current user: public

If you have questions about the server, please let us know.

Query: 3h14_A mol:protein length:391 Aminotransferase, classes I and II, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MSLKNSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETDALGYTVALGLPALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADFAGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALDCDAELQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVSDLTDDSRAFAAEILEKAGVAVTPGLDFDPERGAGTLRFSYARATADIEEGLDRLEAFMQARGEGLast
1 -118.0003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model  100  1MSLKNSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETDALGYTVALGLPALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADFAGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALDCDAELQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVSDLTDDSRAFAAEILEKAGVAVTPGLDFDPERGAGTLRFSYARATADIEEGLDRLEAFMQARGEG 385
2 -108.0005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  45  1MTDRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTARGGSFVRISFAGPSGDIEEALRRIGSWLPS.... 387
3 -107.0001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  28  1MRGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAVEMAREAYRRRRDLLLEGLTALG-LKAVRPSGAFYVLMDTSPIAPDEVRAAERLL-EAGVAVVPGTDFA---AFGHVRLSYATSEENLRKALERFARVLGR.... 384
4 -104.0002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  33  1..MLSKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGKTHYTDSRGILELREKISELYKDKYKADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDFTVES-----LEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEGKCYSAIEFLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKETEINSMIKEFDRRRRLVLKYVKDFG-WEVNNPIGAYYVFPNIGE---DGREFAYKLLKEKFVALTPGIGFGSK-GKNYIRISYANSYENIKEGLERIKEFLNK.... 370
5 -103.0001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  26  2..ALSDRLELVSASEIRKLFDIA----AGMKDVISLGIGEPDFDTPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKKQNGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHSLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSVEEMRKEYDRRRKLVWKRLNEMG-LPTVKPKGAFYIFPRIRDTGLTSKKFSELMLKEARVAVVPGSAFGKA-GEGYVRISYATAYEKLEEAMDRMERVLKERKL. 388
6 -102.0001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  30  7..MVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVKYTDPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNS--YMVQTFKERKNFVVERLKKMG-VKFVEPEGAFYLFFKVRG---DDVKFCERLLEEKKVALVPGSAFL---KPGFVRLSFATSIERLTEALDRIEDFLNSR... 383
7 -102.0001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  27  2..KLAARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGKTRYGPAAGEPRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDVQEMLAAFAERRRYMLDALNAMPGLECPKPDGAFYMFPSIAKTGRSSLDFCSELLDQHQVATVPGAAFG---ADDCIRLSYATDLDTIKRGMERLEKFLHGI... 387
8 -101.0002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  23  7MDVFSDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERI-YENKPEVVYYSHSAGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAINLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEFASALSISDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELP--VEDAEEFARWMLTDFNTMVAPLRGFYPGLGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCS. 398
9 -99.6001xi9_A mol:protein length:406 putative transaminase  ali model follow..  28  5..RASKRALSV-EYAIRDVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGSLDVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGWKNDKEFVLDVLHNAHVLFVHGSGFGEY-GAGHFRAVFLPPIEILEEAMDRFEKFMKERLK. 399
10 -98.4004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  26  5...LSKRFNKNLNKIEVSMIRQFDQSISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKEKYHLTYNPDEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTR-SNDFVLTPEMLEGEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIALPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDALPMKEEYIKRRDYIIEKMEAMK-FKIIKPDGAFYIFAKIPVQGQDSFKFLQDFAKEKAVAFIPGVAFGKY-GEGYLRISYAASMETIKEAMKRLKEFMEQYAD. 393
11 -97.9003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  20  6.AKFKKLGTDNAPGQEVRQSAAGLEALIRGARPVDFSHGDVDAPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDADGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDDETRAGLDLTGLFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPH-TADSVRLNFSQDHEAAVAAARRIVTLVERYR.. 406
12 -97.8005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  25  71..SLSPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHSLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYNDSSSLALYFLDKFQVAMVPGDAFG---DDSCIRISYATSLDVLQAAVEKIRKALEPLRA. 471
13 -96.5003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  19  29..FTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINRGEEWTIDFEQFITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIPEIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDALKFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKGKDFRISHWLINELGVVAIPPTEFYIKEAENLLRFAVCKDDAYLENAVERLKLLKDYL... 447
14 -95.8004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  23  25..EKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTA-QGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDASIAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAGLEMLASMRLCANVPAQHAIQTALGGYQEFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRHDDQKMVLDFLLQEKVLLVQGTAFNWP-WPDHFRIVTLPRVDDIELSLSKFARFLSGYHQ. 424
15 -93.7001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  23  7..IPQSKLPQLGTTIFTQMSALA-----QQHQAINLSQGFPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ-PPHFRVDWQEFLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEYLALPDFYRQKRDILVNALNES-RLEILPCEGTYFLLVDYSAVTLDDVEFCQWLTQEHGVAAIPLSVFCADPPHKLIRLCFAKKESTLLAAAERLRQL....... 386
16 -93.1002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  23  15..MISNKLANIPDSYFGKTMGRK--IEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPENQYGAFHGKEAFKQAIVDFYQRQYNVTLDKEEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLE-PPHYLPDWSKVIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIYALNHYDDLEEQSNVFKTRRDRFEAMLAKA-DLPFVHAKGGIYVWLETPP-GYDSEQFEQFLVQEKSILVAPGKPFGEN-GNRYVRISLALDDQKLDEAAIRLTELAYLYE.. 398
17 -92.6004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  22  4.QLQARRLDGIDYNPWVEFVKLA-----SEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFNQYTKTFGYPPLTKILASFFGELLGQEIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKSSSNWQLDPMELFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHSLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFERSSYFVQFPQAMQRCRDHMIRSLQSV-GLKPIIPQGSYFLITDISDFKPYDRRFVKWMIKNKGLVAIPVSIFYSVPFDHYIRFCFVKDEATLQAMDEKLRKWKVELEN. 424
18 -92.1002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  23  2..ATVSRLRPYATTVFAEMSALA-----TRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDRGFALDADALVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAVAALRNSLRARRDRLAAGLTEI-GFAVHDSYGTYFLCADPRPLGDDSTEFCAALPEKVGVAAIPMSAFCDDVWNHLVRFTFCKRDDTLDEAIRRLSVLAERPATG 399
19 -92.1002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  23  9..RRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDTHYSTSRGIPRLRRAISHWYRDRYDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERASIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQVRDIARQYQQRRDVLVKGLREA-GWMVENPKASMYVWAKIPEPHLGSLEFAKKLLQDAKVSVSPGIGFG-DYGDDHVRFALIENRDRLRQAVRGIKAMFRADGL. 400
20 -92.1002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  24  3........RVPEPSVFLVVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTTYYCLKSCTLPFLEEAARWYEGRYGVGLDPREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL--REDGLADLKAVVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVRGYARVYRERALGMAEALKGV--LSLLPPRATMYLWGRLPE-GVDDLEFGLRLVER-GVALAPGRGFGPG-GKGFVRIALVRPLEELLEAAKRIREALD..... 376
21 -92.1001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  22  2..RLHPRTEAAKESIFPRMSGLA-----QRLGAVNLGQGFPSNPPPPFLLEAVRRAL-GRQDQYAPPAGLPALREALAEEF------AVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDTPEGFRLDLSALLTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPRRLREAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKREGFYEALREGYRRRRDLLAGGLRAM-GLRVYVPEGTYFLMAELPG------WDAFRLVEEARVALIPASAFYLEDPKDLFRFAFCKTEEELHLALERLGRVVNSPRE. 373
22 -91.4001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  22  4WDVSMSNHAGLVFNPIRTVSDNA-KPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEACNGYFPTVGSPEAREAVATWWRNSFKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYVDSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQELDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKKTDVEFFEKLLEEENVQVLPGTIFH---APGFTRLTTTRPVEVYREAVERIKAFCQRHAA. 415
23 -91.3001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  21  14..DLPKRYQGSTKSVWVEYIQLA-----AQYKPLNLGQGFPDYHAPKYALNALAAAANSPDNQYTRGFGHPRLVQALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNADWVLDNNELFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFEPECYFNSISGELMAKRDYMASFLAEVG-MNPTVPQGGYFMVADWSSLARKDYRFTKWMTKSVGLQGIPPSAFYSEPGEDFVRYCFFKKDENLQKAAEILRKWKGS.... 428
24 -91.2003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  19  2........MTFEPYPFERLRALLKEI-TPKKRGLDLGIGEPQFETPKFIQDALKNHT-HSLNIYPKSAFEESLRAAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPSLNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLEACKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWLDDRHAEFFRNIYANNLKLARKIFKNT-----LIYPYSFYVYLPVQ----NGENFAKTLYQNEGIITLPALYLGRNRGADYVRLALVYDTPLLEKPLEIIETYRENHA.. 376
25 -90.5005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  22  2...NAKRIEGLDSNVWVEFTKLA-----ADPSVVNLGQGFPDISPPSYVKEELSKAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKSDWTFDPRELFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHTLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWPECYFNSLPKELEVKRDRMVRLLNSV-GLKPIVPDGGYFIIADVSSLGPYDYKFVKWMTKHKKLTAIPVSAFCDSKFEKLVRFCFIKKDSTLDAAEEIFRAW....... 410
26 -90.0003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  22  38..QRNENFGKLRAGPEIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKATREGYSGYGAEQGQGALREAVASTFYGHAGRAA--DEIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNP-KAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQPEKEMNAMIKFYKENAQILKTTFTEM-GFSVYGGDDAPYIWVGFPGK--PSWDVFAEILERCNIVTTPGSGYGPA-GEGFVRASAFGSRENILEAVRRFKEAYGKRNAS 443
27 -89.5006DK6 Entity 1(prereleased)  ali follow..  22  7.NFLKLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDETFKGYGPEQGYDFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGN-ILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYLKPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKSRRHSTKFNGASYIVQKGAEALYTDESQTKALIEHYMGNAALLVEACKNA-GLSVFGGVNAPYVWVGCPA-GLTSWQMFDKMLNEANVVITPGSGFGSA-GEGYFRISAFNSRANVEEVCRRIAAL....... 410
28 -89.4002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  23  23KVSRNSNMSKLQAFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGI--GDDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPEEAMHKVIGFYKENTNIIIDTFTSL-GYDVYGGKNAPYVWVHFPNQ--SSWDVFAEILEKTHVVTTPGSGFGPG-GEGFVRVSAFGHRENILEACRRFKQLYK..... 426
29 -89.1003ele_A mol:protein length:398 Amino Transferase  ali model follow..  23  3..VVNESMYQLVRSAIRELFEYGKAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDALHGYTSAQGDVETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPAD-TEHFQIDFDALINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGACAPSLFQKMIVKCQGATG----DINAYKENRDLLYEGLTRI-GYHCFKPDGAFYMFVKALE--DDSNAFCEKAKEE-DVLIVAADGFG---CPGWVRISYCVDREMIKHSMPAFEKIYKKYNK. 398
30 -87.5004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  21  39..VRNVNLEKLKNNYLINRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNSTVEGYRGYGLEQGNKTLRKAIAETFYRDLHV--KSNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSGLKEIRSVNNYYKENRKILMDTLVSL-GLKVYGGVNAPYLWVHFKGS--KSWDVFNEILENTHIITVPGSGFGPG-GEEYLRISGFGRRDHIVEASKRLQNFFNTRTK. 444
31 -87.4003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  24  2..KRNPHFVSLTKNADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARTCRGYGPDFGLPALRQKLSEDFYRGF---VDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEFP--EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGLSILPQLE-AIHYYRENSDLLRKALLAT-GFEVFGGEHAPYLWVKPTQANISDRDLFDFFLREYHIAITPGIGFGRS-GSGFVRFSSLGKREDILAACERLQMAPALQS.. 394
32 -86.2003jtx_A mol:protein length:396 aminotransferase  ali model follow..  20  2...MNTLLKQLKPYPFARLHEAMQGISAEGMEAVPLHIGEPKHPTPKVITDALTASLHEL-EKYPLTAGLPELRQACANWLKRRYGLTVDADEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-PAPSFNPDWRSIVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIPILQQV--FDVKLPDASFYIWLKVPD--GDDLAFARNLWQKAAIQVLPGRFLARNPGEGYVRIALVADVATCVKAAEDIVSLYR..... 396
33 -86.2003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  18  19.SVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDALDSGKNGYAPSIGFLSSREEIASYYHCP-EAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDQRILGPCTIVQGALKSILCPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHENDVEFTERLVAEQSVHCLPATCFE---YPNFIRVVITVPEVMMLEACSRIQEFCEQHYHC 421
34 -86.0003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  17  14.KQNELHIKDLGMASIRDLVALVTNLKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVASYPNLDGLPELKQEASRFAKLFVNIDIPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDYSSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPALYALSSGATHSAQWGMAAMLKACNDFRDSVIEYGRKARIMKKMFLDVYDKDGNEPLADGFYFT-VGYKGMDSSKLIEKFVRYGMCAITLKTTGS--KRNEAMRICTSLLPESFPDLEKRLQMLNAE.... 436
35 -85.0003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  18  2.NVRPSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDALDSGKNGYAPSIGYLSSREEVASYYHCP-EAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEILSQRILGPCTIVQGALKSILQRQEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEHENDVEFTERLIAEQSVHCLPATCFE---YPNFFRVVITVPEVMMLEACSRIQEFCEQ.... 400
36 -84.4004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  20  31FRRIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSGKNGYPPTVGADNLRQVVSTYWRRFCQTKLKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNIFTSVADFDTPRLILGGTAKYQVCPGWRVGWSILIDPMWAVGMERLTQLIAGVNSICQEAIARTLCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSYKSDMEFYEKLLDEENVQVLPGEIFG---MSGFLRATVSRPSAVLNEAVDRIIEFCERHKK. 438
37 -83.9003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  19  52IKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPLDSPSFPEDAKARRILQACGGNSLGSYSASQGVNCIREDVAAYIRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRADPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLSVRLCPPVSGQAAMDIVVNPREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLE. 489
38 -82.9004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  22  14.HMSSLRPRREDPPVLEEWYRRH--LGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVVMDDSVSQGGEGVRRAIADRYAG-----GDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEIDPDVLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLDPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAERAVRHADEIGARAAEARHNLAHLTGWMAAHEEVRWTPPEGGVCALPVFRELPQEVERFCLELLERHRTLLVPGTAFG---APHGARLGFGGPQEDFRAGLDGLSRFLRERAAG 399
39 -82.7003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  20  15VDNLNPKVLKCEYAVRGEIVIHAQRLQEQLKDLLQREEIKTLFSAISRAKQILAMIPGRATGAYSHSQGIHGLRDAIASGIASRDGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLETSDVKKINVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDKFHSFKKILPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVCSNITGQILASLVMNPPAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICANKAPDAFYALRLLESTGIVVVPGSGFGQVPGTWHFRCTILPQEDKIPAVISRFTVFHEAFMS. 486
40 -81.6003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  22  1....GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYTG-----VKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLPDLEKLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELDVP-SIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALAHYQELERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVKIAV-DMPMEDFCLQLLQEHGVLLVPGNRFE---RDGYVRLGFACEQETLIKGLEKLSQFLRRFDK. 373
41 -80.0003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  16  77....YINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVANN--YPVPDRCLVNTEKIINYFLQELDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHEKNDWEIEPNEIKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSI-YSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVLDADSRSIGLYHTAGLSTPQQIMEALFSMTHLLTTDTNTHYYSLIDIYRLAEEQVDFLLKLAEKNGVVLVDGVGFGA--KPGELRVSQANLPTEYALIGKQVLELLKEYYE. 527
42 -78.4005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  19  6....................QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELPVLWAESEQRPEAHQAYFTLLGQ-HGYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGADLSAE--LLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAHYDHLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVER-VAFAGRTGTEVWE-ELQRHHVFALPCRQFHPSDGDHMVRIALSRSTEPLEKSVQVLRTVLETR... 376
43 -75.8006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  11  12GSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEA-EEGLQATYEKRFTEAFFQLHRQPTAL--VKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPID--ESVFYDVDRIYPRRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELALENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVRAADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAWFRVDH-PELTATDVHRLLSADGVYVLPGRYFYPSKGDAYVRMALAREPEMFADAMALTRQVLDRHGR. 407
44 -75.2003if2_A mol:protein length:444 Aminotransferase  ali model follow..  17  2MKFSKFGQKFTQPTGISQLMDDLGDALKSDQPVNMLGGGNPAKIDADNDTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRHYDWNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDGELPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYSDALNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVANDRSDNEIKPFYQKQATLAVKLLKQA-PLMIHKPEGAIFLWLWFKDLPISTLDLYERLKAK-GTLIVPSEYFFPQHAHECIRMSIAADEQTLIDGIKVIGEVVRELYDN 443
45 -74.4001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  20  1MRMLSRNATFNSHGQDSSYFLGWQEYEKNPYHIIQMGLAENAKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWTGVEIVPIHCTSSNGFQITETALRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSSFISVMEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSGLVSSQTQHLLSAMLSDKKLTKNIAENHKRLKQRQKKLVSGLQKSG-ISCLNGNAGLFCWVDMRHLFEAEMELWKKIVYEVHLNISPGSSCHCT-EPGWFRVCFANLPERLDLAMQRLKAFVGEYYN. 434
46 -73.9002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  15  74VGGLAKIDGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMALKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPSLNWQYPDSELKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSL-FAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSDEYKHTLKQLIRRRETTLYRELGMPPLRD-ENAVDYYTLIDLQDVQSSTGDMLFRIADETGIVLLPGRGFGS--NRPSGRASLANLNEYEYAAIGRALRKMAD.... 520
47 -73.5002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  16  84...........GRFERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILG---CNYPVPPRMLTVSEQIVRQYIVREAVPPESVDLFAVEGGTAAMALRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIDPDNGWQYSDAELKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSL-FSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQ------LPESAKKALDHRYRSLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQNYYTLIDLQNVQSSTGDMLFRVADETGIVLLPGRGFG--SDRPSGRASLANLNEYEYAAIGRALRRLAD.... 519
48 -73.2003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  14  74VGGLAKIEGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPALNWQYPDSELKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSL-FAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSDQYKHTLKQLIRRREATLYRELGTP-PQRDENAVDYYTLIDLQDVQSSTGDMLFRIADETGIVLLPGRGFGS--DRPSGRASLANLNEYEYAAIGRLRQMADELYA. 524
49 -71.7003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  17  2MTFSLFGDKFTRHSGITRLMEDLNDG-LRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKCNYDGPQGKTALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFIELLPEGQFKYHVDFEIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVPFPGIIFSEARPLNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNDSETVIKPFYYQRVQQTIAIIRRYERCLIHKPEGAIFLWLWFKDLP-ITTELLYQRLKARGVLMVPGHYFFPGHTHQCMRMNYVPEPDKIEAGVKILAEEIERAWR. 415
50 -69.9001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  19  1..ILSKLATNEEHGENSPYFDGWKAYLKNPNGVIQMGLAENQLNPKGSICSEGIKSF-KAIANFQDYHGLPEFRKAIAKFMEKTRGVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRGVQLIPIHCESSNNFKITSKAVSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTQFVSIAEIKDLVHIVYSLSKDMGLPGFRVGIIYSFDDVVNCARKMSSFGLVSTQTQYFLAAMLSDEKDNFLRESAMRLGKRHKHFTNGLEVVG-IKCLKNNAGLFCWMDLRPLFDSEMSLWRVIINDVKLNVSPGSSFECQ-EPGWFRVCFANMDDGVDIALARIRRFVGVEK.. 428
51 -66.8003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  16  2..........VKLENSRKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIDLMSYFSDMTNPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG--------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYT----PITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKVAKKMVEYIIVNSIGVSKESQVRTAKILNVLKEFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYPAFAWLGTKEETDLVSELRRHKVMSRAGERCGS--DKKHVRVSMLSREDVFNVFLERLANMKLIKSID 390
52 -63.4002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  14  8.QSLNEQLQQSNATAFAMLSDLGQNMAEAKSTTYNATIGMATNKDGKSLDAMFNDLTPDEIFPYAPPQGIEELRDLWQQKMLRDNELSIDNSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQIQTLKERYEVTKEVVYADQYHSH-WQAYDFNSGYFMAIKVHDV--DPEALRKHLIDKYSIGVIALNATD-------IRIAFSCEKDDIPHVFDSIAKAIDDLR.. 430
53 -62.9001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  13  30....GIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVRMSYFFNPVSNFIFELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAAN-----YVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYT----PIKYKADEDILLFTMSKFTGHSGSRFGWALIKESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVANTFGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRKCEWEEDKDCYQTFQNGRINTQNGVGFEA--SSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRK. 427
54 -60.8003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  20  1...MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLGIIPQLQAVAEAEARLNAQPHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLYSSPPNFGAQVVAAVLNDEAKASWLKEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMTGLSAAQVDRLREEFGVYLIASG-----------RMCVAGNTANVQRVAKAFAAVM...... 397
55 -60.0004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  16  3...MFEHIDAYPGDPILTLNENFQKDPRD--QKVNLSIGIYDAEGRIPVMGAVREARDSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDARELARRGVPTLVANSFSKNFSLYGERVGGLSVVERVLGQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKQEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKMFTYTGLTESQVDALREVHGVYILRSG-----------RMCVAGNDSNVGIVADAIGKVLKSGA.. 402
56 -59.9003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  16  1...MFENITAAPADPILGLADLFRADERP--GKINLGQGVYKDETGKSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEERAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMYSNPPAHGASVVATILSNDAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---TKEQVLRLREEFGVYAVASG-----------RVNVAGTPDNMAPLCEAIVAVL...... 396
57 -59.2001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  14  1...MLGNLKPQAPDKILALMGEFRADPRQGK--IDLGVGVYDATGHTPIMRAVHAAEQETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLTVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMYSFPPFHGAKIVSTVLTTPERADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMLGATPEQVKRIKEEFGIYMVGDS-----------RINIAGNDNTIPILARAIIEVG...... 393
58 -59.1005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  14  1.SSWWTHVEMGPPDPILGVTEAFKRDTNS--KKMNLGVGAYRDDLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAIEQGINVCLCQSYAKNMGLYGERVGAFTMVKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMTGLKPEQVERLIKEFSIYMTKDGRISVA-GVTSSNVGYLA--HAIHQVTK............ 401
59 -59.0001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  14  1...MFENITATTADPILGLADLFRADERPGK--IDLGIGYKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEERAFAAMHKELIVASSYSKNFALYNERVGACTLVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMSGLTKEQVLRLREEFGVYAVASG-----------RVNVAGTPDNMAPLCEAIVAVL...... 396
60 -58.9004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  16  1MAVTFENITAAPADPILGLADLFRADERP--GKINLGIGVKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMYSNPPAHGASVVATILSNDAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---TKEQVLRLREEFGVYAVASG-----------RVNVAGTPDNMAPLCEAIVAVL...... 400
61 -58.5004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  16  7..TIKRATWNNGPDLAFDINNKANAAIEKREAVINAALGTLLDDKGKSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKPE-GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDFYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGIKEIIEEFEASLAHSARCNWSNGTHAAQNILIEEQELVDLRNMLKSRADVFVTAAKENK-LTMIPYFGGFFTFIPT-----DKAFDIVKDLEKENIFTIPSAKGI--------RVAICGGEEKIPKLVQRLAFYTNKK... 413
62 -58.3002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  15  1...MFENITTAPADPILGLADLLRADERP--GKIDLGMGVYDETGKTPVLTSVKKAENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEERAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---TKEQVLRLREEFGVYAVASG-----------RVNVAGTPDNMAPLCEAIVAVL...... 396
63 -58.2003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  14  8..AAKHAKGKKLKDVIFVTAGQAQAKENGRENVVNGTLGEGNLVFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKECFGNFRPE-GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLFDEHAFQNRVNELAKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVTWSNICRPAMRTMANIVADPAERNCYYQLIRDRADIFKQEAAQVG-LPMLPYRGGFFITIPTD----SANAICEELKKEHIYVIALANGIRIA--CGIPKCQMTGLAEKIYNAMKSLGKL....... 418
64 -58.1004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  12  1.......MAMGKPDPILGLGQDFR--MDPAKRKVNLSIGVYDDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGRILGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLYSNPPLYGAWVVSSILKDPQLTALKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMTGLTREQVELLRSEYHIYMTLNG-----------RAAVSGNSTNVEYVSQAIHNVTK..... 390
65 -57.7004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  15  18...LFSAVELAPRDPILGLNEAFN--ADTRPTKVNLGVGVYTNEDGKIPLLRAVRVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVLGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAFAAANLNVFVSSSFSKSFSLYGERVGALSIIARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGMSGLTSAQVDRLREEFGIYAVSTG-----------RICVAANTRNLDVVANAIAAVLK..... 414
66 -57.7002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  14  1...MFENITTAPADPILGLADLLRADERP--GKIDLGMGVYNDETGKTPVLTSVKKANETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEERAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMGGLTKEQVLRLREEFGVYAVASGRLNVA-GMTPDNLAPLC--EAIVAVL............. 396
67 -57.5003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  14  1..........MQPVLVFKLTADFREDPDPGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMWSNPPAQGARIVASTLSNPEFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFS-NPKQVEYLVNEKHIYLLPSGRINVS-GLTTKNLDYVATVTKIAENLYFQSDYKDDDDK. 416
68 -57.5003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  14  1.SSWWTHVEMGPPDPILGVTEAFKRDTNS--KKMNLGVGAYRDDNGKPYVAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGAIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRINVCLCQSYAKNMGLYGERVGAFTVVKRVESQLKILIRPLYSNPPLNGARIAATILTSPDRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMTGLKPEQVERLTKEFSVYMTKDGRISVA-GVTSGNVGYLA--HAIHQVTK............ 401
69 -57.0001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  14  1...MFENITAAPADPILGLADLFRADERP--GKINLGIGLYYDETGKIPVLTSVKKAEQTTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEERAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMSGLTKEQVLRLREEFGVYAVASGRVNVA-GMTPDNMAPLC--EAIVAVL............. 396
70 -56.8004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  12  7EAQTQGPGSMGKPDPILGLGQDFRMDPAK--RKVNLSIGVYDDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGRILGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLYNNPPLYGAWVVSSILKDPQLTALKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMTGLTREQVELLRSEYHIYMTLNGRAAVS----------GLNSTNVEYVSQAIHNVTK..... 403
71 -54.7001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  14  1...MFENITAAPADPILGLADLFRADERPGK--INLGIGVYDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMYSNPPAHGASVVATILSNDALRAIEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKMFSFSGLTKEQVLRLREEFGVYAVASG-----------LVNVAGTPDNMAPLCEAIVAVL...... 396
72 -54.4003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  19  13....................RNTMKWTRYGQGVLPLWVAESDFSTCPAVLQAITDAVQREAFGYQPDG--SLLSQATAEFYADRYGYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDATGGINLH-DVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQHTVAAGVASVCITITAPSKAWNIAGLKCAQIIFSPSDAEHWQQLSPVIKDGASTLGLIAAEAAYRGTDFLNQEVAYLKNNHDFLLHEIPKIPGAKITPMQATYLMWIDFRDTTIEG-SPSEFFIEKAKVAMNDGAWFGED-GTGFCRLNFATSREVLEEAIDRMAKAVSHHT.. 377
73 -53.4002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  26  5.KYLAGRANWIKGSALADVMKKASELQKKGVKLISLAAGDPDPELPRAVLGEIAKEVEPKSVMYTPANGIPELREELAAFLKKYDHLEVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDGMRVDLLEEKIKELKAKLIYTIPTNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGPLKALDNEGRVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALEYLKRKYHLEGALLGYKEKRDIMLKALENLPNAEFTKPIAGMFVMFFLPE-GADGISFANELMEREGVVVVPGKPF-DESGKNAIRLNFSPSKEEIPIGIKKLAKLYKEK... 404
74 -53.3004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  15  1MAVTFENITAAPADPILGLADLFRADERPGK--VDLGIGYKDETGKTPVMTSVKKAENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMYSSPPAHGASVVATILSNDALRAIEQELTDMRQRIQRLRQLFVNTLQEKGANRDFSFIIKQNGMSGLTKEQVLRLREEFGVYAVASG-----------RVNVAGTPDNMAPLCEAIVAVL...... 400
75 -52.8001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  15  1...MFENITTAPADPILGLADLLRADERP--GKIDLGMGTGKTPVLTSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEERAFAAMHKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQMYSSPPAHGASVVATILGNDALRAIEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMGGLTKEQVLRLREEFGVYAVASG-----------RLNVAGTPDNLAPLCEAIVAVL...... 396

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.