEPFEQKF----ADVLGMDDA--VFFPSGTMAQQVALRIW-----------SDETDNRTVAYHPLCHLEIHEQKELHPIETILVG-AADRLMTLDEIKAL--PDIACLLLELPQREIGGVASELETISRYCRERGIRLHLDGA--------LFEMLPYYEKTAA-EIAGLFDSIYISFYKGLGGI--AGAILAGPAAFCQTARIWKRRYGG-----------DLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTVPVSNMFHLHFDGSPKLEQVQEETGLGFVGYLVDKDGYCSTEISVGDAYGELDQQTRDAGFAR 351
55 -23.4001wyt_A mol:protein length:438 glycine dehydrogenase (decarboxylating) subunit 1  ali model follow..  14  27.FAHLPKEPLPEWKVLEELRRLAAQNLPAHKAFLGGGVRSHHVPPVVQALAALTAYTPYQPEVSQGVLQATFEYQTMIAELAGLEIANASMYDGAT-ALAEGVLLALRETGRMG-----------VLVSQGVHPELRAYLEAVGAKLLTLPLE-----GGRTPLPEVGEEVGAVVVQNPNF--LGALEDLGPFAEAAHGAGALFVAVADPLSLGVLKPPGA-------------YGADIAVGDGQSLG-LPMGFG-FLATKKAFVRQLQAREQYIRRAKAKSNITTNAQLTALMGAMYLAALGPEGLREVALKSVEMAHKLHALLLEVPGVRPFTPK-EFALALPKDPEAVRRALAERGFHVPREYGENLALFAATELHEEEDLLALREALKEVLA. 438
56 -22.5001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  13  8.......LALDAQDSLAPLRQQLPEGVIYLDGNSLGARPVAALARAQAVIAEEWGNGLIRSWNSAGWRDLSERLGNRLATLIGARDGEVVVTDTTSINLFKVLSAA------LRVQATRSPERRVIVTETSNFPTAEGLADMLQQGYTLRLV-----DSPEELPQAIDQDTAVVMLTHV-NYKTGYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQ-------------AGADYAIGCTYKYLNGPGSQAFVWVSPQLCDLVPQPLSGWFGHSRQFAMEGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRC-LTLVTPR-SHVSFEHPEGYAVIQALIDRG-VIGDYREPRIMRFGFTPYTTFTEVWDAVQILGEILDR 401
57 -21.7005b7s_A mol:protein length:419 Cysteine desulfurase  ali model follow..  16  48..........................................EAMDEYYLKYRANVHRGVHRLSQMATHKYEESRKIVADFIGAKFEEIVFTKNTSESNLVALGLGHIFKRGDK-----------IVTTPYEHHSWQRLATKLGLKLEFIEGDDEGNLDLSDAEKKIKGAKLVAVQHVSNAL--GVIHEVEELGKIAKDEGAIFVVDAAQSAGHMEVNVKK-------------LHADFLAFSGHKGPMGPTGIGVLYIREEGTIEDVSLDGYKLTEPPERFEAGTPNIGGAIGLAAGIRYIERIGLGRIERQEHKLVKRTTEGLDELEVPWYGKKHAGVVSFNVPHPHDVAAILDDHSIMVKKLGINGTVRASFHVYNSLEEVETFLGVMEELVK. 409
58 -21.3002hzp_A mol:protein length:501 Kynureninase  ali model follow..  13  77...YIPKIQDLPPVDLSLVN--KDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVKRPWITGDESIVGLMKDIVGANEKEIALMNALTVNLHLLMLSFFKPTPKRYK----------ILLEAKAFPSIESQLQLHGLNIEESMRETLRIEDILEVIEKEGDSIAVILFSGV-HFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHD-------------WGVDFACWCSYKYLNAGAGGIAGAFIHEKHAHTIKPALVGWFGHELST-ISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHNY-VNIITPS-CQLTITFSPNKDVFQELEKRG-VVCDKRNPNGIRVAPVPYNSFHDVYKFTNLLTSILDS 490
59 -20.4003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  14  1GMTN------TLKTSYQKTPYKLGGNGPRNVGVLTEALQNIDDNLESDIYGN------------AVIEDFETKI----AKILGKQSA--VFFPSGTMAQQIALRIW-----------ADRKENRRVAYHPLSHLEIHEQKELQQITPLLLG-TANQLLTIDDIKSLREPVSSVLIELPQ-REIGGQLEELEKISEYCHEQGISLHLDGA--------LWEITPFYQKSAE-EICALFDSVYVSFYKGIGGI--AGAILAGNDDFVQEAKIWKRRYGG-----------DLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVVPVSNMFHVYFENSAILTKIQDETGVGISGY-LQEKSADVCAFEVSVGDAFAEIKNLELVFRC 354
60 -20.0002yri_A mol:protein length:353 Aminotransferase, class V  ali model follow..  16  4.....................................LTPGPTPIPERVQKALLRPMRGHLD--PEVLRVNRAIQERLAALFDPGEGALVAALAGSGSLGM-------------EAGLANLDRGPVLVLVNGAFSVAEMAALHGLDPEVLDFPPGEPVDPEAVARALKRRRYRMVALVHGETSTGVLNPAEAIGALAKEAGALFFLDATLGMLPFSMRA----------------GVDYAFTGSQKCLSAPPGLAPIAASLEARKAFTGKRGWYLEHWERGGYHHTTPVLLHYALLEALDLVLEEGVAARERRAREVYAWVLEELKARGFRPYPKASPLPTVLVVRDADRLVRALYAEGVAVAGGIGPQVLRL-MGEGARREAYQAFLKALDRALAL 352
61 -19.8003kgw_A mol:protein length:393 Alanine-glyoxylate aminotransferase  ali model follow..  12  27.....................................LGPGPSNLAPRVLAAGSLRMIGHMQ--KEMLQIMEEIKQGIQYVFQTRNPLTLVVSGSGHCAMETALF----------NLLEPGDSFLTGTNGIWGMRAAEIADRIGARVHQMIKKPGEHYTLQEVEEGLAQHKPVLLFLVHGESSTGVVQPLDGFGELCHRYQCLLLVDSSLGGVPIYMDQ----------------GIDIMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTKWGCEGETRVIHHTTPVTSLYCLRESLALIAEQGLENCWRRHREATAHLHKHLQEMGLKFFVKPTITTVTVAGYNWRDIVSYVLDHFSIEIS--EERVLRI-LGYNATTENVDRVAEALREALQH 387
62 -19.8005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  12  31.....................................LGPGPSNLPPRIMAAGGLQMIGSMS--KDMYQIMDEIKEGIQYVFQTRNPLTLVISGSGHCALEAALV----------NVLEPGDSFLVGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVNSSLGGTPLYMDR----------------GIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKPTVTTVAVAGYDWRDIVSYVIDHDIEIMGGLGPKVLRI-LGCNATRENVDRVTEALRAALQH 391
63 -19.6003cai_A mol:protein length:406 POSSIBLE AMINOTRANSFERASE  ali model follow..  11  16.....................SLGDGWVHFDAPAGMLIPDSVATTVSTAFRRSGASTVGAHPSARRSAAVLDAAREAVADLVNADPGGVVLGADRAVLSLLAEASSSRAGLGY-----------EVIVSRLDDEAWLRAAHRYGAKVKWAEVDETGELPTWQWESLISKSTRLVAVNSASGT-LGGVTDLRAMTKLVHDVGALVVVDHSAAAPYRLLDIRE-------------TDADVVTVNAHAW-GGPPIGAMVFRDPSVMNSFGSVSTNPYATGPARLEIGVHQFGLLAGVVASIEYLAAVSMQSADAYLNRVFDYLMVSLRSLPLVMLIGRPIPVVSFAVHPADRVVQRLADNG-VLGVNDVGGAVTVGLAHYSTMAEVDQLVRALASLG.. 400
64 -19.5001m32_A mol:protein length:366 2-aminoethylphosphonate-pyruvate aminotransferase  ali model follow..  11  8.....................................LTPGPLTTSRTVKEAMLFDSCTWDD--DYNIGVVEQIRQQLTALATASEGYTSVLLQGSGSYAVEAVLGS----------LGPQDKVLIVSNGAYGARMVEMAGLMGIAHHAYDCGEVARPDVQAIDAILNADPTISHIAMVSETTTGMLNPIDEVGALAHRYGKTYIVDASFGGIPMDIAA----------------HIDYLISSANKCIQGVPGFAFVIAREQKLAACKGHSRSLSLDDNHGKWRFTSPTHTVLAFAQALKEL-EGGVAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPIITAFRFSEFYRRLKEQGFVIYP--QSDCFRIGNIGEVYAADITALLTAIRTAMYW 364
65 -19.5002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  12  26.....................................LGPGPSNLPPRIMAAGGLQMIGSMS--KDMYQIMDEIKEGIQYVFQTRNPLTLVISGSGHCALEAALV----------NVLEPGDSFLVGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSSLGGTPLYMDR----------------GIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKPTVTTVAVAGYDWRDIVSYVMDHDIEIMGGLGPKVLRI-LGCNATRENVDRVTEALRAALVA 386
66 -19.5004lw2_A mol:protein length:404 Cysteine sulfinate desulfinase  ali model follow..  12  7.........FNPAQFRAQFPALQDAGVYLDSAATALKPEAVVEATQQFYSLSAGNVHRSQFAEAQRLTARYEAAREKVAQLLNAPDDK-VWTRGTTESNMVAQCYARPRLQPGDE----------IIVSVAEHHAWLMVAQQTGAKVVKLPLNAQRLPDVDLLPELITPRSRILALGQMSNV-TGGCPDLARAITFAHSAGMVVMVDGAQGAVHFPADVQQ-------------LDIDFYAFSGHKL-YGPTGIGVLYGKSEKMVHEVSFDGFTTQSAPWKLEAGTPNVAGVIGLSAALEWLADYDINQAESWSRSLATLAEDALAKPGFRSFRCQDSSLLAFDFAGHSDMVTLLAEYGIALAELGVTGTLRASFAPYNTKSDVDALVNAVDRALE. 400
67 -19.5006c9e_A mol:protein length:422 Cysteine desulfurase  ali model follow..  16  15...............VNKIRKDFPVLHQKINEYDLVYFDNAATTQKPKAVIDAINVHRGVHALSVRATEMYEAARAKVKRFINARSPR-IFVRGTTEANLVAQSLVAPRILPDEE----------ILITHMEHHSWQMVCKKMGCKLQVAPISLNGEVILEEFERKLNENTKMVAINYASNS-LGTINPVKTMIKMAHEVGAKVLLDGAQATAHLIVDVQD-------------LDCDFYAFSGHKM-YGPTGIGVLWGKEEEMINSVSFEATEYAAIPHKFEAGTPNIAGAIGLAAAIDYIWSLDLDAIAEYETQLLNYATKAIEAVKGYNIIGTAVPIISFVHGKAHDIGTILDSEGIAIDFYDVAATSRISMSFYNTFKEIDYCMEALQRVKE. 413
68 -19.4004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  12  28.....................................LGPGPSNLPPRIMAAGGLQMIGSMS--KDMYQIMDEIKEGIQYVFQTRNPLTLVISGSGHCALEAALV----------NVLEPGDSFLVGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSFLGGTPLYMDR----------------GIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKPTVTTVAVAGYDWRDIVSYVIDHDIEIMGGLGPKVLRI-LGCNATRENVDRVTEALRAALQH 388
69 -19.4004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  12  26.....................................LGPGPSNLPPRIMAAGGLQMIGHMS--KEMYQIMDEIKEGIQYVFQTRNPLTLVISGSGHCALEAALV----------NVLEPGDSFLVGANGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSSLGGTPLYMDR----------------GIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKWGCDDQPRMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKPTVTTVAVAGYDWRDIVSYVMDHDIEIMGGLGPKVLRI-LGCNATRENVDRVTEALRAALQH 386
70 -19.4004w91_A mol:protein length:422 Aminotransferase  ali model follow..  16  15...............VEAIRRDFPILSRQVHGKTLVYLDNGASAQKPQSVIDAVNVHRGLHFLSNAATDAYEKSRETVRRFLNAGSVD-VFTKNATEANTVAYGYGMPFIGEGDE----------ILLSIMEHHSWHFIRERQGAKLVFTPVDDNGVFHIEEFEKRLSERTKLVAITHMSNT-LGTVVPIKKIVELAHARGIPVLVDGSQGAVHLPVDVQD-------------LGCDWYVFTGHKV-YGPSGIGVLYGRAQEMIEEVTEENVTYNHPPHRFEAGTPPIVQAIGLGAALEYMEKIGRHAILAHEADLRDYAHERLGRINSLRIFGNAGAIISFALEGAHDVSMVIDRAGVAVKRFGVTSTCRASFALYNTRAEVDALAEALEKARK. 413
71 -19.2002ch1_A mol:protein length:396 3-HYDROXYKYNURENINE TRANSAMINASE  ali model follow..  12  22.....................................MGPGPSNCSKRVLTAMTNTVLSNFH--AELFRTMDEVKDGLRYIFQTENRATMCVSGSAHAGMEAMLS----------NLLEEGDRVLIAVNGIWAERAVEMSERYGADVRTIEGPPDRPFSLETLARAIELHQPKCLFLTHGDSSSGLLQPLEGVGQICHQHDCLLIVDASLCGVPFYMDK----------------EIDAVYTGAQKVLGAPPGITPISISPKALDVIRNRRTKWGCYDEPKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKPTVTGIMIKGVDWWKVSQYAMNNSLEVQGGLGPKAWRV-MGECSTVQKIQFYLYGFKESLKA 382
72 -19.2002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  11  23.....................................MGPGPSNAPQRVLDAMSRPILGHLH--PETLKIMDDIKEGVRYLFQTNNIATFCLSASGHGGMEATLC----------NLLEDGDVILIGHTGHWGDRSADMATRYGADVRVVKSKVGQSLSLDEIRDALLIHKPSVLFLTQGDSSTGVLQGLEGVGALCHQHNCLLIVDTSLGGAPMFMDR----------------EIDAMYTGSQKVLGAPPGITPVSFSHRAVERYKRRNTKWGCFGRPRIYHHTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIDWLKAAQYAMKTLVEISGGLGPQVFRI-MGQNATTERVDRVLQVFQEAVAA 382
73 -19.1005xt5_A mol:protein length:419 Cysteine desulfurase SufS  ali model follow..  18  6...............ITDIREQFPILHQQVNGHDLVYLDSAATSQKPRAVIETLNVHRGVHTLGTRATDGYEGAREKVRKFINAKSMA-IFTKGTTTSNMVALSYARANLKPGDE----------VVITYMEHHAWQQAVKATGATLKYIPLQEDGTISLEDVRETVTSNTKIVAVSHVSNV-LGTVNPIKEMAKIAHDNGAVIVVDGAQSTPHMKIDVQD-------------LDCDFFALSSHKM-CGPTGVGVLYGKKAEMIDFVGLYESTWKELPWKFEAGTPIIAGAIGLGAAIDFLEEIGLDEISRHEHKLAAYALERFRQLDGVTVYGPEAGLVTFNLDDPHDVATVLDAEGIAVKWLDVTATARASFYLYNTEEEIDKLVEALQKTKE. 403
74 -19.1001c0n_A mol:protein length:406 PROTEIN (CSDB PROTEIN)  ali model follow..  17  5...............VDAVRADFPVLSREVNGLPLAYLDSAASAQKPSQVIDAEAVHAGAHTLSAQATEKMENVRKRASLFINARSAE-VFVRGTTEGNLVANSWGNSNVRAGDN----------IIISQMEHHAWQMLCARVGAELRVIPLNPDGTLQLETLPTLFDAATRLLAITHVSNV-LGTENPLAEMITLAHQHGAKVLVDGAQAVMHHPVDVQA-------------LDCDFYVFSGHKL-YGPTGIGILYVKEALLQEVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALGLNNIAEYEQNLMHYALSQLESVPDLTLYGPQLGVIAFNLGAAYDVGSFLDNYGIAVAYYNVPAMCRASLAMYNTHEEVDRLVTGLQRIHR. 403
75 -19.1003zrp_A mol:protein length:384 SERINE-PYRUVATE AMINOTRANSFERASE (AGXT)  ali model follow..  12  6.....................................LHVGPTTIKEDVLVAGLENNVGFTS--KEFVEALAYSLKGLRYVMGASKNY-LIIPGGGTSAMESVT-----------SLLKPNDKILVVSNGVFGDRWEQIFKRYPVNVKVLRPSPGDYVKPGEVEEEVRKSEYKLVALTHVETSTGVREPVKDVINKIRKYVELIVVDGSVGAEEVKAEE----------------NVDVYLTASQKALGSAAGLGLLLLSPKALSILDSQNSI--AEEGKAAYFATPPVHVILQLAEAFRLIEKEGIENRIKRHTMVASAIRAGLEALGLEIVASNTVTGVILKVADPQKVLAGTVNEGVEFAP-PAFKYFRIGHMGWVTPNDAIIAISVIERTLRK 362

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.