current user: public

If you have questions about the server, please let us know.

Query: 3hqt_A mol:protein length:409 CAI-1 autoinducer synthase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# Score Template Links and tools%idFirst MGSSSSGLVPRGSHMNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFRLast
1 -102.0003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model  100  1MGSSSSGLVPRGSHMNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR 403
2 -100.0002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  100  1..............MNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR 389
3 -98.3004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  23  48....................AERQKLLDSGVTDPFAIVMEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSASVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGV... 433
4 -97.5002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  24  32....................AERQKLLDSGVTDPFAIVMEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGV... 417
5 -95.6002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  23  12....................AEREALLATGVRDPYAIVMDKVLSPTEAMINGRKTILLGTYNYMGMTFDPDVIAAGKQALDEFGSGTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPGKLVVLEGVYSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEEAGVEADVDFVVGTFSKSVGTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHAGDKRAHLWKNSRRLHQGLRDMGYKLGAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATGV... 397
6 -95.3003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  24  16.........................EELKAKGLYAYFRPIQSKQDTEVKIDGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLNDDVDLIMGTFSKSLASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAEV... 394
7 -93.4001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  23  12...................LTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTLGKALGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGV... 399
8 -93.3005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  20  25.....................QKKRLDKSYRYFNNINRLAKEFPLAHRQREADKVTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVPNPSHIVPVLIGNADLAKQASDILIKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQL... 432
9 -93.2005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  22  12.........................ADLDAQGLRRVRRTADSACDAHMTVNGREIVGFASNDYLGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHADTATLGALLEACQTKLIVTDTVFSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALAAAALRSPHLVYVGTLGXAAGVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEARRAHLAALIERTRALLRRTRWQPDSHTAVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA..... 393
10 -93.0005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  22  14.........................KEIDARGLRRRRRTADTPCAAHMTVDGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDTDALSAMLEASDVKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIAQAALRSPNLISIGTLDKAAGVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEARRAHLQQLIGRTRAMLKATPWLPDSHTAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA.... 396
11 -93.0001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  23  12.........................DARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKV--KPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEARREKLAALITRFRAGVQDLPFTLDSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGN......... 383
12 -92.6003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  22  16.........................EGLKKAGLYKSERIITSPQNAEIKVGEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEARFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYCGVADRVDILTGTLGKALGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEPQLRKQLQENSRYFRAGMEKLGFQLPGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGA... 398
13 -92.4003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  24  45..............................................RVRPPVAAELDLASNDYLGLSQHPDVLDGGVEALRTWGGGAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDACRLSRARVVVSPHRDVDAVDAALAARERAVVVTESVFSADGDLAPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHEVGLAGAPDVMTTTLSKALGSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALRVLDAEPQRARAVLDRAAELATIAGVTE---APVSAVVSVILGDPEIAVGAAAACLDRGVRVGCFRPPTVPAGTSRLRLAARASLTDDEMALARQVLTDVLATAR.... 397
14 -91.3002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  26  40..............................................RPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAAAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQRDAQQMHAKVLKMRLKALGMPIDHGSHIVPVVIGDPVHTKAVSDMLLDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA.... 401
15 -91.2004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  21  39..............................................TPFIKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYDG--KSFITTEGVFSTSGSITQLDKLAKITPEK---LIVDEAHSFGVLGKNGRGAINSFRISKNCLICVFPLGKAFGGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELKDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEYI... 390
16 -29.1002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  13  1......................................................MFKRETKDFINIQTGGKLTEEARQALLEWGDGYSVCDFCIKTPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDIEETKKRGEVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEI--------GADFIVGSGHKSMAASGGVMGMKEEWAEIVLRRSEKYLLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPLYEISKKAKGGRFFLYRELKSRKIHG------IKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIEKYS.... 371
17 -22.3002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  15  3..................................................SDKIMIDLRSDTVTK---TEEMRKAMAQA--------EVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVAVLSGVMPHPVPGKNPDDVRKAIRPPRTSLIAIENTHNRSGPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKE---YAGYADSVMFCLSKGLCAVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALT---KMVDRLKEDHENARFLALKLKEIGYSVDVKTNMVILRTDNLKNAHGFIEALRNSGVLA-------NAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS.... 349
18 -21.6004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  15  1......................................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDTKLLSLEN--THNGKVLPLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALK---NNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVLIN---------ASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR...... 333
19 -21.6003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  15  1......................................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAAVLGSIQPQPIDAAADGTLPLDKVAMRTKLLSLENVLPRE----YLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALK---NNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVLIN---------ASPIVRLVTHLDVSREQLAEVAAHWRAFLAR...... 333
20 -20.6006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  11  48..................................................SGAYLTDPDGRRWIDFDGDEEVAEAIARAARG------RSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVDARDRSIVLSSGYHG-HCDEPFTPNQHGIVEFLFDLDVLAEWLSRPEQAAVVISPDHMHLGE---YTEFTRLTKEADVPVIADEV--VGLRYRAG-------LSTPLLDPAVWIVAKCLAN--AAVGGDAHLLAALEDVSFTSYFE----PTAMAAATTTLRRMATGE--QQAIRAAGDRFIAHTRAVPIDLAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFE-------------NQTPSAAFTDEVVEDACGRIDRVSAALT.... 389
21 -20.5005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  14  52..............................................................LNPIQRGGILPKEAKKAVYEYWDGYSVCRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYENLEGYKEVIDNKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEV--------KADFIVASGHKSMASAPGILAFSEEFSDKITKTSEKFMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFDELKKRGIAGVTKEIKMSVYGL-EWEQVEYVVNAIKEIVESCK.... 411
22 -20.3004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  16  21...........................................................MRESIKLIASENITSLAVREAHRYAEGLPGKRLYQGCKEVETLCIELSKELFKAEHANV--SGVVANLAVFFAETKPGDKLMAPDGGHISHWKVSAAGIRGLKVINHPDADAMVKKILEEKPKLILFGG--SLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLI----AGKQFQDPLREGAEYLMGSTHKTFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVFTESHQVIIDIDIEFSASELAKMYEEANIILNKNLLPNNSDNPSGIRLGTQEGMKEKEMEEIAEFMKRIAID...... 392
23 -20.1003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  14  2..................................................SHMRYIDLRSDTVTQ---TDAMRQCMLHA--------EVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAAVLGSVALQPVPMQADGSLALADVRAATRLVCLEN--THNGKVLPLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRE---LVAPFDSVSICLSKGLGAVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQ---QHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMV-TSGESAPLLAFMKARGILFS---------GYGELRLVTHLQIHDDDIEEVIDAFTEYLGA...... 341
24 -20.0001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  13  66..................................................KGIYLWDVEGRKYFDFLSHPKIVNALKSQVDKLTLTSRA------YNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLAKYKAKIVFAAGNFWGRTLSAISSSTDPTSYIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPLMGVRELCTRHQVLFIADEIQT---LARTGR-AVDYENVRPDI-----LLGKALSG--SAVLCDDDIMLTIKPGEHGSTYGGN--PLGCRVAIAALEVLE-EENLAENADKLGIILRNELMKLPSDVVTAVRGKGLLNAKDWDAWKVCLRLRDNGLLA-------KPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF..... 439
25 -20.0003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  14  26....................................................ASWIKLNTNE---YPPSPEVVKAILEELGP-----DGAALRIYPSASSQKLREVAGELYGFDSWIIMANGSDEVLNNLRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTGDFRIAGFPERYEGKVFFLTTPNAPLGPSFPLEYIDELARRCAGMLVLDETY-AEFAESNALELVRRHE------VVTRTLSKSYSLAGGLAIARPEVIAALDKIRDHY----NLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPDRDGKRVYDGLYARKVLVRHFSDPLLAH----MRISIG---TREEMEQTLAALKEIGE....... 353
26 -19.9001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  12  11..................................................AKPKPYSFVNDYSVG---HPKILDLMARD-------NMTQHAGYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHEAIEATGHKVVTAPCPDVADIESALHENRSEHMVIPKLVYISNTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLA-DIARLTDMFYIGATKAGGMGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMK------ELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFP-ENTMIAELNNDFDMYTVEP-------LKDGTCIMRLCTSWATEEKECHRFVEVLKRLVAS...... 357
27 -19.7006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  12  45..................................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLVREATGRPLLLSAGYHGYYPSEAPLENADGVVDFFFDLGLLRELLRAPERAAVVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV----WVVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVAT-GEPQRAVREAGDRFLRHARKLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL..... 387
28 -19.5001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  16  22...........................................................QHAKIELIASENFVSRAVMEANKYAEGYPGRRYYGGCEIVEELARERAKQLFGAEHANV--SGAQANMAVYFTVLEHGDTVLGSHGGHLTHGSPVNFSGVQYNFVAYGDYDDVREKARLHRPKLIVAAA--SAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAG-----LHPNPVPYAHFVTTTTHKTLGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDKAYAKRVVDNAKRLASALQNEGFTLTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESTSGIRIGTAAGFGLEEMDEIAAIIGLVLKN...... 386
29 -19.5006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  12  29..................................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLVREATGRPLLLSAGYHGYYPSEAPLENADGVVDFFFDLGLLRELLRAPERAAVVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV----WVVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVAT-GEPQRAVREAGDRFLRHARKLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL..... 371
30 -19.4003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  14  38...........................................................QRDTLEMIASENFVPRAVLQANKYAEGLPGRRYYGGCEVVENLARDRAKALFGAEFANV--SGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYE--DMDAVRATALEFRPKVIIAGW--SAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAG-----LHPSPVPHADVVSTTVHKTLGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEADRQRRTLSGARIIADRLMAPDVAKGTDVHLVLVDLRDSPDGQAAEDLLHEVGITVNRNAVPNDPRPTSGLRIGTPAGFGDTEFTEVADIIATALAT...... 407
31 -19.3004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  13  45..................................................KGARVWDINGNEYYDFLAHPRVIAALCRQAERLTLTLRA------GNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIAPDSAKVILCNNNYWGRTITACSSSTTFDCYIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPLKRAHELCRSKNVLLIVDEIQT---LCRTGR-AADHDEVHPDI-----LLGKSLSA--SAVMGRADVMDVLKPGTHGSTFGGN--PLACAVAVEALTVLK-DEKLADRAERLGAQFRDCLRRE--EIRGRGLLNAVEVDDAIDPNDVVMKLKENGILS-------KPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV..... 420
32 -19.2004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  10  36....................................................KIAARIGANE---FGPAPSVLLAIRQAAGDTWKYADPEN---------HDLKQALARHLGTSANIAIGEGIDGLLGQIRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPREDLEGLLAAVGRENAPLVYLANPDNPMGSWWPAERVVAFAQALTTLLVLDEAY-CETAPRDALPPIESLIDKPNV-IRARTFSKAYGLAGGYTLSTPGTAQAFDKIRNHF----GMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLALPSATNFVAVDCGKDASRAIVDRLMSDHGIFIRMPGVAPLNR----IRISTA---PDAEMDLLAAALPEVIRSLA.... 374
33 -19.2005ykr_A mol:protein length:461 Probable aminotransferase  ali model follow..  14  65..................................................QGARVTDIDGQQYVDFAAQPAVADAIARQARR-------GSTLMLPTEDSLWVGAELARRFGLPYWQVTTSATDANRFVLRMLSGRDKVVVFNCNYHGS-VDESQVEFTTTRLVEFNDLDALEAALAHGDVAAVLTEPFMTNVGMVPPHAGLRELTRRHDVALIIDETHTISC-----AGYSGAHGLEPDF----FVLGKCIA--GGIWGCSQAQAERIWAVLPHF--TLAGNALQLAAMRATFAEVMT-EDAYRHMFQLAAQLEAGVRATLEELRLPWHVTRIHARNGLIEACLHLYLLNRGVLLTP----------FHNMALTCPATRAEDVELHDRLLRDCLGEL..... 456
34 -19.2004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  14  59..................................................GGCLLRDVEDGEIIDLNADREVLDAVADQFAK-------GHMTGLPHELDARAGALIAELVGVEQVRFANSGTEAVASALRATTGRTLVVTFEGHYHGW-SETVLRAGAHTVQLGWNDPDALRELFARDGDRIVIVEPVLANAGVIPPLQLLRELTGRSGAMLVFDEV--TGFRVARG-GAQERYGVEPDL----TVLSKVMGG--AAFGGRRHAMRMLASNEAHHAGVYAGNHAALRAVVAMLGKIRSLPDLYERLEDTGQYMEDTVREVFATEKRPVHINRVALVDFPRHRRLQTLAQKEGVYFHP---------NALEPWFLSTAHTRDVIDKVAGALQRSLVGLG.... 458
35 -19.1003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  14  29...........................................................QEEHIELIASENYTSPRVMQANKYAEGYPGKRYYGGCEVVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLQPGDTVLGAQGGHLTHGSPVNFSGKLYNIVPYGDYDEMAKLAKEHKPKMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAG-----VYPNPVPHAHVVTTTTHKTLGPRGGLILAKGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEKVYQQQVAKNAKAMVEVFLNRGYKVVSGHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRIGSPAGFKEAEVKELAGWMCDVLDN...... 395
36 -19.1004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  13  60..................................................KGARVWDINGNEYYDFLAHPRVIAALCRQAERLTLTLRA------GNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIAPDSAKVILCNNNYWGRTITACSSSTTFDCYIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPLKRAHELCRSKNVLLIVDEIQT---LCRTGR-AADHDEVHPDI-----LLGKSLSA--SAVMGRADVMDVLKPGTHGSTFGGN--PLACAVAVEALTVLK-DEKLADRAERLGAQFRDCLRRE--EIRGRGLLNAVEVDDAIDPNDVVMKLKENGILS-------KPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAVEEERK 440
37 -19.0003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  12  16....................................................DNPIRINFNE---LGMSPKAQAAARDAVVKANRYAKNEI---------LMLGNKLAAHHQVEPSILLTAGSSEGIRAAEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKAFDIEGLKAAVAYSGPSIVYLVNPNNPTGTITPADVIEPWIASKNTMFIVDEAYAEFVNDPRFRSISPMITQGAENIILLKTFSKIHAMAGGYAVAHPTVIALMGRYVAGE----KINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEG---VFHQLVVPLKDYQTHMADAGVLIGRAFPPA----DNWCRISLG---TPQEMQWVADTMREFRKKSWI... 354
38 -19.0004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  15  30...........................................................QEDHIELIASENYTSPAVMAANKYAEGYPGKRYYGGCEVVEQLAIDRVKQLFGAEAANV--SGSQANQGVFFAMLKPGDTIMGAHGGHLTHGSPVNMSGKWFNVVSYGDYDAAEKLANEHKPKLIVAGA--SAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAG-----VYPNPVPHADFVTTTTHKSLGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEKEYQQKVVENARVLAETLVKRGLRITESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKTSGIRLGSPAGFGPAEAEQVGNLIADVLEN...... 393
39 -19.0003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  16  25...........................................................QNSNIELIASENFVSEAVMEANKYAEGYPGRRYYGGCEVTESIAIDRAKALFGAEHVNV--SGPQANMAVYLVALEMGDTVLGSHGGHLTHGAPVNFSGKFYNFVEYGNYDEVRKLALEHKPKLIVAGA--SAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAG-----LHPNPVEYADFVTTTTHKTLGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNKTYQQQVVKNAKVLAEALINEGFRIDNHLVAVDVKGSIGLTGKEAEETLDSVGITCNKNTIPFDQEKTSGIRLGTPAGFDEKAFEEVAKIISLALKN...... 390
40 -18.8003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  11  14...............................................................GQISGHGKRNVGVLKTAFAAVADEMASDQY-GTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQKELHPIETILVGAAD--TLDEIKALPDIACLLLELPQREIGAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAAE---IAGLFDSIYISFYKGLGGAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYE---LRKDRMGQYYEQAKQLAEQFNALP-VPVSNMFHLHFDGQAADISPKLEQVQEETGLGFVG------YLVDKDGYCSTEISVGDAYGELDQQTRDAGFARLRQAFS 357
41 -18.8003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  13  27....................................................NVDIRLNTNE---YPPSEALVADLVATVDK-----IATELNRYPERDAVELRDELAAYITKQTGLWAANGSNEILQQLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYA-----SPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGYFVANPAFIDAVMLVRLPY----HLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSES---VFFGDFSDQHAAWQAFLDRGVLIRDVGIA------GHLRTTIG---VPEENDAFLDAAAEIIKL...... 364
42 -18.7001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  11  25....................................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAAYICLAVTVNLAGSMANMRAVRELTAAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLQDEFPAQSLAASIYVETGVRPKLETVRLTIPRRYTYAHMDVVADGIIKLYQH...... 430
43 -18.7002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  17  42..................................................EGAYVWDADGNRYLDYVAHPKVLARVRETLER-------GLTFGAPSPLEVALAKKVKRAYFVDLVRFVNSGTEATMSALRGYTGRPYIVKFRGNYHGH-ADGLLVEAGSTLVLEYNDPEGLREVLKRRGEEIIIFEPVVGNAGVLVPTEDFLKEAKAYGVLLIADEV--TGFRLAFG-GATELLGLKPDL----VTLGKILGG--AAYAGRREIMEKVAPLGPVYQAGTSGNPLAMAAGLATLELLEENPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNDARRTDTELFKRFFHGLLDRGIYWPP---------SNFEAAFLSVAHREEDVEKTLEALRKAL........ 424
44 -18.5005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  13  3....................................................DKSQQFASDNYSG---CPEAWAAMEKA-------NHGHDRAYGDDQWTERASEYFRNLFETDCEVFFFNGTAANSLALASLCQSYHSVICSETAHVETDECEFFSNGSKLLTAASTPQSIREVALKRQDIHYPKPRVVTITGTVYRLKAISATCKELGLNLHMDGARFTNACAFLGCSPAE-LTWKAGVDVLCFGGTKNGMAGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEAWLRHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQMPEH-----AIEALRAKGWRFYT-------IGSGGARFMCSWDTEEERVRELAADIRSIIT....... 345
45 -18.5004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  12  32....................................................AVPVRLNTNE---HPPTRALVDDVVRSVRE-----AAIDLHRYPDRDAVALRADLAGYLTAQTGIWAANGSNEILQQLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRADVDVAVAAVVDRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIVDEAYGEFSSQPSAVSLVEEY---PSKLVVTRTMSKAFAFAGGYLIATPAVIDAMLLVRLPY----HLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDA---VLFGEFADAPAAWRRYLEAGILIRDVGIPGY------LRATTG---LAEENDAFLRASARIATDL..... 370
46 -18.5002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  15  84..................................................TGSRFQDVDGHAYVNFLSHPVIRAAVERALAV-------GLNLSTQTENEALFAEAVCDFPSIDLVRFTNSGTEANLMALAAITGRKTVLAFDGGYHGG-LLNFASGHAHVVLGVYNDVEGTADLLKRHGHDCILVEPMLGAGGCVPALDLLRAEASRCGALLIFDEV----MTSRLSGGAQEMLGISADL----TTLGKYIGG--GAFGGRRDLMERFDPARDGAFAHAGT-ILTMSAGHAALTQIYT-RQAASDLSASGDRFRANLNRIAVENQAPLQFTDVRAADQQLKELFFFHMLRKGIYLAP-------------MYALSLEIADAGRDAFAEALADFIGEQ..... 454
47 -18.4001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  13  26...........................................................QEEHIELIASENYTSPRVMQANKYAEGYPGKRYYGGCEIVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLEPGDTVLGAHGGHLTHGSPVNFSGKLYNIVPYGDYADLEKQAKEHKPKMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAG-----VYPNPVPHAHVVTTTTHKTLGPRGGLILAKGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEKTYQQQVAKNAKAMVEVFLERGYKVVSGHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRVGTPAGFKEAEAKELAGWMCDVLDS...... 392
48 -18.4002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  14  47..................................................QGVHKTDVDGNVYLDFFGHPRVNAAIAEALSH-------GVQYAASHPLEVRWAERIVAAFSIRKLRFTGSGTETTLLALRAFTGRRMILRFEGHYHGW-HDFSASGYANTLLIRPDDIEGMREVFANHGSDIFIAEPVGSHFGVTPVLREGAELARQYGALFILDEV--SGFRVGNH-GMQALLDVQPDL----TCLAKASAG--GILGGREDVMGVLSRGSDRKVLHQGT-PITAAAAIAAIDTILE-DDVCAKINDLGQFAREAMNHLFARKGLNWLAYEVARPDVKMIAAMRMALILEGVDIGG-------------SVFLSAQHEREHVEHLVTTFDRVLDRL..... 435
49 -18.4006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  14  47..................................................QGVHKTDVDGNVYLDFFGHPRVNAAIAEALSH-------GVQYAASHPLEVRWAERIVAAFSIRKLRFTGSGTETTLLALRAFTGRRMILRIATHYHGW-HDFSASGYNNTLLIRPDDIEGMREVFAQHGSDIFIAEPVGSHFGVTPVLREGAELARQYGALFILDEV--SGFRVGNH-GMQALLDVQPDL----TCLAKASAG--GILGGREDVMGVLSRGSDRKVLHQGT-PITAAAAIAAIDTILE-DDVCAKINDLGQFAREAMNHLFARKGLNWLAYEVARPDVKMIAAMRMALILEGVDIGG-------------SVFLSAQHEREHVEHLVTTFDRVLDRL..... 435
50 -18.4001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  14  49..................................................KGVFVYDVNDKRYYDFLSHPNILNAMINQAKNLTICSRA------FSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLCENMAKIVVCKNNFSGRTLGCISASTTKKCTVPYDDLEALEEELKDPNVCAFIVEPIQGEAGVIVPLQGVYDICKKYNVLFVADEVQT---LGRTGK-CVHHYNVKPDV-----LLGKALSG--SAVLANDDIMLVIKPGEHGSTYGGN--PLAASICVEALNVLINE-KLCENAEKLGGPFLENLKRELKDSKIVRDVKGLLCAELVNVLDICLKLKENGLIT-------RDVHDKTIRLTPPLCITKEQLDECTEIIVKTVKFFDERF. 427
51 -18.4003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  14  36..................................................KGVFVYDIEDRRYYDFLSHPDILNAMINQAKKLTICSRA------FSDSLGVCERYLTNLFGYDKVLMMNTGAEASETAYKLCENSAKIIVCNNNFSGRTLGCVSASTDKKCKVPYDDLEALEKELQDPNVCAFIVEPVQGEAGVIVPFPGVASLCKKYNVLFVADEVQT---LGRTGK-CTHHYGVKPDV-----LLGKALSG--SAILANDDVMLVLKPGEHGSTYGGN--PLAAAICVEALKVLINE-KLCENADKLGAPFLQNLKEQLKDSKVVREVKGLLCADLVNVWDICLKFKENGLIT-------RSVHDKTVRLTPPLCITKEQLDECTEIIVKTVKFFD.... 411
52 -18.3005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  14  35..................................................EGVFVWDVEGKKYYDFLSHPKIVEALVEQASKLALTSRA------YNSKLGEYEQKITSLLGFDKVLPMNSGAEAVETAVKLAENAAKIIVCENNFHGRTTTIVSFSNDPDANIPYNDIAALEEVLSKEAGNIFLVEPIQGEAGVYVPLKQSSELCKKHNVLFIADEVQT---IARTGK-ACHHEDVQPDI-----ILGKALSG--SAVLANNNIMDVIKPGQHGSTFGGN--PLACAVAMAALDVVQDE-KLSERAEKLGNLFRSEIEKLIEKTDLITKVKGLLNADSSTAWNLCLALKENGLLA-------KPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILEF..... 413
53 -18.3001v72_A mol:protein length:356 Aldolase  ali model follow..  14  5..................................................SRPPALGFSSDNIAG---SPEVAQALVKH-------SSGQAGPYGTDELTAQVKRKFCEIFERDVEVFLPTGTAANALCLSAMTPPWGNIYCHPASHINNDECEFFSNGAKLMTVDGDIVRLRERTREKVQPACVSITQATEVGSIYTIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAE-MTWKAGVDALSFGATKNGVLAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLT--DLWLRNARKANAAAQRLAQGLEGLGVLGGTEANILFCRLDSA-----MIDALLKAGFGFY-----HDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQ.... 354
54 -18.2002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  15  22...........................................................QREGLELIASENFVSKQVREANKYAEGYPGARYYGGCERVESLAIERAKALFGAAWANV--SGSQANMAVYMALMEPGDTLMGAAGGHLTHGSRVNFSGKLYKVVSYGDLEEVRRLALEHRPKVIVAGA--SAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAG-----LHPNPLPYAHVVTSTTHKTLGPRGGLILSNDELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEKEYSRLVVENAKRLAEELARRGYRIVTGHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPTSGIRIGTPAGFTPEEMPLVAELIDRALLE...... 387
55 -18.1002cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE  ali model follow..  16  26..................................................KGAHIWDVDGNQYIDYVAHPEVIDALHAALEK-------GTSFGAPCLLENILAEMVIAAVSVEMVRFVNSGTEACMAVLRAYTQREKVIKFEGCYHGH-ADMFLVKAGSTLTAPYNDLEAVSRLFEQYPNDIVILEPVVGNAGFIPPLEGLRELTKQYGALLVFDEV--TGFRIAYG-GAQEKFGVTPDL----TTLGKVIGG--GAYGGRAEIMKMVAPAGPVYQAGTSGNPLAMTAGIKTLEILSR-PGSYEHLDRITGKLVQGLLDAAREFGHEVCGGQAKQSDLKKFAAFHRGMLEQGIYLAP---------SQFEAGFTSLAHTEADIERTIAAARTVLSQL..... 411
56 -18.1005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  15  25...........................................................QNEHLEMIASENYTFPSVMEANKYAEGYPNKRYYGGCEKIESLAIERAKKLFNCQFANV--SGSQANNAVYHALLKPYDKILGSCGGHLTHGAKVSLTGKHYQSFSYGDYEEALKIAQSVKPEIIVCGF--SAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTN-----EHAHPFPHCHVVSSTTHKTLGPRGGIILTNEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEKAYAKLVKSNMQVLAKALKEKNHKLVSGHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSTSGIRIGSAAGMGAKEFEIIGNKISDILND...... 389
57 -18.1004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  13  57...........................................................QIETINLIASENLTNTAVRECNKYSEGYPHKRYYGGNDKIEELCYKRALEAFNVSEEEWGVSGSAANVQALYALVGVKGKIMGMHLCHLTHGFFDEKKKVSITSDLFEDMESVRNLALSFQPKVIICGY--TSYPRDIDYKGFREICDEVNAYLFADISHISSFVA---CNLLNN---FTYADVVTTTTHKILGPRSALIFFNKKRNPGIDQKINSSVFQGGPHNNKIAAVACQLKEVNTPKEYTKQVLLNSKALAECLLKRNLDLTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDVDSPSGIRIGTPAGCKEKDMEFIADMLLKAIL....... 431
58 -18.1002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  14  47..................................................KDAYAWDVDGNRYIDYVAHPEVIEALKVAMEK-------GTSFGAPCALENVLAEMVNDAVSIEMVRFVNSGTEACMAVLRAYTGRDKIIKFEGCYHGH-ADMFLVKAGNTLTTPYNDLEAVKALFAENPGEIVILEPIVGNSGFIVPLEGLREITLEHDALLVFDEV--TGFRIAYG-GVQEKFGVTPDL----TTLGKIIGG--GAYGGKREIMQLVAPAGPMYQAGTSGNPLAMTAGIKTLELLRQ-PGTYEYLDQITKRLSDGLLAIAQETGHAACGGDAKKSDLQKFSRFHRGMLEQGIYLAP---------SQFEAGFTSLAHTEEDIDATLAAARTVMSAL..... 432
59 -18.1004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  16  71..................................................EGAALWDADGHRYADFISAPEIRDAVIEAMQG-------GINLTGHNLLEGRLARLICEFPQIEQLRFTNSGTEANLMALTHFTGRRKIVVFSGGYHGGV-LGFGARPSDFLVLPYNDAQTARAQIERHGPEIVLVEPMQGASGCIPGLQALRESATQVGALLVFDEV----MTSRLAHGLANKLGIRSDL----TTLGKYIGG--GAFGGRADVMALFDPRTGPLAHSGTFNVMTMAAGYAGLTKLFT-PEAAGALAERGEALRARLNALCANEGVAMQFTDLAAVDGRLRQLLFFHLLNEDIYSSP-------------FVVLSLPLTDADIDRYVAAIGSFIGGHG.... 441
60 -18.1003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  15  31...........................................................QQSQVELIASENIVSRAVLDANKYAEGYPGKRYYGGCEEVEALAIERVKRLFNAGHANV--SGAQANGAVMLALAKPGDTVLGDAGGHLTHGAKPALSGKWFNALQYGDYDQVEALAQQHKPSLIIAGF--SAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAG-----RHANPVEHAHVVTSTTHKTLGPRGGFVLTNEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDKTYIDRVLANAQALGDVLKAGGVDLTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKTSGIRLGTPAGFGAAEFREVGRLILEVFEA...... 396
61 -18.1003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  13  24...........................................................QCEGLEMIASENFTLPEVMEVNKYAEGYPGKRYYGGCEEIETLAIERCKKLFNCKFANV--SGSQANQGVYAALINPGDKILGSHGGHLTHGAKVSSSGKMYESCFY-DYEKVREIAKKEKPKLIVCGA--SAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAG------HPSPFPYAHVVSSTTHKTLGPRGGIIMTNEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEKVYAKQVRTNAQVLANVLMDRKFKLVSDHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSTSGLRLGTPAGFKEKEMEIVSNYIADILDD...... 388
62 -18.1003f0h_A mol:protein length:376 Aminotransferase  ali model follow..  12...........................................................QGMLNFTVGPVMSSEEVRAIGAEQVPYFRTTEFSSTMLENEKFMLEYAKAPEGSKAVFMTCSSTGSMEAVVMNCFTKKDKVLVHRFVQLCEIHEIPYVALKLEHGKKLTKEKLYEYDNQNFTGLLVNVD--TSTAVLYDTMMIGEFCKKNNMFFVCDCVSAFL---------ADPFNMNEGADVMITGSQKVLACPPGVIVLAPRGVERVEKSKVRTMYFDTPAVGILLQINERLKEIKKHDAEVARIASQAADFRAKIKDLPFELVSESPVTSVHPTTANAYDIFLKLKDEYGIWICP------EMKDTIFRVGHIGALTHEDNTTLVNAFKDLQKRNLL... 370
63 -18.1006MME Entity 1(prereleased)  ali follow..  11  25....................................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAAYICLAVTVNLAGSMANMRAVRELTEAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLQDEFPAQSLAASIYVETGVRPKLETVRLTIPRRYTYAHMDVVADGIIKLYQH...... 430
64 -18.0003bs8_A mol:protein length:438 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  14  45..................................................KGSKIFDIDGNEYIDYVTNDRVVESLKKVAEY-------GTSFGAPTEVENELAKLVIDRVSVEIVRMVSSGTEATMSALRGYTGRNKILKFEGCYHGH-GDSLLIKAGNTITVPYNDLESVKLAFQQFGEDIVIVEPVAGNMGVVPPLQGLRDITEQYGSLLIFDEV--TGFRVDYN-CAQGYFGVTPDL----TCLGKVIGG--GAYGGKAEIMEQIAPSGPIYQAGTSGNPLAMTAGLETLKQLT--PDSYKNFIKKGDRLEEGISKAAEAHGIPHTFNTAKASDLKLFASYYKGMANEGVFLPP---------SQFEGLFLSTAHTDEDIENTIQAAEKVFAEIS.... 430
65 -18.0004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  15  26...........................................................QSSVIELIASENFVSPAVLEANKYAEGYPSKRFYNGCEKAENLAIERVKKLFNCKYANV--SGSQANQAVYLALLQPGDTVLGDSGGHLTHGAAPNMSGKWFNAVSYSDYDEIERLADLHKPKLLIAGF--SAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATG-----EHQSPIPYAHAVTSTTHKTLGPRGGLILSNDEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEKSYIQQVISNAKALASSLQERGYDILTGHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSTSGIRLGTPAGFKEKDFVLVGHMVADILDG...... 391
66 -18.0003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  11  30....................................................KEVIKLASNE---FGTPPKAIECLRQNANKAHLYPDDSM---------IELKSTLAQKYKVQENIIIGAGSDQVIEFAHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSIEFKKLYETHKD-EIKLIFLCLPNNPLGECLDASEATEFIKGVDCLVVIDAAYNEFASFKDSKKHLEPCELIKEFDLYLGTFSKLYGLGGGYGIANANIISAFYKLRAPF----NVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDEKNSTDLSEKLLKKGIIIRNLKSYGLN-----IRITIG---TSYENEKFFTEFDKILR....... 365
67 -18.0003k28_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase 2  ali model follow..  15  43..................................................KGSKVYDIDGNEYIDYVANDRVVEALKAVAER-------GTSFGAPTEIENKLAKLVIERVSIEIVRMVNSGTEATMSALRGYTGRNKILKFIGCYHGH-GDSLLIKAGNTITVAYNDLESVKYAFEQFGDDIVIVEPVAGNMGVVPPLEGLREVTEQNGALLIFDEV--TGFRVAYN-CGQGYYGVTPDL----TCLGKVIGG--GAYGGKAEIMRQVAPSGPIYQAGTSGNPLAMAAGYETLVQLT--PESYVEFERKAEMLEAGLRKAAEKHGIPHHINAAKSSNLQFFAAYYREMVEQGVFLPP---------SQFEGLFLSTVHSDADIEATIAAAEIAMSKL..... 427
68 -18.0004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  12  23....................................................PGAIKLASNE---FGPLPSVRAAIDRATDTVNRYPDNGC---------VQLKAALARHLGPDEHVAVGCGSVSLCQQLQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTDLYAMLATDRTRLIFVCNPNNPTSTVVGPDALARFVEAVHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNV-VVLRTFSKAYGLAGGYAIGHPDVITALDKVYVPF----TVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQA---VWLPLGSRTQDFVEQAADARIVVRPYG-------TDGVRVTVA---APEENDAFLRFARRWRSD...... 353
69 -17.9005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  13  42..................................................EGAYVLDEDDKRYVDYVSHPDVLDAVRRQLDH-------GLSYGAPTALEVEMADLVCSMVSMEMVRMVSSGTEATMSAIRGYTGRDSIIKFEGCYHGH-SDSLLVKAGHTLTLPFNDIEAVRKTLGEVGKEVIIVEPVAGNMNCVPPLEGLREACDEHGVVLIFDEV--TGFRVALG-GAQAYYGVTPDL----STFGKIIGG--GAFGGKREIMQQISPLGPVYQAGTSGNPLAMAAGLTTLRLISR-PGFHDELTAYTTRMLDGLQQRADAAGIPFVTTDVMASDVERFKRFFHLMLDGGVYLAP---------SAFEAGFTSIAHGDKELEITLNAAEKAFAALK.... 429
70 -17.9004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  15  32...........................................................QQNNIELIASENVVSKAVMAANKYAEGYPGKRYYGGTAVVETLAIERAKKLFGAKFANV--SGSQANAAVYMSLIQPGDTVMGSAGGHLTHGAPVSFSGKTYNFVSYNDYDAILAQAKEVRPKLIVAGA--SAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASG-----HHPSPVPYAHVTTTTTHKTLGPRGGLILTDDEIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAKEYGENVIKNAAAMADVFNQHPDFRGTNNHLFLVDVTKVVNGKVAQNVLEEVNITLNKNSIPYEQLSTSGIRVGSPAGMGEAESRQIAEWMVEALEN...... 398
71 -17.9003l44_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1  ali model follow..  16  45..................................................KGAYFWDVDGNKYIDYLAHPHITKAITTAAEN-------GVLYGTPTALEVKFAKMLKEAMALDKVRFVNSGTEAVMTTIRAYTGRTKIMKFAGCYHGH-SDLVLVAAGSVITVPFNNVETLKEALDKWGHEVILVEPIVGNFGIVEPLEKVNELVHEAGALVIYDEV--TAFRFMYG-GAQDLLGVTPDL----TALGKVIGG--GAYGGKKEIMEQVAPLGPAYQAGTAGNPASMASGIACLEVLQQ-EGLYEKLDELGATLEKGILEQAAKHNIDITLNAAQDTDGEMFGKFFKLMLQEGVNLAP---------SKYEAWFLTTEHTKEDIEYTIEAVGRAFAAL..... 430
72 -17.9002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  12  50................................................AITGRRYLDMFTF--LG--NPPALVDDREFHAELMQAALNKPSNSDVYSVAMARFVETFARVLALPHLFFVEGGALAVENALKAAALGTQVLHLRGAFHGRSGYTLSLTNTKPTILEAEALRQARAAFETRPHDIFVAEPIQGEGGDRHFFAAMRELCDEFDALLIFDEVQ-TGC-GLTGT-AYQQLDVAPDI-----AFGKKTQVCGGRRVDEVADNVFAVPSRLNSTWGGN--LTDMVRARRILEVIEAE-GLFERAVQHGKYLRARLDELA-DPRGRGLMCAFSLPTTADRDELIRQLWQRAVIV-------LPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVVT.... 449
73 -17.9005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  14  52..................................................RGAVIVDADGEERLDFVADPDINEAVIRQLAD-------GVAFAMPTEHEIALAELLTEVPSLQQVRFTNSGTEAVMMAIKAYTGRPRIAKFDGCYHGS-YDFAEVSTQSVVVLPFNDIDGTERLIEQHRDELVLIDPNPRSLGLYPALQRLREITRAYGIVLIFDEVISLRS-----GGMQSVLGVTPDL----TAMGKIIGG--GAVGGSAEVMSVFDPTGGP---TFNANPVTMVAGLTAMRKLT--PAEFDRLATLGQQLRAGVEEVPGQVTGYGSLFHIHLHERAFVGRVHEALMGRGIFITP-------------FGCLSTPMGVPEVEAFVDAFAAALQDAR.... 445
74 -17.8003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  14  16....................................................AQAVCLAFNE---EAVEPRVQAAIAAAAARINRYPFDAE---------PRVMRKLAEHFSCPDNLMLVRGIDECFDRISAEFSSMRFVTAWP-GFDGYRARIAVSGLRHFEIGLTD--DPNDLAQVSRDDCVVLANPSNPTGQALSAGELDQLRQR--GKLLIDETY-VDYSSFRARGLAYGENE-----LVFRSFSKSYGLAGGALFGPSELIAAMKRKQWFC----NVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVSSEANFVLVENAAGE---RTLRFLRERGIQVKDAGQFGLHH----IRISIG---REEDNDRLLAALAEYSDH...... 336
75 -17.8004e77_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  13  43..................................................DGAYLFDVDGKAYIDYVNHPAIRQAVIEAVER-------GLSFGAPTEMEVKMAQLVTDLVTMDMVRMVNSGTEATMSAIRGYTGRDKIIKFEGCYHGH-ADCLLVKAGHTLTCTYNDLASVRQAFEQYPQEVIIVEPVAGNMNCIPPLPGLRALCDEFGALLIIDEV--TGFRVALA-GAQDYYHVIPDL----TCLGKIIGG--GAFGGRREVMNALAPTGPVYQAGTSGNPIAMAAGFACLTEISQ-VGVYETLTELTDSLATGLRHAAKEENIPLVVNDVMNCDVERFKRFFHLMLEEGVYLAP---------SAFEAGFMSLAHSNEDIQKTVNAARRCFAKL..... 429

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24