current user: public

If you have questions about the server, please let us know.

Query: 3jtx_A mol:protein length:396 aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .
# Score Template Links and tools%idFirst GMNTLLKQLKPYPFARLHEAMQGISAPEGMEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRRYDGLTVDADNEILPVLGSREALFSFVQTVLNPVSDGIKPAIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGDDLAFARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADVATCVKAAEDIVSLYRLast
1 -124.0003jtx_A mol:protein length:396 aminotransferase  ali model  100  1GMNTLLKQLKPYPFARLHEAMQGISAPEGMEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRRYDGLTVDADNEILPVLGSREALFSFVQTVLNPVSDGIKPAIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGDDLAFARNLWQKAAIQVLPGRFLARDTEQGNPGEGYVRIALVADVATCVKAAEDIVSLYR 396
2 -97.6002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  25  16.ISNKLANIPDSYFGKTMGRKIE---HGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPQKYGAFHGKEAFKQAIVDFYQRQY-NVTLDKEDEVCILYGTKNGLVAVPTCVINPGDY-----VLLPDPGYTDYLAGVLLADGKPVPLNLEPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNP-----SILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIYALNHYDDLEEQSNVFKTRRDRFEAMLAKALPFVHAKGGIYVWLETPPGDSEQFEQFLVQEKSILVAPGKPF------GENGNRYVRISLALDDQKLDEAAIRLTELAY 395
3 -95.7001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  24  2ALSDRLELVSASEIRKLFDIAA-----GMKDVISLGIGEPDFDTPQHIKEYAKEALDKGTHYGPNIGLLELREAIAEKLKKQ-NGIEADPKTEIMVLLGANQAFLMGLSAFLKDGEE-----VLIPTPAFVSYAPAVILAGGKPVEVPTEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSI----ASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSVEEMRKEYDRRRKLVWKRLNEMLPTVKPKGAFYIFPRIRDLTSKKFSELMLKEARVAVVPGSAF------GKAGEGYVRISYATAYEKLEEAMDRMERVLK 384
4 -93.3004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  26  9.FNKNLNKIEVSMIRQFDQSIS-----DIPDVLKLTLGEPDFATPKHIKEAAKRAIDADSHYTGMAGLLALRQAASAFVKEKY-HLTYNPDNEILVTIGATEALSASLTAILEPGDK-----VLLPAPAYPGYEPVVNLVGAEVVEIDTRSNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEY------LPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDALPMKEEYIKRRDYIIEKMEAMFKIIKPDGAFYIFAKIPGQDSFKFLQDFAKEKAVAFIPGVAF------GKYGEGYLRISYAASMETIKEAMKRLKEFME 389
5 -93.0003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  37  2......MTFEPYPFERLRALLKEIT--PKKRGLDLGIGEPQFETPKFIQDALKNHTHSLNIYPKSAFEESLRAAQRGFFKRRF-KIELKEN-ELISTLGSREVLFNFPSFVLFDYQ---NPTIAYPNPFYQIYEGAAKFIKAKSLLMPLKENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLEACMLAGNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWLDDRHAEFFRNIYANNLKLARKIFKN---TLIYPYSFYVYLPVQ--NGENFAKTLYQNEGIITLPALYLGRN----RIGADYVRLALVYDTPLLEKPLEIIETYRE 373
6 -92.9002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  27  3......RVPEPSVFLVVDEAKRKAR-ERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPYGYCLKSCTLPFLEEAARWYEGRY-GVGLDPRREALALIGSQEGLAHLLLALTEPEDL-----LLLPEVAYPSYFGAARVASLRTFLIPL-REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAP-----SPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGDDLEFGLRLV-ERGVALAPGRGF------GPGGKGFVRIALVRPLEELLEAAKRIREALD 376
7 -91.9005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  20  1ANAKRIEGLDSNVWVEFTKLAA------DPSVVNLGQGFPDISPPSYVKEELSKAADNMNQYTRGFGHPALVKALSCLYGKIY-QRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDE-----VIIMVPFYDCYEPMVRMAGAVPVFIPLRSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKI----ATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIECYFNSLPKELEVKRDRMVRLLNSVLKPIVPDGGYFIIADVSSPYDYKFVKWMTKHKKLTAIPVSAFCDSKS-KPHFEKLVRFCFIKKDSTLDAAEEIFRAW.. 410
8 -90.8002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  27  9RRFARIDRLPPYVFNITAELKMAAR-RRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREHGYSTSRGIPRLRRAISHWYRDRY-DVQIDPESEAIVTIGSKEGLAHLMLATLDHGDT-----ILVPNPSYPIHIYGAVIAGAQVRSVPLPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQ----VPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQVRDIARQYQQRRDVLVKGLREAWMVENPKASMYVWAKIPELGSLEFAKKLLQDAKVSVSPGIGF------GDYGDDHVRFALIENRDRLRQAVRGIKAMFR 396
9 -89.4003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  18  8.FKKLGTDNAPGQEVRQSAAGLEALIRG-GRPVDFSHGDVDAPTPGAFDLFSAGVQSGGQAYTEYRGDLGIRDLLAPRLAAFT-GAPVDARDGLIITPGTQGALFLAVAATVARGDK-----VAIVQPDYFANRKLVEFFEGEMVPVQLDETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVD---AENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGMEDRIARHQAIRDELLHVLRGCVFARTPQAGSYLFPRLPKVAPAEFVKILRLQAGVVVTPGTEF------SPHTADSVRLNFSQDHEAAVAAARRIVTLVE 403
10 -89.2003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  19  38QRNENFGKLRAGYLFPEIARRRKAHKNPDAKIISLGIGDTTEPLPKYIADAMAKAAEGYSGYGAEQGQGALREAVASTFYGHAG-----AADEIFISDGSKCDIARI-QMMFGSKPT-----VAVQDPSYPVYVDTSVMMGMTGDHNGTGDGIEYMVCNPPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYE----IPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQPEKEMNAMIKFYKENAQILKTTFTEMFSVYGGDDAPYIWVGFPGKPSWDVFAEILERCNIVTTPGSGY------GPAGEGFVRASAFGSRENILEAVRRFKEAYG 438
11 -88.8001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  19  14DLPKRYQGSTKSVWVEYIQLAA------QYKPLNLGQGFPDYHAPKYALNALAAAANSPNQYTRGFGHPRLVQALSKLYSQLV-DRTINPMTEVLVTVGAYEALYATIQGHVDEGDE-----VIIIEPFFDCYEPMVKAAGGIPRFIPLKSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRI----CTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFEPECYFNSISGELMAKRDYMASFLAEVMNPTVPQGGYFMVADWSSRKDYRFTKWMTKSVGLQGIPPSAFYSEPN-KHLGEDFVRYCFFKKDENLQKAAEILRKWKG 427
12 -87.7002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  23  10.FSDRVLLTEESPIRKLVPFAEMAK-KRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRRQ-RVDVKPE-NVLVTNGGSEAILFSFAVIANPGDE-----ILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRG-EFASALSIES------DKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFDFVRETYRERVETVLKKLEEHKRFTKPSGAFYITAELPVEDAEEFARWMLTDFNTMVAPLRGFYLTPGL---GKKEIRIACVLEKDLLSRAIDVLMEGLK 394
13 -87.7001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  21  8.PQSKLPQLGTTIFTQMSALA------QQHQAINLSQGFPDFDGPRYLQERLAHHVAQGNQYAPMTGVQALREAIAQKTERLY-GYQPDADSDITVTAGATEALYAAITALVRNGDE-----VICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASV----LAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEYLALPDFYRQKRDILVNALNESLEILPCEGTYFLLVDYSALDDVEFCQWLTQEHGVAAIPLSVFCAD----PFPHKLIRLCFAKKESTLLAAAERLRQL.. 386
14 -87.7001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  24  3GLSRRVQAMKPSATVAVNAKALELRR-QGVDLVALTAGEPDFDTPEHVKEAARRALAQGTKYAPPAGIPELREALAEKFRRE-NGLSVTPE-ETIVTVGGSQALFNLFQAILDPGDE-----VIVLSPYWVSYPEMVRFAGGVVVEVETPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEG-EHFSPGRV------APEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAVEMAREAYRRRRDLLLEGLTALLKAVRPSGAFYVLMDTSPPDEVRAAERLL-EAGVAVVPGTDFA--------AFGHVRLSYATSEENLRKALERFARVLG 383
15 -86.2003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  20  4.KNSSRSAVDPFIVMDVMEAARRAEE-AGRRIIHMEVGQPGTGAPRGAVEALAKSLETDLGYTVALGLPALRQRIARLYGEWY-GVDLDPG-RVVITPGSSGGFLLAFTALFDSGDR-----VGIGAPGYPSYRQILRALGLVPVDLPTPENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAV--------TALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALDCDAELQANLDVYKANRKLMLERLPKATRIAPPDGAFYVYADVSDDDSRAFAAEILEKAGVAVTPGLDFDP-----ERGAGTLRFSYARATADIEEGLDRLEAFMQ 380
16 -86.2001xi9_A mol:protein length:406 putative transaminase  ali model follow..  20  5RASKRALSV-EYAIRDVVLPARELE-KKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGNYYGDSEGLPELRKAIVEREKRK-NGVDITPD-DVRVTAAVTEALQLIFGALLDPGDE-----ILVPGPSYPPYTGLVKFYGGKPVEYRTEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEG-EHISPGSLTK-----DVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDLKEYMKKLKERRDYIYKRLNEIISTTKPQGAFYIFPKIEVKNDKEFVLDVLHNAHVLFVHGSGF------GEYGAGHFRAVFLPPIEILEEAMDRFEKFMK 395
17 -86.1004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  19  6.QARRLDGIDYNPWVEFVKLAS------EHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDNQYTKTFGYPPLTKILASFFGELL-GQEIDPLRNVLVTVGGYGALFTAFQALVDEGDE-----VIIIEPFFDCYEPMTMMAGGRPVFVSLSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISI----ASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFERSSYFVQFPQAMQRCRDHMIRSLQSVLKPIIPQGSYFLITDISDPYDRRFVKWMIKNKGLVAIPVSIFYSVPH-QKHFDHYIRFCFVKDEATLQAMDEKLRKWKV 420
18 -86.0002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  19  25SRNSNMSKLQAGYLFPEIARRRSAHKYPDAQVISLGIGDTTEPIPEVITSAMAKKAEGYSGYGAEQGAKPLRAAIAKTFYGGLG-----GDDDVFVSDGAKCDISRL-QVMFGSNVT-----IAVQDPSYPAYVDSSVIMGQTGQFNTDVQKY---NGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDD-NPRSIFE----IPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPEEAMHKVIGFYKENTNIIIDTFTSLYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVVTTPGSGF------GPGGEGFVRVSAFGHRENILEACRRFKQLYK 426
19 -85.5002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  23  2.LSKRLLNFESFEVMDILALAQKLES-EGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGTHYTDSRGILELREKISELYKDKY-KADIIPD-NIIITGGSSLGLFFALSSIIDDGDE-----VLIQNPCYPCYKNFIRFLGAKPVFCDF-------TVESLEEALSDKTKAIIINSPSNPLGEVID----REIYEFAYENIPYIISDEIYNGLVYEGKC-----YSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKETEINSMIKEFDRRRRLVLKYVKDFWEVNNPIGAYYVFPNIGE-DGREFAYKLLKEKFVALTPGIGF------GSKGKNYIRISYANSYENIKEGLERIKEFLN 369
20 -85.4001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  20  8.VSRRISEIPISKTMELDAKAKALIK-KGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGVKYTDPRGIYELREGIAKRIGER-YKKDISPD-QVVVTNGAKQALFNAFMALLDPGDE-----VIVFSPVWVSYIPQIILAGGTVNVVETMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEF-----TSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNS--YMVQTFKERKNFVVERLKKMVKFVEPEGAFYLFFKVRG-DDVKFCERLLEEKKVALVPGSAFL--------KPGFVRLSFATSIERLTEALDRIEDFLN 381
21 -85.3003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  20  30.TSNTAKDVWSLTNEAAAKAANNSKN-QGRELINLGQGFFSYSPPQFAIKEAQKALDMVNQYSPTRGRPSLINSLIKLYSPIY-NTELKAE-NVTVTTGANEGILSCLMGLLNAGDE-----VIVFEPFFDQYIPNIELCGGKVVYVPIRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIA----TLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDALKFEKMRQEYINKFKIFTSIFDELLPYTAPEGTYFVLVDFSKGKDFRISHWLINELGVVAIPPTEFYIKEH-EKAAENLLRFAVCKDDAYLENAVERLKLLKD 445
22 -85.1006DK6 Entity 1(prereleased)  ali follow..  19  9.LKLKAGYLFPEIARRVKAFTEGNP-EAAQRLIRCGIGDVTEALPEAVRYAMHEAVDEFKGYGPEQGYDFLRNAIADNDYKAR-GLPIEAD-EIFISDGSKCDTGNI-LDIFGQGNT-----IAITDPVYPVYVDTNVMIGNTGEADENGAYACTPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFE----IEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKRRHSTKFNGASYIVQKGAEALYTDESQTKALIEHYMGNAALLVEACKNALSVFGGVNAPYVWVGCPAGTSWQMFDKMLNEANVVITPGSGF------GSAGEGYFRISAFNSRANVEEVCRRIAAL.. 410
23 -84.4001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  21  2RLHPRTEAAKESIFPRMSGLAQ------RLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYAPPAGLPALREALAEEFAVE--------PESVVVTSGATEALYVLLQSLVGPGDE-----VVVLEPFFDVYLPDAFLAGAKARLVRLTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERP-------RRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKREGFYEALREGYRRRRDLLAGGLRAMLRVYVPEGTYFLMAELPG----WDAFRLVEEARVALIPASAFYLE----DPPKDLFRFAFCKTEEELHLALERLGRVVN 369
24 -84.4002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  21  2ATVSRLRPYATTVFAEMSALAT------RIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGNQYPPGPGSAPLRRAIAAQRRRHF-GVDYDPETEVLVTVGATEAIAAAVLGLVEPGSE-----VLLIEPFYDSYSPVVAMAGAHRVTVPLDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPL----AGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAVAALRNSLRARRDRLAAGLTEIFAVHDSYGTYFLCADPRPDDSTEFCAALPEKVGVAAIPMSAFGQASQQADVWNHLVRFTFCKRDDTLDEAIRRLSVLAE 394
25 -84.4001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  23  2KLAARVESVSPSMTLIIDAKAKAMKA-EGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGTRYGPAAGEPRLREAIAQKLQRD-NGLCYGAD-NILVTNGGKQSIFNLMLAMIEPGDE-----VIIPAPFWVSYPEMVKLAEGTPVILPTVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAAS---PEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDVQEMLAAFAERRRYMLDALNAMLECPKPDGAFYMFPSIAKRSSLDFCSELLDQHQVATVPGAAFG--------ADDCIRLSYATDLDTIKRGMERLEKFLH 385
26 -83.4004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  19  25EKSSKLENVCYDIRGPVLKEAKRLE-EEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTAQGYCDSKGLYSARKAIMQHYQAR-GMRDVTVE-DIYIGNGVSELIVQAMQALLNSGDE-----MLVPAPDYPLWTAAVSLSSGKAVHYLCESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPD-----LLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAGLEMLASMRLCANVPAQHAIQTALGGYQEFITPGGRLYEQRNRAWELINDIVSCVKPRGALYMFPKIDAHDDQKMVLDFLLQEKVLLVQGTAF------NWPWPDHFRIVTLPRVDDIELSLSKFARFLS 420
27 -82.9005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  22  3DRVALRAGVPPFYVMDVWLAAAERQR-THGDLVNLSAGQPSAGAPEPVRAAAAAALHLNLGYSVALGIPELRDAIAADYQRRH-GITVEPD-AVVITTGSSGGFLLAFLACFDAGDR-----VAMASPGYPCYRNILSALGCEVVEIPCPQTRFQPTAQML-AEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCA------WQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATADGNLASYAINRSLLLDGLRRIDRLAPTDGAFYVYADVSDSDSLAFCSKLLADTGVAIAPGIDFDTAR-----GGSFVRISFAGPSGDIEEALRRIGSWLP 386
28 -81.2005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  22  71SLSPRVQSLKPSKTMVITDLAATLVQ-SGVPVIRLAAGEPDFDTPKVVAEAGINAIREGTRYTLNAGITELREAICRKLKEE-NGLSYAPD-QILVSNGAKQSLLQAVLAVCSPGDE-----VIIPAPYWVSYTEQARLADATPVVIPTISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHTSF----ASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGGGETVAEMVKAYRERRDFLVKSLGDIVKISEPQGAFYLFIDFSANDSSSLALYFLDKFQVAMVPGDAFG--------DDSCIRISYATSLDVLQAAVEKIRKALE 467
29 -80.5004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  20  39VRNVNLEKLKNNYLFPEINRRELEHKHPNVQLISLGTGDTTEPIPEQITSHMSNFAEGYRGYGLEQGNKTLRKAIAETFYRDLH-----KSNEVFVSDGAQSDISRL-QLLLGSNVT-----IAVQDPTFPAYIDSSVIIGQTGHFHEKTKKY-PNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDG-SPRSIYE----IPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSGLKEIRSVNNYYKENRKILMDTLVSLLKVYGGVNAPYLWVHFKGSKSWDVFNEILENTHIITVPGSGF------GPGGEEYLRISGFGRRDHIVEASKRLQNFFN 440
30 -80.3003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  22  2KRNPHFVSLKNYLFADLQKRVAQFRENPQHTVINLSIGDTTQPLNASVAEAFASSIARLRGYGPDFGLPALRQKLSEDFYRGF-----VDAKEIFISDGAKVDLFRL-LSFFGPNQT-----VAIQDPSYPAYLDIARLTGAKEIIA-LQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFE----IPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ-LEAIHYYRENSDLLRKALLATFEVFGGEHAPYLWVKPTQISDRDLFDFFLREYHIAITPGIGF------GRSGSGFVRFSSLGKREDILAACERLQMAPA 391
31 -79.4001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  19  7.SMSNHAGLVFNPIRTVSDNAK--PSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEANGYFPTVGSPEAREAVATWWRNSFLKSTIVKD-NVVLCSGGSHGILMAITAICDAGDY-----ALVPQPGFPHYETVCKAYGIGMHFYNCPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFET-TVPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQELDQIVAKIEESAMYLYNHIGECLAPTMPRGAMYLMSRIDLKTDVEFFEKLLEEENVQVLPGTIFH--------APGFTRLTTTRPVEVYREAVERIKAFCQ 411
32 -79.2003ele_A mol:protein length:398 Amino Transferase  ali model follow..  21  4.VNESMYQLVRSAIRELFEYGKKRAAIGKENVYDFSIGNPSIPAPQIVNDTIKELVTDYHGYTSAQGDVETRAAIAEFLNNTH-GTHFNAD-NLYMTMGAAASLSICFRALTSDA----YDEFITIAPYFPEYKVFVNAAGARLVEVPADTEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFV-------TKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGACAPSLFQKMIVKCQGATG----DINAYKENRDLLYEGLTRIYHCFKPDGAFYMFVKALEDDSNAFCEKAK-EEDVLIVAADGFG--------CPGWVRISYCVDREMIKHSMPAFEKIYK 394
33 -75.6006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  14  14HMHPQATPAPGAPLLDLTQHEIQAL-TMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQATYEKRFTEAFFQLHRQPTA-----VKNKTMLSYAASISTMVAGMFLKKERLA-----VTLIEPCFDNLYDVLANMDVPLYPID-ESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMY-ELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVRDADRLASVREVLTRNRECARKTLDGSLEYQEPVVKSVAWFRVDHELTATDVHRLLSADGVYVLPGRYFYWSE--PSKGDAYVRMALAREPEMFADAMALTRQVLD 403
34 -75.5003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  14  16.NELHIKDLGMASIRDLVALVTNLEKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGSIYPNLDGLPELKQEASRFAKLFV-NIDIPAR-ACVPTVGSMQGCFVSFLVAKNREYG-----TLFIDPGFNLNKLQCRILGQKFESFDLEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDYSHPGEPLYPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPALYALSSGATHSAQWGMAAMLKACNDFRDSVIEYGRKARIMKKMFLDNKDGNEPLADGFYFTVGKGMDSSKLIEKFVRYGMCAITLKTT-------GSKRNEAMRICTSLLESQFPDLEKRLQMLNA 435
35 -73.5003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  17  21.RPSDMAKKTFNPIRAIVDNMKVKP-NPNKTMISLSIGDPNLPTDPEVTQAMKDALDSGNGYAPSIGFLSSREEIASYYHCPEAPLE---AKDVILTSGCSQAIDLCLAVLANPGQN-----ILVPRPGFSLYKTLAESMGIEVKLYNLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATL-----STDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRSQRILGPCTIVQGALKSILCRGEFYHNTLSFLKSNADLCYGALAAILRPVRPSGAMYLMVGIEMENDVEFTERLVAEQSVHCLPATCFE--------YPNFIRVVITVPEVMMLEACSRIQEFCE 416
36 -72.9003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  14  55.PFTEVIRANIGDAQAMGQQPITFL-RQVMALCTYPLDSPSFPEDAKARRILQACGGNSGSYSASQGVNCIREDVAAYITRRDGGVPADPD-NIYLTTGASDGISTILKILVSGGGKS-RTGVMIPIPQYPLYSAVISELDAIQVNYYLEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRKKVLYEMGPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLLSVRCPPVSGQAAMDIVVNPREKESVLGNLAKKAKLTEDLFNQVIHCNPLQGAMYAFPRIFIAPDMFYCMKLLEETGICVVPGSGFGQ-----REGTYHFRMTILPPVEKLKTVLQKVKDFHI 485
37 -72.7003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  17  4.RPSDMSNKTFNPIRAIVDNMKVKP-NPNKTVISLSIGDPNLPTDPEVTQAMKDALDSGNGYAPSIGYLSSREEVASYYHCPEAPLE---AKDVILTSGCSQAIELCLAVLANPGQN-----ILIPRPGFSLYRTLAESMGIEVKLYNLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATL-----STNVPILSCGGLAKRWLVPGWRLGWILIHDRRIRDGLVKLSQRILGPCTIVQGALKSILQRQEFYQDTLSFLKSNADLCYGALSAILQPVRPSGAMYLMVGIEMENDVEFTERLIAEQSVHCLPATCFE--------YPNFFRVVITVPEVMMLEACSRIQEFCE 399
38 -72.0004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  18  36..SSKHAQRTLQPLNNLTDNMK--PSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSGNGYPPTVGADNLRQVVSTYWRRFCQ-----KWENVIITSGVSQAIVLALTALCNEGDN-----ILVCAPSFPHYKSVCDSYGIECRYYYLPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDTN-----VPRLILGGTAKYQVCPGWRVGWSILIDPMWAVGMERLTQLIAGVNSICQEAIARTLCPTECTEHIVTQLEAGAKVYARLLEHDISMEAPQASMFVMLKLNLKSDMEFYEKLLDEENVQVLPGEIFG--------MSGFLRATVSRPSAVLNEAVDRIIEFCE 434
39 -71.7004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  14  16.SSLRPRREDPPVLEEWYRRHLG---PDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVMDDSVSQGGEGVRRAIADRYAG--------DADRVLVTHGSSEAIALTLNALLHRGDR-----VVVQEGIYHSLGHYPRAAGCDVAVLPGRVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADP-------GADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAERAVRHADEIGARAAEARHNLAHLTGWMAALVRWTPPEGGVCALPVFREQEVERFCLELLERHRTLLVPGTAFG--------APHGARLGFGGPQEDFRAGLDGLSRFLR 394
40 -70.4003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  13  57.LYCNIGNPQSLGQQPVTFFREVLALCDHPDLLQREEIKTLFSAISRAKQILAMIPGRAGAYSHSQGIHGLRDAIASGIASR-DGFPANAD-DIFLTDGASPGVHLMMQLLINEKDG-----ILVPIPQYPLYSASIALHGGALVPYYLESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKKKIVRSLGYGEEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNIPKASDESYASKAEKDGILASLARRAKALEHAFNKLITCNEAEGAMYVFPQICKAPDAFYALRLLESTGIVVVPGSGFGQ-----VPGTWHFRCTILPQEDKIPAVISRFTVFHE 482
41 -70.2003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  12  75AGYINTDGIRERLFAFLDPDKNDED-KFLIDAVNYCHTELGLNRDKVVAEWVNGAVAN-NYPVPDRCLVNTEKIINYFLQELYKDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDK-----IAINEPIFTPYLRIPELKDYELVEVDLEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSVVP---------YNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVLDADSRSIGLYHTAGLSTPQQIMEALFSMTHLLDTNTHYYSLIDIYRFEQVDFLLKLAEKNGVVLVDGVGFGA-------KPGELRVSQANLPTEYALIGKQVLELLK 523
42 -68.7003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  19  1..GMKLPRFGVEEWLNVHENSAIYDI-AGVSISSLTLEEL-FALSGTNPEDFYKKLQGTLNYGWIEGSPAFKKSVSQLYTG--------KPEQILQTNGATGANLLVLYSLIEPGDH-----VISLYPTYQQLYDIPKSLGAEVDLWQIEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELD---------VPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALAHYQELERNRHILEENLAILDQWIEEEVSYIRPAVVSTSFVKIADMPMEDFCLQLLQEHGVLLVPGNRFE--------RDGYVRLGFACEQETLIKGLEKLSQFLR 369
43 -68.0005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  14  1..............MTTQPQLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELVLWAESEQRPEAHQAYFTLLGQ--HGYPAEPG-RVLSCYSSSVSMEILARSLSASVDR-----VALVHPTFDNIADLLRGNGLDLVPVEEDALH-----ADLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAH-----YDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSRDDGGLADLHAFILHNRSVVRRALAGVVSFPDPESRSSVERVAFAGRTGTEVWEELQRHHVFALPCRQFHWAEP--SDGDHMVRIALSRSTEPLEKSVQVLRTVLE 374
44 -67.6001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  15  4.LSRNATFNSHGQDSSYFLGWQEYEKNNTNGIIQMGLAENAKNPEAAAFKKNGESIFAEALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEA-----VLIPTPYYPGFDRDLKWTGVEIVPIHCSSNGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKD-SEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGL-VSSQTQHLLSAMLSDKNYIAENHKRLKQRQKKLVSGLQKSISCLNGNAGLFCWVDMRHEAEMELWKKIVYEVHLNISPGSSC------HCTEPGWFRVCFANPERTLDLAMQRLKAFVG 430
45 -66.8003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  15  3TFSLFGDKFRHSGITRLMEDLNDGL--RTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKNYDGPQGKTALLNALAVLLRETL-GWDIEPQ-NIALTNGSQSAFFYLFNLFAGRRADG--STKKVLFPLAPEYIGYADSGLEDDLFVSLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVPFPGI-------IFSEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNDSETVIKPFYYQRVQQTIAIIRRYLSIHKPEGAIFLWLWFKDLITTELLYQRLKARGVLMVPGHYFFPGDKPWPHTHQCMRMNYVPEPDKIEAGVKILAEEIE 411
46 -65.6003if2_A mol:protein length:444 Aminotransferase  ali model follow..  15  3KFSKFGQKFQPTGISQLMDDLGDALK-SDQPVNMLGGGNPAKIDANDTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRHY-DWNLTSE-NIALTNGSQNAFFYLFNLFGGASKSVDKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDE--FEALENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYSDAHLNW-------DNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVANDRSDNEIKPFYQKQATLAVKLLKQALGIHKPEGAIFLWLWFKDLSTLDLYERLKAK-GTLIVPSEYFGVDVSDYQHAHECIRMSIAADEQTLIDGIKVIGEVVR 438
47 -65.3001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  14  2.LSKLATNEEHGENSPYFDGWKAYDSKNPNGVIQMGLAENQLNPKGSICSEGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDPERVVMAGGATGANETIIFCLADPGDA-----FLVPSPYYPAFNRDLRWTGVQLIPIHCESNNFKITSKAVKEAYENKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILDEQEMTKDLVHIVYSLSKDMGLPGFRVGIIYSNDDVVNCARKMSSFGLVSTQTQYFLAAMLSDEKDNFLRESAMRLGKRHKHFTNGLEVVIKCLKNNAGLFCWMDLRPDSEMSLWRVIINDVKLNVSPGSSF------ECQEPGWFRVCFANMDDGVDIALARIRRFVG 425
48 -64.6002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  17  9SLNEQLQQSNATAFAMLSDLGQNMSAEAKSTTYNATIGMATNKDGKMFASSLDAMFDEIFPYAPPQGIEELRDLWQQKMLRDNPELSIDNMSRPIVTNALTHGLSLVGDLFVNQDDT-----ILLPEHNWGNYKLVFNTRNGANLTYPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSLFTALTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQIQTLKERYEVTKEVVYADQYHSWQAYDFNSGYFMAIKVHDVDPEALRKHLIDKYSIGVIALNATD------------IRIAFSCEKDDIPHVFDSIAKAID 427
49 -63.8002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  11  81GIEGRFERF-------IAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILG--CNYPVPPRMLTVSEQIVRQYIVREGAVPPESV-DLFAVEGGTAAMAYIISGLLKAGDK-----VAIGMPVFTPYIEIPELAQYDLKEVPIPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSVCP---------RNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQ------LPESAKKALDHRYRSLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQVNYYTLIDLQNSSTGDMLFRVADETGIVLLPGRGFGS-------DRPSGRASLANLNEYEYAAIGRALRRLA 518
50 -63.3002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  11  82GIEGRFERY-------IAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGC-NYPVPPRMLNISEKIVRQYIIREMGDAIPSESVNLFAVEGGTAAMAYILNGLLKAGDK-----VAIGMPVFTPYIEIPELAQYALEEVAINSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAICP---------ENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSDEYKHTLKQLIRRRETTLYRELGMPPLRENAVDYYTLIDLQDSSTGDMLFRIADETGIVLLPGRGFGS-------NRPSGRASLANLNEYEYAAIGRALRKM. 518
51 -62.3003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  12  79....KIEGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGILGC-NYPVPPRMLNISEKIVRQYIIREMGDAIPSESVNLFAVEGGTAAMAYIVNGLLKAGDK-----VAIGMPVFTPYIEIPELAQYALEEVAIPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSLFAICP---------ANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSDQYKHTLKQLIRRREATLYRELGTPQRDENAVDYYTLIDLQDSSTGDMLFRIADETGIVLLPGRGFGS-------DRPSGRASLANLNEYEYAAIGRALRQM. 518
52 -56.9003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  14  2.....VKLENSRKPEKISNKNI----PMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTDLMSYFSDMTEPELEDAIKDLHGVVGN-----EDRYIVVGTGSTQLCQAAVHALSSLARSQ-PVSVVAAAPFYSTYVEETTYVRSGMYKWEG----------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHY------------TPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVKKMVEYIIVNSIGVSKESQVRTAKILNSENFFKYGREMMKNRWEKLREVVKESFTLPKYPEAFCNYFGKSGTKEETDLVSELRRHKVMSRAGERCGS-------DKKHVRVSMLSREDVFNVFLERLANMKL 385
53 -56.7004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  14  7TIKRATWNNGPDLAFDINNKANAAIEKYGEAVINAALGTLLDDKGPSVYDRLDEMDRSHASYAPIEGEKDYRKIVIDTLFGPYK---PEGYISAIATPGGTGAIRSAIFSYLDEGDP-----LICHDYYWAPYRKICEEFGRNFKTFEFFTDDFAFNIDVYKEAIDEGIRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEKFSNLPR-NLFVVVAFSMSKSHTAYGLRSGAAVGSKEIIEEFEASLAHSARCNWSNGTHAAQNILIEEQELVDLRNMLKSRADVFVTAAKENLTMIPYFGGFFTFIPT---DKAFDIVKDLEKENIFTIPSA-------------KGIRVAICGGEEKIPKLVQRLAFYTN 411
54 -56.4003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  13  1.MFENITAAPADPILGLADLFRADERP---GKINLGQGVYKDETGKSVKKAEQYLLENEKNYLGIDGIPEFGRCTQELLFGK-GSALINDKRARTPGGTGALRVAADFLAKNTSVKR-----VWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEGLR---AFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDAELTDMRQRIQRMRQLFVNTLQEKANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASG----------------RVNVAMTPDNMAPLCEAIVAVL. 396
55 -55.8003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  12  8AAKHAKGKKLKDVIFVTAGQAQAAKENGRENVVNGTLGEGNLVFLKTVKEEYLSLSDSEVGYAPIAGIPDFLCAAEKECFGNFR---PEGHIRSIATAGGTGGIHHLIHNYTEPGDE-----VLTADWYWGAYRVICSDTGRTLVTYSLFDEHNNFNHEAFQNRVKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKFSHLP-KEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNKSNICRPAMRTMANIVADPAERNCYYQLIRDRADIFKQEAAQVLPMLPYRGGFFITIPTD--SANAICEELKKEHIYVIALANGIRIA-------CGIPKCQMTGLAEKIYNAMKSLGKL.. 418
56 -55.5001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  13  1.MLGNLKPQAPDKILALMGEFRADPRQ---GKIDLGVGVYDATGHTPIMRAVHAAEQRTKTYAGLSGEPEFQKAMGELILGD-GLKSETTATLATVGGTGALRQALELARMANPDLR-----VFVSDPTWPNHVSIMNFMGLPVQTYRYDAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRL---IASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMASFPPFHGAKIVSTVLTTPELRADMAELEAVRSGMLRLREQGELRDLSGSDRFGFVAEHRGGATPEQVKRIKEEFGIYMVGDS----------------RINIAGNDNTIPILARAIIEVG. 393
57 -55.4003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  13  1.MFQKVDAYAGDPILTLMERFKEDPRSDSIGLYYNEDGIIPQLQAVAEAEARLNAQPHGSLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGFLKRYFPESG-----VWVSDPTWENHVAIFAGAGFEVSTYPWDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRA---IASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKSSPPNFGAQVVAAVLNDEALKASLKEVEEMRTRILAMRQEKVLSTEMPERNFDYLLNQRGGLSAAQVDRLREEFGVYLIASG----------------RMCVAGNTANVQRVAKAFAAVM. 397
58 -55.1004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  12  2AMFEHIDAYPGDPILTLNENFQKDPRD---QKVNLSIGIYDAEGRIPVMGAVREAESGPKPYLPMVGLAAYRDAVQSLVFGA-DHPARAAGRIATLGGSGALKVGADFLKRYFPDSQ-----VWLSDPSWENHRFIFERAGFTVNTYPYDEATGGLKFDAMLAALPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAVRE---LARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLASNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARSIHDGLRDHVSGEALTRYVKQRGGLTESQVDALREVHGVYILRSG----------------RMCVAGNDSNVGIVADAIGKVLK 399
59 -54.8004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  12  4GTFENITAAPADPILGLADLFRADERP---GKINLGIGVKDETGKTPVLTSVKKAEETTKNYLGIDGIPEFGRCTQELLFGK-GSALINDKRARTPGGTGALRVAADFLAKNTSVKR-----VWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRA---FAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDAELTDMRQRIQRMRQLFVNTLQEKNRDFSFIIKQNGMFSFSG--TKEQVLRLREEFGVYAVASG----------------RVNVAMTPDNMAPLCEAIVAVL. 400
60 -54.7001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  12  30..GIISEGSPKCECNTCYT--PDCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVLHRMSYFFNPVSFELEKTIKELHEVVGNAAA--KDRYIVFGVGVTQLIHGLVISLSPNMTATPDAKVVAHAPFYPVFREQTKYFDK-------KGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYT------------PIKYKADEDILLFTMSKFTGHSGSRFGWLIKDESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKGFKKLRERWVNITALLDQSDRFSRPPSPSYAWVKCEW-EEDKDCYQTFQNGRINTQNGVGFEA-------SSRYVRLSLIKTQDDFDQLMYYLKDMVK 423
61 -54.5002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  19  7.LAGRANWIKGSALADVMKKASE-LQKKGVKLISLAAGDPDPEL-GEIAKEVLEKEPKSVMYTPANGIPELREELAAFLKKY-DHLEVSPE-NIVITIGGTGALDLLGRVLIDPGD-----VVITENPSYINTLLAFEQLGAKIEGVPVDNDG--MRVDLLEEKIKEKVKLIYT-IPTNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKALDNE-----GRVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALEYLKEKYHLEGALLGYKEKRDIMLKALENHLEFTKPIAGMFVMFFLPEGDGISFANELMEREGVVVVPGKPFYTD----ESGKNAIRLNFSPSKEEIPIGIKKLAKLYK 402
62 -54.4005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  13  2SWWTHVEMGPPDPILGVTEAFKRDTNS---KKMNLGVGAYRDDLPSVRKAEAQIAAKNLKEYLPIGGLAEFCKASAELALGE-NSEVLKSGRQTISGTGALRIGASFLQRFFKFSRD-----VFLPKPTWGNHTPIFRDAGMQLQGYRYDPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDK---AWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKVESQLKILIRPMYSNPPLNGARIAAAILNTPDRKQWLQEVKGMADRIIGMRTQSNLKKEGSTHNWQHITDQIGGLKPEQVERLIKEFSIYMTKDGRISV------AGVTSSNVGYL---------AHAIHQVTK 401
63 -54.2001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  12  1.MFENITATTADPILGLADLFRADERP---GKIDLGIGYKDETGKTPVLTSVKKAEQYLKNYLGIDGIPEFGRCTQELLFGK-GSALINDKRAQTPGGSGALRVAADFLAKNTSVKR-----VWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRA---FAAMHKELIVASSYSKNFALYNERVGACTLVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLFVNTLQEKGANRDFSFIIKQNGGLTKEQVLRLREEFGVYAVASG----------------RVNVAMTPDNMAPLCEAIVAVL. 396
64 -54.1004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  11  1........MAMGKPDPILGLGQDFRMDPAKRKVNLSIGVYDDADQPFVLECVKQATLGTMDYAPVTGIASFVEEAQKLCFGP-TCAALRDGRQTLGGTGALRIGGDLLNRFVANCNR-----IYGPDVGYPNHESIFAKAGMELTPYSYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAF--VPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLASNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAERLVSELKACGSVHDWSHIERQVGGLTREQVELLRSEYHIYMTLNG----------------RAAVSLNSTNVEYVSQAIHNVTK 390
65 -54.0004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  12  17SLFSAVELAPRDPILGLNEAFNA---DTRPTKVNLGVGVYTNEDGKIPLLRAVRDAGLPRGYLPIDGIAAYDASVQKLLLGD-DSPLIAAGRVVALGGTGALKIGADFLRTLNPKAK-----VAISDPSWENHRALFDMAGFEVVAYPYDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRL---FAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAGLVERLKAAGIERDFSFINAQRGGLTSAQVDRLREEFGIYAVSTG----------------RICVALNTRNLDVVANAIAAVLK 414
66 -54.0002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  12  1.MFENITTAPADPILGLADLLRADERP---GKIDLGMGVYDETGKTPVLTSVKKAEETTKNYLGIDGIPEFGRCTQELLFGK-GSALINDKRARTPGGTGALRVAADFLAKNTSVKR-----VWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLR---AFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAELTDMRQRIQRMRQLFVNTLQEK----GANRDFSFIIKQNGGLTKEQVLRLREEFGVYAVASG----------------RVNVAMTPDNMAPLCEAIVAVL. 396
67 -53.9003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  12  2SWWTHVEMGPPDPILGVTEAFKRDTNS---KKMNLGVGAYRDDNGKPYVLPSVRKANLDKEYLPIGGLAEFCKASAELALGE-NNEVLKSGRQTISGTGALRVGASFLQRFFKFSRD-----VFLPKPSWGNHTPIFRDAGMQLQGYRYDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAW--AVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISQLVSNLKKEGSSHNWQHITDQIGGLKPEQVERLTKEFSVYMTKDGRISV------AGVTSGNVGYLA--HAIHQVTK....... 401
68 -53.7001vp4_A mol:protein length:425 aminotransferase, putative  ali model follow..  17  15.ISKIGQNMKSSIIREI------LKFAADKDAISFGGGVPDPETAEIAKEIIEKEYHYTLQYSTTEGDPVLKQQILKLLERMYGITGLDED-NLIFTVGSQQALDLIGKLFLDDES-----YCVLDDPAYLGAINAFRQYLANFVVVPLEDDG--MDLNVLERKLSEQVKFIYV-VSNNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVDPIFKIGGP-----ERVVLLNTFSKVLA-PGLRIGMVAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLERLEQLKPTIELYRRKRTVMLNALEEYFKWVKSEGGLFIWLTLPEGFDTWEMFEYAKRKKVFYVPGRVFKVY----DEPSPSMRLSFCPPDEKIVEGIKRLREVVL 410
69 -53.3001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  1.MFENITAAPADPILGLADLFRADERP---GKINLGIGLYYDETGKIPVLTSVKKAEQTKLYLGIDGIPEFGRCTQELLFGK-GSALINDKRARTAQTSGALRVAADFLAKNTSVKR-----VWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLR---AFAAMHKELIVASSYSKNFGLYNERVGACTL-DRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLFVNTLQEKGANRDFSFIIKQNGGLTKEQVLRLREEFGVYAVASGRVNV------AGMTPDNMAPLC--EAIVAVL........ 396
70 -52.6002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  13  1.MFENITTAPADPILGLADLLRADERP---GKIDLGMGVYNDETGKTPVLTSVKKAEQTKNYLGIDGIPEFGRCTQELLFGK-GSALINDKRARTPGGTGALRVAADFLAKNTSVKR-----VWVSNPGWPTHKSVFNSAGLEVREYAYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRA---FAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLFVNTLQEKGANRDFSFTIKQNGGLTKEQVLRLREEFGVYAVASGRLNV------AGMTPDNLAPLC--EAIVAVL........ 396
71 -52.3003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  12  1........MQPVLVFKLTADFREDPDPRGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLHEYLPILGLAEFRSCASRLALGDDS-GGVQSLGGTGALRIGADFLARWYNGTNNKNTP-----VYVSSPTWENHNAVFSAAGFKDIRSYRYWDA-LQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAW--AIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMESNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTELRARLEALKTPGTWNHITDQIGGLNPKQVEYLVNEKHIYLLPSGRINV------SGLTTKNLDYVATVTKIAENLYFQSDYKD 412
72 -52.2001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  18  19.FSEKAMLMKASEVRELLKLVET------SDVISLAGGLPAPETKKIAVEVLEEHADKALQYGTTKGFTPLRLALARWMEKR-YDIPMSKV-EIMTVAGSQQALDLIGRVFLNPGD-----PIVVEAPTYLAAIQAFKYYDPEFISIPLDDKG--MRVDLLEEKLEERVKIVYT-VSTNPAGVTMSVDRRKKLLELANEYDFLIVEDGPYSELRYSGEPTPPIKHFDDY-----GRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKMEIAKQSIDLCTNTFGQAIAWKYVENDEHIPKIIEFYKPRRDAMLEALEEYMEWTKPEGGMFVRVTLPEGIDTKLMMERAVAKGVAYVPGEAFFVH----RDKKNTMRLNFTVPEETIREGVRRLAETIK 409
73 -52.2003ez1_A mol:protein length:423 Aminotransferase MocR family  ali model follow..  16  1GMTKEASRPALDLARQAYEAFKARG-----LNLNMQRGQPAFDLSNGLLTVLGAEDLDLRNYPGVAGLPSARALFAGYLDVKAENVLVWELQGLVLTFALLHGVRGSTGPWLSQTP-----KMIVTVPGYDRHFLLLQTLGFELLTVDMQSDGPDVDAVERLAGTDPSVKGILF-VPSNPGGETISLEKARRLAGLAAAPDFTIFADDAYRVHHLVEEDRAEPVNFVVLARGYPDRAFVFASTSKITF-AGAGLGFVASSEDNIRWLSKYLGAQSIGPNKVEQARHVKFLTEEGLMRDHAAIIAPKFRAVDEVLRAELTWTLPKGGYFISLDTAEPVADRVVKLAEAA-GVSLTPAGAT---PAGQDPHNRNLRLAPTPPVEEVRTAMQVVAACIR 413
74 -52.1006d0a_A mol:protein length:431 Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial  ali model follow..  18  7.ITAASAARNPSPIRTMTDILSRGPK----SMISLAGGLPNPNMNGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHGQMDLCVTSGSQQGLCKVFEMIINPGD-----NVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSEDAKNPQKNTPKFLYT-VPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSM-----DVDGRVIRADSFSKIIS-SGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEMAHVDRVIDFYSNQKDAILAAADKLAEWHVPAAGMFLWIKVKGIDVKELIEEKAVKMGVLMLPGNAFYVD---SSAPSPYLRASFSASPEQMDVAFQVLAQLIK 422
75 -52.0003ue8_A mol:protein length:439 Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial  ali model follow..  18  7.ITAASAARNPSPIRTMTDILSRGPK----SMISLAGGLPNPNMNGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQIKLHNPPTIHGQMDLCVTSGSQQGLCKVFEMIINPGD-----NVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPDSEDAKNPQKNTPKFLYT-VPNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVPTFLSM-----DVDGRVIRADSFSKIIS-SGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHEMAHVDRVIDFYSNQKDAILAAADKLAEWHVPAAGMFLWIKVKGIDVKELIEEKAVKMGVLMLPGNAFYVD---SSAPSPYLRASFSASPEQMDVAFQVLAQLIK 422

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 4 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24