current user: public

If you have questions about the server, please let us know.

Query: 3k28_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase 2, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst MRKFDKSIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVAYNCGQGYYGVTPDLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPESYVEFERKAEMLEAGLRKAAEKHGIPHHINRAGSMIGIFFTDEPVINYDAAKSSNLQFFAAYYREMVEQGVFLPPSQFEGLFLSTVHSDADIEATIAAAEIAMSKLKALast
1 -111.0003k28_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase 2  ali model  100  1MRKFDKSIAAFEEAQDLMPGGVNSPVRAFKSVGMNPLFMERGKGSKVYDIDGNEYIDYVLSWGPLIHGHANDRVVEALKAVAERGTSFGAPTEIENKLAKLVIERVPSIEIVRMVNSGTEATMSALRLARGYTGRNKILKFIGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGVAKNTITVAYNDLESVKYAFEQFGDDIACVIVEPVAGNMGVVPPQPGFLEGLREVTEQNGALLIFDEVMTGFRVAYNCGQGYYGVTPDLTCLGKVIGGGLPVGAYGGKAEIMRQVAPSGPIYQAGTLSGNPLAMAAGYETLVQLTPESYVEFERKAEMLEAGLRKAAEKHGIPHHINRAGSMIGIFFTDEPVINYDAAKSSNLQFFAAYYREMVEQGVFLPPSQFEGLFLSTVHSDADIEATIAAAEIAMSKLKA 429
2 -110.0003bs8_A mol:protein length:438 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  80  3MRSYEKSKTAFKEAQKLMPGGVNSPVRAFKSVDMDPIFMERGKGSKIFDIDGNEYIDYVLSWGPLILGHTNDRVVESLKKVAEYGTSFGAPTEVENELAKLVIDRVPSVEIVRMVSSGTEATMSALRLARGYTGRNKILKFEGCYHGHGDSLLIKAGSGVATLGLPDSPGVPEGIAKNTITVPYNDLESVKLAFQQFGEDIAGVIVEPVAGNMGVVPPQEGFLQGLRDITEQYGSLLIFDEVMTGFRVDYNCAQGYFGVTPDLTCLGKVIGGGLPVGAYGGKAEIMEQIAPSGPIYQAGTLSGNPLAMTAGLETLKQLTPDSYKNFIKKGDRLEEGISKAAEAHGIPHTFNRAGSMIGFFFTNEPVINYETAKASDLKLFASYYKGMANEGVFLPPSQFEGLFLSTAHTDEDIENTIQAAEKVFAEISR 431
3 -108.0002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  58  6.FKTIKSDEIFAAAQKLMPGGVSSPVRAFKSVGGQPIVFDRVKDAYAWDVDGNRYIDYVGTWGPAICGHAHPEVIEALKVAMEKGTSFGAPCALENVLAEMVNDAVPSIEMVRFVNSGTEACMAVLRLMRAYTGRDKIIKFEGCYHGHADMFLVKAGSGVATLGLPSSPGVPKKTTANTLTTPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPDAGFLEGLREITLEHDALLVFDEVMTGFRIAYGGVQEKFGVTPDLTTLGKIIGGGLPVGAYGGKREIMQLVAPAGPMYQAGTLSGNPLAMTAGIKTLELLQPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMFGFFFTEGPVHNYEDAKKSDLQKFSRFHRGMLEQGIYLAPSQFEAGFTSLAHTEEDIDATLAAARTVMSAL.. 432
4 -107.0005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  53  2..AMSRSETLFNNAQKHIPGGVNSPVRAFKSVGGTPLFFKHAEGAYVLDEDDKRYVDYVGSWGPMILGHSHPDVLDAVRRQLDHGLSYGAPTALEVEMADLVCSMVPSMEMVRMVSSGTEATMSAIRLARGYTGRDSIIKFEGCYHGHSDSLLVKAGSGALTFGVPNSPGVPAAFAKHTLTLPFNDIEAVRKTLGEVGKEVACIIVEPVAGNMNCVPPAPGFLEGLREACDEHGVVLIFDEVMTGFRVALGGAQAYYGVTPDLSTFGKIIGGGMPVGAFGGKREIMQQISPLGPVYQAGTLSGNPLAMAAGLTTLRLIRPGFHDELTAYTTRMLDGLQQRADAAGIPFVTTQAGGMFGLYFSGAAIVTFEDVMASDVERFKRFFHLMLDGGVYLAPSAFEAGFTSIAHGDKELEITLNAAEKAFAALK. 429
5 -107.0002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  51  2..ERPISEAYFQEAKRHIPGGVSSPVRAFKAVGGTPPFLVRGEGAYVWDADGNRYLDYVMSWGPLILGHAHPKVLARVRETLERGLTFGAPSPLEVALAKKVKRAYPFVDLVRFVNSGTEATMSALRLARGYTGRPYIVKFRGNYHGHADGLLVEAGSGALTLGVPSSAGVPEEYAKLTLVLEYNDPEGLREVLKRRGEEIAAIIFEPVVGNAGVLVPTEDFLKALHE-AKAYGVLLIADEVMTGFRLAFGGATELLGLKPDLVTLGKILGGGLPAAAYAGRREIMEKVAPLGPVYQAGTLSGNPLAMAAGLATLELLEPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNRVGSMITVFFTEGPVVTFQDARRTDTELFKRFFHGLLDRGIYWPPSNFEAAFLSVAHREEDVEKTLEALRKAL..... 424
6 -106.0005hdm_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic  ali model follow..  56  8.FSLQKSEEAFNAAKNLMPGGVNSPVRAFKSVGGQPVLIDSVKGSKMWDIDGNEYIDYVGSWGPAIIGHADDEVLAALAETMKKGTSFGAPCLLENVLAEMVISAVPSIEMVRFVNSGTEACMGVLRLARAFTNKEKFIKFEGCYHGHANAFLVKAGSGVATLGLPDSPGVPKAATSDTLTAPYNDLEAVEKLFAAHKGEISAVILEPVVGNSGFIPPTPEFINGLRQLTKDNGVLLIFDEVMTGFRLAYGGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRRDIMEMVAPAGPMYQAGTLSGNPLAMTAGIHTLKRLQAGTYEYLDKITKELTNGILEAGKKTGHPMCGGYISGMFGFFFAEGPVYNFADSKKSDTEKFGRFFRGMLEEGVYFAPSQFEAGFTSLAHTPEDIQLTIAAAERVLSRI.. 434
7 -106.0004e77_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  55  2.NAMSKSENLYAQAQQLIPGGVNSPVRAFTGVGGIPLFIERADGAYLFDVDGKAYIDYVGSWGPMILGHNHPAIRQAVIEAVERGLSFGAPTEMEVKMAQLVTDLVPTMDMVRMVNSGTEATMSAIRLARGYTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPTDFAKHTLTCTYNDLASVRQAFEQYPQEVACIIVEPVAGNMNCIPPLPEFLPGLRALCDEFGALLIIDEVMTGFRVALAGAQDYYHVIPDLTCLGKIIGGGMPVGAFGGRREVMNALAPTGPVYQAGTLSGNPIAMAAGFACLTEIQVGVYETLTELTDSLATGLRHAAKEENIPLVVNHVGGMFGLFFTNDTVTCYQDVMNCDVERFKRFFHLMLEEGVYLAPSAFEAGFMSLAHSNEDIQKTVNAARRCFAKL.. 429
8 -105.0002cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE  ali model follow..  61  1.................MPGGVSSPVRAFKSVGGQPIVFDHVKGAHIWDVDGNQYIDYVGSWGPAIVGHAHPEVIDALHAALEKGTSFGAPCLLENILAEMVIAAVPSVEMVRFVNSGTEACMAVLRLMRAYTQREKVIKFEGCYHGHADMFLVKAGSGVATLGLPDSPGVPKATTAATLTAPYNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPDAGFLEGLRELTKQYGALLVFDEVMTGFRIAYGGAQEKFGVTPDLTTLGKVIGGGLPVGAYGGRAEIMKMVAPAGPVYQAGTLSGNPLAMTAGIKTLEILRPGSYEHLDRITGKLVQGLLDAAREFGHEVCGGHISGMFGLFFTAGPVTNYEQAKQSDLKKFAAFHRGMLEQGIYLAPSQFEAGFTSLAHTEADIERTIAAARTVLSQL.. 411
9 -105.0003l44_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1  ali model follow..  49  2VVKFTKSEALHKEALEHIVGGVNSPSRSFKAVGGAPIAMERGKGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITKAITTAAENGVLYGTPTALEVKFAKMLKEAMPALDKVRFVNSGTEAVMTTIRVARAYTGRTKIMKFAGCYHGHSDLVLVAAGSGPSTLGTPDSAGVPQSIAQEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPKPGFLEKVNELVHEAGALVIYDEVITAFRFMYGGAQDLLGVTPDLTALGKVIGGGLPIGAYGGKKEIMEQVAPLGPAYQAGTMAGNPASMASGIACLEVLQEGLYEKLDELGATLEKGILEQAAKHNIDITLNRLKGALTVYFTTNTIEDYDAAQDTDGEMFGKFFKLMLQEGVNLAPSKYEAWFLTTEHTKEDIEYTIEAVGRAFAALAD 432
10 -105.0002epj_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  42  6LASGEKSRMLFERTKELFPGGVNSPVRAAVK--PYPFYVKRGEGAYLYTVDGARIVDLVLAYGPLILGHKHPRVLEAVEEALARGWLYGAPGEAEVLLAEKILGYVKRGGMIRFVNSGTEATMTAIRLARGYTGRDLILKFDGCYHGSHDAVLVAAGSAAAHYGVPTSAGVPEAVARLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIANAGVIPPRREFLAALQRLSRESGALLILDEVVTGFRLGLEGAQGYFNIEGDIIVLGKIIGGGFPVGAVAGSREVMSLLTPQGKVFNAGTFNAHPITMAAGLATLKALEEPVYSVSREAAKALEEAASEVLDRTGLPYTINRVESMMQLFIGVEEVSNAAQARKADKKFYVKLHEEMLRRGVFIAPSNLEAVFTGLPHQGEALEIAVEGLRSSLKTVLG 433
11 -103.0004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  34  20.ADRPTNAESLDGIKSVIAGGVSSSMRAA--AVPLPLVVRSAGGCLLRDVEDGEIIDLNMGYGPHLFGYADREVLDAVADQFAKGHMTGLPHELDARAGALIAELVPGVEQVRFANSGTEAVASALRLARATTGRTLVVTFEGHYHGWSETVLRAGKTALHMEGVPGALGMIPEALAHTVQLGWNDPDALRELFARDGDRIAAVIVEPVLANAGVIPPAPGFLQLLRELTGRSGAMLVFDEVITGFRVARGGAQERYGVEPDLTVLSKVMGGGFPVAAFGGRRHAMRMLAS-NEAHHAGVYAGNHAALRAVVAMLGKIRPDLYERLEDTGQYMEDTVREVFATEKRPVHINRVGTLMSVALLKGSAEPSAEAALVDFPRHRRLQTLAQKEGVYFHPNALEPWFLSTAHTRDVIDKVAGALQRSLVGLG. 458
12 -102.0005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  35  14.EPGSAAADLFERARRVLPGGNTRTTV---YSAPYPPYAARGRGAVIVDADGEERLDFVNNYTALIHGHADPDINEAVIRQLADGVAFAMPTEHEIALAELLTERVPSLQQVRFTNSGTEAVMMAIKAARAYTGRPRIAKFDGCYHGSYDFAEVSTGEDGFPVATPYTGGTPQAVLDSVVVLPFNDIDGTERLIEQHRDELAAVLIDPNPRSLGLYPAEPAFLQRLREITRAYGIVLIFDEVIS-LRSDYGGMQSVLGVTPDLTAMGKIIGGGFPVGAVGGSAEVMSVFDPTGGAPHGGTFNANPVTMVAGLTAMRKLTPAEFDRLATLGQQLRAGVEEVLREAGVPGQVTGYGSLFHIHLHQRPLADYRNSVLSERAFVGRVHEALMGRGIFITPA--LFGCLSTPMGVPEVEAFVDAFAAALQDARG 446
13 -101.0002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  29  9.RKTEGSVFWAQRARSVMPDGVTADTRAFD---PHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMILRFEGHYHGWHDFSASGYNS---HFDGQPAPGVLPETTANTLLIRPDDIEGMREVFANHGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGFRVGNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGSDVLHQGTFTGNPITAAAAIAAIDTIEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGLPGSITRAEVARPDVKMIAAMRMALILEGVDIGGR--GSVFLSAQHEREHVEHLVTTFDRVLDRLAD 437
14 -101.0006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  29  9.RKTEGSVFWAQRARSVMPDGVTADTRVFD---PHGLFISDAQGVHKTDVDGNVYLDFFGGHGALVLGHGHPRVNAAIAEALSHGVQYAASHPLEVRWAERIVAAFPSIRKLRFTGSGTETTLLALRVARAFTGRRMILRIATHYHGWHDFSASGYNS---HFDGQPAPGVLPEIAKNTLLIRPDDIEGMREVFAQHGSDIAAFIAEPVGSHFGVTPVSDSFLREGAELARQYGALFILDEVISGFRVGNHGMQALLDVQPDLTCLAKASAGGLPGGILGGREDVMGVLSRGSDVLHQGTFTGNPITAAAAIAAIDTIEDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGFHLMPGLPGSITRAEVARPDVKMIAAMRMALILEGVDIGGR--GSVFLSAQHEREHVEHLVTTFDRVLDRLAD 437
15 -99.3002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  32  45ARDNPVSAGHHERARRSMPGGNTRSILFHR---PFPLVIAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHSHPVIRAAVERALAVGLNLSTQTENEALFAEAVCDRFPSIDLVRFTNSGTEANLMALATATAITGRKTVLAFDGGYHGGLLNFA--------------SGHAPTNAPYHVVLGVYNDVEGTADLLKRHGHDCAAILVEPMLGAGGCVPAERAFLDLLRAEASRCGALLIFDEVMTS-RLSGGGAQEMLGISADLTTLGKYIGGGMSFGAFGGRRDLMERFDPAGAFAHAGTFNNNILTMSAGHAALTQITRQAASDLSASGDRFRANLNRIAVENQAPLQFTGLGSLGTIHFSRAPIRSAGDVRAADQQLKELFFFHMLRKGIYLAPRGM--YALSLEIADAGRDAFAEALADFIGEQRA 456
16 -97.0004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  33  32TDANPASQRQFEAQARYMPGANSRSVLFYA---PFPLTIARGEGAALWDADGHRYADFIAEYTAGVYGHSAPEIRDAVIEAMQGGINLTGHNLLEGRLARLICERFPQIEQLRFTNSGTEANLMALTAALHFTGRRKIVVFSGGYHGGVLGFG--------------ARPSPTTVPFDFLVLPYNDAQTARAQIERHGPEIAVVLVEPMQGASGCIPGQPDFLQALRESATQVGALLVFDEVMTS-RLAPHGLANKLGIRSDLTTLGKYIGGGMSFGAFGGRADVMALFDPRGPLAHSGTFNNNVMTMAAGYAGLTKLTPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLMNAHFVQGDVRSSEDLAAVDGRLRQLLFFHLLNEDIYSSPRGF--VVLSLPLTDADIDRYVAAIGSFIGGHGA 442
17 -95.1005ykr_A mol:protein length:461 Probable aminotransferase  ali model follow..  27  25.ELHPRSAQAYRENRRHWLYGAPLHWMQQWP-GNCPLLVKEAQGARVTDIDGQQYVDFALGDSGAMFGHAQPAVADAIARQARRGSTLMLPTEDSLWVGAELARR-FGLPYWQVTTSATDANRFVLRLCRMLSGRDKVVVFNCNYHGSVDESQVEFDAAGRMVPRAGVHPNGVRHATTTRLVEFNDLDALEAALAH--GDVAAVLTEPFMTNVGMVPPAEGFHAGLRELTRRHDVALIIDETHT-ISCGPAGYSGAHGLEPDFFVLGKCIAGGIPSAVWGCSQAQAERIWAVLPFGFGGTLAGNALQLAAMRATFAEVTEDAYRHMFQLAAQLEAGVRATLEELRLPWHVTRIGARVEYLFMTHAPRNGGEAHHANGLIEACLHLYLLNRGVLLTPFH-NMALTCPATRAEDVELHDRLLRDCLGELLE 458
18 -86.3006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  19  2..GSSSSENLYFQGGGHMTKNSSLLAECPRDEKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLL--LSAGYHGYDPMWY--------------PSEAPLEPNADGVVDFFFDLGLLRELLR-APERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPGLSTA-ELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEV-----SFTSFFEPTILAAADAALARVTGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEE-------------ALYGAANAEGLLFYAG--DNQGVSAAFDEAVLGEAERRFARVCERLAP 389
19 -82.9006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  20  3.............KNSSLLAEFPTCPRD---EKDRPRVFTAASGAWLTDESGFRWIDFDNARGSILLGHGDPVVAEAVARAATGADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLAVREATGRPLL--LSAGYHGYDPMWY--------------PSEAPLEPNADGVVDFFFDLGLLRELLR-APERVAAVVVSPDHMH-----LSPGWYRELRRLCSAAGVVLVADEVKVGLRYAPGLSTA-ELLAPDVWVVAKGMANGHAVSAVGGSRRLLKPLKEV-----SFTSFFEPTILAAADAALARVTGEPQRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEE-------------ALYGAANAEGLLFYAG--DNQGVSAAFDEAVLGEAERRFARVCERLAP 373
20 -82.2006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  19  2..GSSSSENLYFQGGGHMDIGAGKLLAQEPTADGRPRVFVEGSGAYLTDPDGRRWIDFDNARGSVVLGHGDEEVAEAIARAARGRSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVRDARDR--SIVLSSGYHGYDPMWHCDEP------FTPNQHGI---------VEFLFDLDVLAEWL-SRPEQVAAVVISPDHMHLG-----ERWYTEFTRLTKEADVPVIADEVKVGLRYRAGLST--PLLDPAVWIVAKCLANGSPVAAVGGDAHLLAALEDV-----SFTSYFEPTAMAAATTTLRRMATEPQQAIRAAGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVAD-------------AFHAAAAAEGLLFFEG--DNQTPSAAFTDEVVEDACGRIDRVSAALTG 390
21 -55.5001sf2_A mol:protein length:426 4-aminobutyrate aminotransferase  ali model follow..  25  1...MNSNKELMQRRSQAIPRGVGQ---------IHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHPKVVAAVEAQLKKLSHTCFQYEPYLELCEIMNQKVPGAKKTLLVTTGSEAVENAVKIARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGGLMPGHVYRALYPC-ISEDDAIASIHRIFKNDPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADEVQSGARTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGG---LGGTYAGNPIACVAALEVLKVFQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELFED-----GDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRIL-EDAQIRQGLEIISQCFDEAK. 425
22 -54.4004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  25  25....PKSQALAERRSAVVAAGVASG---------VPVYVEDADGGIIRDVDGNSFIDLGSGIAVTSVGASDPAVVAAVQEAAAHTCFMVTPYEGYVAVTEQLNRLTPGAKRTVLFNSGAEAVENAVKVARLATGRDAVVAFDHAYHGRTNLTMALTAKAMPYKT-PFAPEVYRMPMSYPFREENPEAKRAITMIEKQGDQVAAIIIEPIQGEGGFIVPAEGFLPALSEWAKEKGIVFIADEVQSGFRTGEWFAVDHEGVVPDIITMAKGIAGGLPLSAITGRADLLDAVHPGG---LGGTYGGNPVACAAALAAIDTMQHDLNGRARHIEELALGKLRELAAEGSVVGDIRGRGAMLAIELVQP------GSKEPNAELTKAVAAACLKEGVIILTCGTYGNVIRLL-SDELLIDGLEVLAAAIKAH.. 455
23 -54.0001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  21  2..SLNDDATFWRNARQHLVRYGGT----------EPMIIERAKGSFVYDADGRAILDFTSGQMSAVLGHCHPEIVSVIGEYAGK-LFSGMLSRPVVDLATRLANITPPLDRALLLSTGAESNEAAIRMAKLVTGKYEIVGFAQSWHGMTGAAASATYSAGRKGVGPAAVGSFAIPAPFTYRPRFERLDYAFDLIDRQSGNLAAFIAEPILSSGGIIELPDGYMAALKRKCEARGMLLILDEAQTGVRTGTMFACQRDGVTPDILTLSKTLGAGLPLAAIVTSAAIEERAHELG-YLFYTTHVSDPLPAAVGLRVLDVVQRDLVARANVMGDRLRRGLLDLMERFDCIGDVRGRGLLLGVEIVKD-----RRTKEPADGLGAKITRECMNLGLSMNIVQLPGM--PLTVSEDEIDLGLSLLGQAIERA.. 432
24 -53.8005g4i_A mol:protein length:446 PHOSPHOLYASE  ali model follow..  21  14....QTANDLLARRYATIGPHSPLFYR-------QPLELVSGSGVWLTDAQGKVYLDGYN--NVPHVGHANPAVADAIYQQLLTNLHTRYLNSRVVEYAEALLSKFDGLERLFLTNSGSEANELALRIARQHTGNTGVLVSDFSYHGNTTSLAEITTAHVRALRIPDVSGIAEVDVPVLLEQSLADVDAAIASLQAAGHGVSVFLFDPLFSTEGLLQLPSGYIEGVATRVRAAGGLVISDEVQSGFRTGSG-GYQMFNVEPELVTMGKPMGNGHPIGAVVTTAELLDEFGRHNM--FFNTFAGNPVSSAAGLAVLRYMDQELMAKADQLGKYIRKRLENIAQRSGNVGSVRGRGLFFGIDIIES-----DGSRNPAPALTKILIEDMRERGVLISRVGPHDNVLKMR-GREHADILLGQLELSLASLPQ 440
25 -53.6005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  23  3MSETKNSEYFIELEEKHGAHN----------YHPLPVVLDRGEGVFVWDVEGKKYYDFLSAYSAVNQGHSHPKIVEALVEQASKLALTSRANSKLGEYEQKITS-LLGFDKVLPMNSGAEAVETAVKLARKWENAAKIIVCENNFHGRTTTIVSFSNDPDANQNYPFTPGF--------IRIPYNDIAALEEVLSKEAGNIAAFLVEPIQGEAGVYVPNEGFLKQSSELCKKHNVLFIADEVQTGIRTGKLIACHHEDVQPDILILGKALSGGMPVSAVLANNNIMDVIKPGQ---HGSTFGGNPLACAVAMAALDVVDEKLSERAEKLGNLFRSEIEKLIEKTDLITKVRGKGLLNAILINDTP----------DSSTAWNLCLALKENGLLAKPTHGNIIRLALVITEEQLLDCVKIIEKTILEF.. 413
26 -53.5003q8n_A mol:protein length:453 4-aminobutyrate transaminase  ali model follow..  24  29....PISQELQARKQSAVAAGVGVT---------LPVYVVAAGGGVLADADGNQLIDFGSGIAVTTVGNSAPAVVDAVTQQVAA-CFMVTPYEGYVKVAEHLNRLTPGEKRTALFNSGAEAVENAVKIARAYTRRQAVVVFDHAYHGRTNLTMAMTAKNQPYKH-PFANEVYRVPTSYPFRDGETDAHALDLINKQGADNVAAVVIEPVHGEGGFVVPAPGFLGALQKWCTDNGAVFVADEVQTGFRTGALFACEHENVVPDLIVTAKGIAGGLPLSAVTGRAEIMDGPQSGG---LGGTYGGNPLACAAALAVIDTIRENLVARARAIGETMLSRLGALAAADPRIGEVRGRGAMIAVELVKP------GTTEPDADLTKRVAAAAHAQGLVVLTCGTYGNVLRFL-PDHLLDEGLDILAAVFAEVK. 453
27 -53.4005g09_A mol:protein length:483 TRANSAMINASE  ali model follow..  23  9.....NWEQVKEWDRKYLMRTFSTQNEY------QPVPIESTEGDYLIMPDGTRLLDFFNQLYCVNLGQKNQKVNAAIKEALDR-VWDTYATDYKAKAAKIIIEDILGPGKVRFVSTGSEAVETALNIARLYTNRPLVVTREHDYHGWTGGAATVTRLRSYRSGLSYNSAVLMAPSPNMFQDSDGNVKYTRRMIENYGEQVAAVITEVSQGAGSAMPP-YEYIPQIRKMTKELGVLWINDEVLTGFRTGKWFGYQHYGVQPDIITMGKGLSSSLPAGAVLVSKEIAAFMD-KHRWESVSTYAGHPVAMAAVCANLEVMMEEFVEQAKDSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKTKNFTHGMNPNQIPTQIIMKKALEKGVLIGGVMPNTMRIGLNVSRGDIDKAMDALDYALDYLES 470
28 -53.3004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  22  17....DKASKLIDEENKYYARSARINY--------YNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQK-TPAYFHHVPGMELSEKLAKIAPGPKMVSFGNSGSDANDAIIKFARAYTGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTR-PMLPSVVHVPYPDSYRTYPGEFNEFKKPFESFADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLRTGK-AIQQFKDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLDAPA---HLFTTAGNPVCSAASLATLDVIEYELVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKD-----PKTKEPDSDAATKVIYYAFAHGVVIITLAGNILRFQLVIPREQLDQALQVLDDAFTAVEN 448
29 -53.2005g2p_A mol:protein length:485 TRANSAMINASE  ali model follow..  23  6..QKINWEQVKEWDRKYLMRTFSTQNEY------QPVPIESTEGDYLITPGGTRLLDFFNQLCCVNLGQKNQKVNAAIKEALDR-VWDTYATDYKAKAAKIIIEDILGPGKVRFVSTGSEAVETALNIARLYTNRPLVVTREHDYHGWTGGAATVTRLRSFRSGLSCSSAVLMAPSSNTFQDSNGNVKYTRRMIENYGEQVAAVITEVSQGVGSTMPP-YEYVPQIRKMTKELGVLWISDEVLTGFRTGKWFGYQHYGVQPDIITMGKGLSSSLPAGAVVVSKEIAAFMD-KHRWESVSTYAGHPVAMAAVCANLEVMMEELVEQAKNSGEYIRSKLELLQEKHKSIGNFDGYGLLWIVDIVNAKTKNFRHGMNPNQIPTQIIMEKALEKGVLIGGAMPNTMRIGLNVSRGDIDKAMDALDYALDYLES 470
30 -53.2003oks_A mol:protein length:451 4-aminobutyrate transaminase  ali model follow..  22  22....PRSQALIDRKGTAVARGVGT---------TMPVYAVRAGGGIVEDVDGNRLIDLGSGIAVTTVGNSAPKVVEAVRSQVGD-CFMVTPYEGYVAVCEQLNRLTPVDKRSALFNSGSEAVENAVKIARSHTHKPAVVAFDHAYHGRTNLTMALTAKVMPYKD--------GPFAPEIYRAPLSYAKRAITVIDKQADNLAAVVIEPIQGEGGFIVPADGFLPTLLDWCRKNDVVFIADEVQTGFRTGAMFACEHEGIDPDLIVTAKGIAGGLPLSAVTGRAEIMDSPHVSG---LGGTYGGNPIACAAALATIETISEGLVARAQQIEKIMKDRLGRLQAEDDRIGDVRGRGAMIAMELVKA------GTTEPDADLTKALCAGAHAAGVIVLSCGTYGNVVRFL-GDDLLNEGLDVLEEVLRG... 450
31 -52.9004ffc_A mol:protein length:453 4-aminobutyrate aminotransferase (GabT)  ali model follow..  24  25....PRSGALAERRRAAVSAGVGST---------APVYAVDADGGVIVDADGNSFIDLGAGIAVTTVGASHPAVAAAIADQATHTCFMVTPYEQYVQVAELLNALTPGDKRTALFNSGAEAVENAIKVARLATGRPAVVAFDNAYHGRTNLTMALTAKSMPYKS-PFAPEVYRMPASYPLRDEPG-ISRIETQIG--AQSLAAIIIEPIQGEGGFIVPAPGFLATLTAWASENGVVFIADEVQTGFRTGAWFASEHEGIVPDIVTMAKGIAGGMPLSAVTGRAELMDAVYAGG---LGGTYGGNPVTCAAAVAALGVMELDLPARARAIEASVTSRLSALAEEVDIIGEVRGRGAMLAIEIVKP------GTLEPDAALTKSIAAEALSQGVLILTCGTFGNVIRLL-GDDLLDEGITALSDIIRAKAS 451
32 -52.6004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  24  32....KTEEDFFACDRQYV----------CQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRANDVTGPACRFMAE-MFGYDRVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFPFTPGF--------ELIDYDDVGALEEALKD--PNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKPGT---HGSTFGGNPLACAVAVEALTVLDEKLADRAERLGAQFRDCLRRELYGKPWIKEIRGRGLLNAVEVDS------------DAIDPNDVVMKLKENGILSKPTRGRVMRFPLVITDEEHRDATTRIIKSFLAVEE 437
33 -52.6003r4t_A mol:protein length:467 4-aminobutyrate aminotransferase GabT  ali model follow..  22  33....PASLELNKRRAAAVSGGVGVT---------LPVFVVRAGGGIVEDADGNRLIDLGSGIAVTTIGNSAPRVVDAVRDQVEQTCFMVTPYEQYVAVAEQLNRITPGEKRTVLFNSGAEAVENSIKVARAHTRKQAVVAFDYAYHGRTNLTMALTAKSMPYKS-PFAPEIYRAPVSYPYRDNLLDAERAINLIDKQAANLAAVIIEPIAGEGGFIVPADGFLPALQRWCRDNDVVFIADEVQTGFRTGAMFACDHENVEPDLIVTAKGIADGFPLSAVTGRAEIMDAPHTSG---LGGTFGGNPVACAAALATIETIRDGMVERARQIERLVMDRLLRLQAADDRLGDVRGRGAMIAMELVKS------GTAEPDAALTQKLAAAAHAAGVIVLTCGMFGNVIRLL-SDELLSEGLDILCQILAD... 461
34 -52.5004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  25  33....ALNREVIEYFKEHVNPGFLEYRKSVTAGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEDPLRAMLAKTLAALTPGLKYSFFCNSGTESVEAALKLAKAYQGKFTFIATSGAFHGKSLGALSATAKSTFRKPF-------MPLLPGFRHVPFGNIEAMRTALNECGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMRTGKMFACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLFDNPFL-HTTTFGGNPLACAAALATINVLEQNLPAQAEQKGDMLLDGFRQLAREYDLVQEARGKGMLMAIEFVDNEIG-------------YNFASEMFRQRVLVAGTLNNAKTIRIE-TIEQCELVIKAARKALAAMRV 454
35 -52.4004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  22  385IAQTPAREDTLDRYHQYI----NPMMVDFLKLQRCDNVFRSAAGTQLYDDAGEAFLDMVAGYGCLNLGHNPQPVVNALKNYLDA-IQYISIPEQTAKLAEVLCRLAPGMGRVFFSNSGTEAVEAAMKIAKASTGKPGIAYLRNSYHGKTLGALSITGRDKHRRYF-------TPLLDAMVEVPFGDLAALREALNR--EDVGALMIEPIQGEGGVHIPPAGYLQAVQQLCRETGVLLMVDEVQTGLRTGKLFACEWDGIEPDVLMLSKSLSGGLPIGATLCRADLWQKAYGTRFLVHSSTYGGGNLASVVALSALREIAQDLVGHAERMGAYFKQALSEIAARYPFVSEVRGRGLMLGIQFDQAFTGA--------------VNASAREFATRLPGDWHTTWKFLPDPVQAHLRAAMDRMEQALGEMFC 796
36 -52.3001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  24  38....PTSDDIFEREYKYGAHN----------YHPLPVALERGKGIYLWDVEGRKYFDFLSSYSAVNQGHCHPKIVNALKSQVDKLTLTSRANNVLGEYEEYITK-LFNYHKVLPMNTGVEAGETACKLARKWKYKAKIVFAAGNFWGRTLSAISSSTDPTSYDGFPFMPGF--------DIIPYNDLPALERALQD--PNVAAFMVEPIQGEAGVVVPDPGYLMGVRELCTRHQVLFIADEIQTGLRTGRWLAVDYENVRPDIVLLGKALSGGLPVSAVLCDDDIMLTIKPGE---HGSTYGGNPLGCRVAIAALEVLEENLAENADKLGIILRNELMKL--PSDVVTAVRGKGLLNAIVIKETKDWDAWK-----------VCLRLRDNGLLAKPTHGDIIRFPLVIKEDELRESIEIINKTILSF.. 439
37 -52.3001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  20  17VKDLKTPEDYINNELKYG----------AHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAYSSVNQGHCHPNILNAMINQAKNLTICSRASVPLGICERYLTN-LLGYDKVLMMNTGAEANETAYKLCRKWENMAKIVVCKNNFSGRTLGCISASTTKKCTSNFPFAPQF--------SKVPYDDLEALEEELKD--PNVCAFIVEPIQGEAGVIVPSDNYLQGVYDICKKYNVLFVADEVQTGLRTGKLLCVHHYNVKPDVILLGKALSGGYPISAVLANDDIMLVIKPGE---HGSTYGGNPLAASICVEALNVLNEKLCENAEKLGGPFLENLKRELKDSKIVRDVRGKGLLCAIEFKN------------ELVNVLDICLKLKENGLITRDVHDKTIRLPLCITKEQLDECTEIIVKTVKFFDE 425
38 -52.2003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  23  10....HMTKALYDRDGAAIGNLQKLRF--------FPLAISGGRGARLIEENGRELIDLSGAWGAASLGYGHPAIVAAVSAAAANATILSASNAPAVTLAERLLASFPGTHKIWFGHSGSDANEAAYRAIVKATGRSGVIAFAGAYHGCTVGSMAFSGHSVQADA-AKADGLILLPYPDPYRPYRNDLTLLTEKLAAPAGSIGAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGILVVCDEVKVGLRSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAF----AMQTLHGNPISAAAGLAVLETIDRDLPAMAERKGRLLRDGLSELAKRHPLIGDIRGRGLACGMELVCD-----RQSREPARAETAKLIYRAYQLGLVVYYVGMNGNVLEFT-TETDIHKALDLLDRAFSELSA 434
39 -52.2005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  22  29....DKASKLIDEENKYYARSARINY--------YNLVIDHAHGATLVDVDGNKYIDLLASASAINVGHTHEKVVKAIADQAQK-TPAYFHHVPGMELSEKLAKIAPGPKMVSFGNSGSDANDAIIKFARAYTGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTR-PMLPSVVHVPYPDSYRTYPGEFNEFKKPFESFADETACVLIEPIQGDGGIIKAPEEYMQLVYKFCHEHGILFAIDEVNQGLRTGK-AIQQFKDIEPDLMSVGKSLASGMPLSAVIGKKEVMQSLDAPA---HLFTTAGNPVCSAASLATLDVIEYELVEKSATDGAYAKQRFLEMQQRHPMIGDVRMWGLNGGIELVKD-----PKTKEPDSDAATKVIYYAFAHGVVIITLAGNILRFQLVIPREQLDQALQVLDDAFTAVEN 460
40 -52.1005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  25  31....ALNREVIEYFKEHVNPGFLEYRKSVTAGDYGAVEWQAGSLNTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQEDPLRAMLAKTLAALTPGLKYSFFCNSGTESVEAALKLAKAYQGKFTFIATSGAFHGKSLGALSATAKSTFRKPF-------MPLLPGFRHVPFGNIEAMRTALNECGDDVAAVILEPIQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMRTGKMFACEHENVQPDILCLAKALGGGMPIGATIATEEVFSVLFDNPFL-HTTTFGGNPLACAAALATINVLEQNLPAQAEQKGDMLLDGFRQLAREYDLVQEARGKGMLMAIEFVDNEIG-------------YNFASEMFRQRVLVAGTLNNAKTIRIE-TIEQCELVIKAARKALAAMRQ 452
41 -52.1005m46_A mol:protein length:440 Aminotransferase class-III  ali model follow..  23  4....AMAGNLYGRDGAAIGSLQKLRF--------FPLAVAGGQGARLVEEDGRELIDLSGAWGAASLGYGHPAIIEAVSRAAANASILSASNAPAVALAERLTASFPGTHKVWFGHSGSDANEAAYRAITRATGRTGVIAFIGAYHGCTVGSMAFSGHSVQADA-AKADGLILLPYPDPYRPYQDDLALLKERLAAPAGSIAAAFIEPIQSDGGLIVPPDGFLRKFADICRAHGISVVCDEVKVGLRSGRLHCFEHEGFVPDILVLGKGLGGGLPLSAVIAPAEILDCASAF----AMQTLHGNPVCAAAGLAVLETIEAELTTAAERKGKLLREGLARLAERHELIGDIRGRGLACGVELVRN-----RQSREPARAETAKLIYRAYELGLVLYYVGMNGNVLEMT-TEDEVRHAVNLLDQAFTELST 428
42 -52.1004jev_A mol:protein length:422 Acetylornithine/succinyldiaminopimelate aminotransferase  ali model follow..  29  13....EQTAITRATFDEVI----------LPVYAPADFIPVKGKGSRVWDQQGKEYIDFAGGIAVTALGHCHPALVEALKSQGETLWHTS--NEPALRLGRKLID-ATFAERVLFMNSGTEANETAFKLARHYPFKTKIIAFHNAFHGRSLFTVSVGGQPKYSDGFPKPADI--------IHVPFNDLHAVKAVMD---DHTCAVVVEPIQGEGGVQAATPEFLKGLRDLCDEHQALLVFDEVQCGMRTGDLFAYMHYGVTPDILTSAKALGGGFPVSAMLTTQEIASAFHVGS---HGSTYGGNPLACAVAGATFDIITPEVLQGIHTKRQQFVQHLQAIDEQFDIFSDIRGMGLLIGAELKPKYKGRARD-----------FLYAGAEAGVMVLNAGADVMRFSLVVEEADIHEGMQRFAQAVGKVVA 414
43 -52.1004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  24  17....KTEEDFFACDRQYV----------CQNYAPVPVVISKGKGARVWDINGNEYYDFLAGVSSLSQGHCHPRVIAALCRQAERLTLTLRANDVTGPACRFMAE-MFGYDRVLLMNTGAEAGESALKIARKWPDSAKVILCNNNYWGRTITACSSSTTFDCYNNFPFTPGF--------ELIDYDDVGALEEALKD--PNVAAFFVEPIQGEGGVNVPKPGYLKRAHELCRSKNVLLIVDEIQTGLRTGRLLAADHDEVHPDILLLGKSLSAGVPISAVMGRADVMDVLKPGT---HGSTFGGNPLACAVAVEALTVLDEKLADRAERLGAQFRDCLRRELYGKPWIKEIRGRGLLNAVEVDS------------DAIDPNDVVMKLKENGILSKPTRGRVMRFPLVITDEEHRDATTRIIKSFLAVEE 422
44 -51.9005ti8_A mol:protein length:474 Aminotransferase  ali model follow..  20  49...................................ARIITKAEGVYLWDSEGNKILDGMAGLWCMNVGYGRKELAEVAYKQMLENLFFQTAHPPALELAKAIADIAPGMNHVFFTGSGSESNDTVLRMVRHYPQKKVVIGRWNGYHGTVAGVSLGGMKALHSQGDLPIPGIVHIAQPYWYGEGGDMAEQLEKKILEVGEEVAAFIAEPIQGAGGVIVPPDTYWPKIREILAKYEILFIADEVICGFRTGEWFGSQYYGNAPDLMPIAKGLTSGYPMGGVIVRDEIVDTLNEGGEFYHGFTYSGHPVAAAVALENIRILREEIVETVKAETAPYLQKRWQELADHPLVGEARGVGMVGALEL----VKNKKTRERFENGVGMLCREHCFRNGLIMRAVGDTMIISPLVITKPEIDELITLARKCLDQTAA 464
45 -51.8003lg0_A mol:protein length:422 Ornithine aminotransferase  ali model follow..  20  4VKELKSSQDYMNNELTYG----------AHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRASDSLGVCERYLTN-LFGYDKVLMMNTGAEASETAYKLCRKWENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFPFVPNF--------LKVPYDDLEALEKELQD--PNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLRTGKLLCTHHYGVKPDVILLGKALSGGYPISAILANDDVMLVLKPGE---HGSTYGGNPLAAAICVEALKVLNEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKN------------DLVNVWDICLKFKENGLITRSVHDKTVRLPLCITKEQLDECTEIIVKTVKFFDD 412
46 -51.8001vef_A mol:protein length:395 Acetylornithine/acetyl-lysine aminotransferase  ali model follow..  29  7....EDWRALLEAEKTLD----------SGVYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQPTPMRGEFYRTLTAILPPLNRVFPVNSGTEANEAALKFARAHTGRKKFVAAMRGFSGRTMGSLSVTWEPKYREPF-------LPLVEPVEFIPYNDVEALKRAVD---EETAAVILEPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAVMREEVARSMPKGG---HGTTFGGNPLAMAAGVAAIRYLRTRLWERAAELGPWFMEKLRAIPSPK---REVRGMGLMVGLELKEKAA--------------PYIARLEKEHRVLALQAGPTVIRFPLVIEKEDLERVVEAVRAVLA.... 395
47 -51.4004adb_A mol:protein length:406 SUCCINYLORNITHINE TRANSAMINASE  ali model follow..  28  18...............................YAPAPFIPVRGEGSRLWDQQGKEYIDFAGGIAVNALGHAHPELREALNEQASKFWHTGN-NEPVLRLAKKLID-ATFADRVFFCNSGAEANEAALKLARKFSHKSGIVAFKNAFHGRTLFTVSAGGQPAYSQDFPLPADI--------RHAAYNDINSASALID---DSTCAVIVEPIQGEGGVVPASNAFLQGLRELCNRHNALLIFDEVQTGVRTGELYAYMHYGVTPDLLTTAKALGGGFPVGALLATEECARVMTVGT---HGTTYGGNPLASAVAGKVLELITPEMLNGVKQRHDWFVERLNTINHRYGLFSEVRGLGLLIGCVLNADYAGQAKQISQE-----------AAKAGVMVLIAGGNVVRFALNVSEEEVTTGLDRFAAACEHFVS 402
48 -51.3003hmu_A mol:protein length:472 Aminotransferase, class III  ali model follow..  20  38...................................TRVITRARGVWLNDSEGEEILDAMAGLWCVNIGYGRDELAEVAARQMRENTFFKTTHVPAIALAQKLAELAPGLNHVFFAGGGSEANDTNIRMVRTYPEKTVIISRKNAYHGSTVASSALGGMAGMHAQSGLIPDVHHINQPNWWAEGGDMARELEEAILELGENVAAFIAEPVQGAGGVIVAPDSYWPEIQRICDKYDILLIADEVICGFRTGNWFGTQTMGIRPHIMTIAKGLSSGYPIGGSIVCDEVAHVIG-KDEFNHGYTYSGHPVAAAVALENLRILEEEILDHVRNVAAPYLKEKWEALTDHPLVGEAKIVGMMASIALTPNKASR-AKFASEPGTIGYICRERCFANNLIMRHVGDRMIISPLVITPAEIDEMFVRIRKSLDEAQA 454
49 -50.7003n5m_A mol:protein length:452 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  22  32...................................TTVGAKAEGCWVEDIQGKRYLDGMSGLWCVNSGYGRKELAEAAYKQLQT-FPMSQSHEPAIKLAEKLNEWLGGEYVIFFSNSGSEANETAFKIARQYYHRYKFMSRYRGYHGNTMATMAATGQAQRRYQYPFASGFLHVTPPDCYRMPGIEVKEVDRVMTWELETIAAFIMEPIITGGGILMAPQDYMKAVHETCQKHGALLISDEVICGFRTGKAFGFMNYDVKPDIITMAKGITSAYPLSATAVKREIYEAFKGKGEFRHINTFGGNPAACALALKNLEIIENELIERSAQMGSLLLEQLKEEIGEHPLVGDIRGKGLLVGIEL----VNDKETKEPIDNDKIASVVNACKEKGLIIGRNGMTTAGYNLVISSEEIAFVIGTLKTAMERI.. 452
50 -50.6005kr5_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  22  16....TSLEQLLEMDRAHF-----THAYDHASGALPGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGREEVADAIYEQAKQHTYVGHSNDPVIELSSRIIEDWAGMKKVFYGMSGSDANETQIKLVWYYNNKKKIIARERSYHGSGIVTGSLTGLPSFHQHFLPIDRVKHTVCPHWYNAPPGMVEELEKLIAREGDTIAAFIAEPVMGTGGIVPPPQGYWEAIQAVLRKHDILLIADEVVCGFRLGSKTGSEHYGIKPDLITVAKGLTSAYPLSAVIVSEKVWDVIEKGGVMGHGWTYSGHPVCAAAALANLDILERELTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMAD--KGARTPFDPALKVSQKVAAAALEDGLIVRALPHGDILGPLVTTRAEVDEIVAIAKEAFDEVAD 470
51 -50.6004a6r_A mol:protein length:459 OMEGA TRANSAMINASE  ali model follow..  18  1MQKQRTTSQWRELDAAHH---LHPFTDTASLNQAGARVMTRGEGVYLWDSEGNKIIDGMAGLWCVNVGYGRKDFAEAARRQMEENTFFKTTHPAVVELSSLLAEVTPGFDRVFYTNSGSESVDTMIRMVRRYPEKKTLIGRWNGYHGSTIGGASLGGMKYMHEQGLPIPGMAHIEQPWWYKHGKDMARWLEEKILEIGDKVAAFVGEPIQGAGGVIVPPATYWPEIERICRKYDVLLVADEVICGFRTGEWFGHQHFGFQPDLFTAAKGLSSGYPIGAVFVGKRVAEGLIAGGDFNHGFTYSGHPVCAAVAHANVAALRDEVQRVKDDIGPYMQKRWRETFSRFEHVDDVRGVGMVQAFTLVKNKAK--RELFPDFGEIGTLCRDIFFRNNLIMRACGDHIVSAPLVMTRAEVDEMLAVAERCLEEFEQ 451
52 -50.4005kqu_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  20  16....TDFDQLFEQDRAHF-----THAHDHASGALPGRIITGASGIRIRDHEGRELIDAFAGLYCVNIGYGRTEVADAIYKQAKEHTYVGHSTEAIIELSSRIIRDWAGMKKVYYGLSGSDANETQIKLVRYYNQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFLPVEGIKHTVCPHWYKAPAGMADELEKLILAEGDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLNKYDVLLIADEVVCAFRLGSKMGSQRYGMRPDLITTAKGLTSAYPLSAVIVGEKVWDVIEKAGAMGHGWTYSGHPICAAAALANLDILERELTANAADVGAYLNQRLRETFEGHPLVGEVRGDGMLAALEFMADREA--RTPFDPALKVGPKVSAACLEDGMIARAMPHGDILGPLVLTRAEADEIVGIAKAAVDEVAG 470
53 -50.3005kr4_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  21  16....TSLDQLFEEDRAHF-----THAHDHASGALPGKIVTGGKGIRIEDHQGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQHTYVGHSTDAIIELSSRIIRDWAGMKKVYYGMSGSDANETQIKIVWYYNNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFLPIDRVKHTVCPHWYKAPAGMVEELEKLIAREGDTIAAFIAEPVMGTGGIIAPPQGYWEAIQAVLRKHDILLISDEVVCGFRLGSKMGAQHYGIKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGGPMGHGWTYSGHPICAAAALANLDILERELTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMAD--KDARTPFDPALKVGPKVSAAALEDGVIARAMPHGDILGPLVTTRAEVDEIVGIVKQAVDEVAD 470
54 -50.2005kqw_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  21  16....TDLDQLFEMDRAHF-----THAHDHASGALPGRIITGGKGIRIQDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKEHTYVGHSTEAIIELSSRIIRDWAGMKKVYYGMSGSDANETQIKLVWYYNQKKKIISRQRGYHGSGIMTGSLTGLPSFHQHFLPIERIKHTVCPHWYKAPAGMADELEKLILAEGDTVAAFIGEPVMGTGGIIPPPQGYWEAIQAVLNKYDILLIADEVVCGFRLGSKMGSQHYGMKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGGPMGHGWTYSGHPICAAAALANLDILERELTGNAADVGAYLQQRLRETFGGHPLVGEVRGVGMLAALEFMAD--KDARTPFDPALKVGPKVSAACLEDGMIARAMPHGDILGPLVITRAEVDEIVGIAKQAVDEVAD 470
55 -50.2004e3r_A mol:protein length:473 Pyruvate transaminase  ali model follow..  21  44...................................TVVVTHGEGPYIVDVNGRRYLDANSGLFNMVAGFDHKGLIDAAKAQYERHAAFGKMSDQTVMLSEKLVEVSPFSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGATAVSASMTGFPYNSVFGLPLPGFVHLTCPHYWRYGEEGARELEETIQREGDTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVVCGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAEEFPHGFTASGHPVGCAIALKAIDVVMNELAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKDKAS--KTPFDGNLSVSERIANTCTDLGLICFPLGQSVVLCPFILTEAQMDEMFDKLEKALDKVFA 464
56 -50.2003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  20  15...............................YKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGVCALGYNHAKFNAKIKAQVDKLLHTSN-NENIAAAAKNLAK-ASALERVFFTNSGTESIEGAMKTARKYAKGGQFIAFKHSFHGRTLGALSLTANEKYQKPF-------KPLISGVKFAKYNDISSVEKLVN---EKTCAIILESVQGEGGINPANKDFYKALRKLCDEKDILLIADEIQCGMRSGKFFAYEHAQILPDIMTSAKALGCGLSVGAFVINQKVASNSLEAGD--HGSTYGGNPLVCAGVNAVFEIFEEKILENVNKLTPYLEQSLDELINEFDFCKKRKGLGFMQGLSLDKS-------------VKVAKVIQKCQENALLLISCGENDLRFPLILQKEHIDEMSEKLRKALKSF.. 395
57 -50.1005kr3_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  21  16....QSLDQLFEMDRAHF-----THAHDHASGALPGRIITGGKGIRIEDHEGREYIDAFAGLYCVNIGYGRTEVADAIYEQAKQHTYVGHSTDAIIELSSRIIRDWAGMKKVYYGMSGSDANETQIKLVWYYNNKKKIISRERGYHGSGIVTGSLTGLPSFHQHFLPIDRVKHTVCPHWYRAPAGMVEELEKLIAREGDTIAAFIAEPVMGTGGIIPPPQGYWEAIQAVLRKHDILLIADEVVCGFRLGSKMGSQHYGIKPDLITVAKGLTSAYPLSGVIVGEKVWDVIEKGGPMGHGWTYSGHPICAAAALANLDILERELTGNAADVGAYLQQRLHEAFGAHPLVGEVRGVGMLAALEFMAD--KDARTPFDPALKVGPKVSAAALEDGMIARAMPHGDILGPLVTTRAEVDEIVGIAKQAVDEVAD 470
58 -50.0005kqt_A mol:protein length:479 4-aminoburyrate transaminase  ali model follow..  20  16....TDYAKLFEQDRAHF-----THAHDHASGALPGRIITGASGVRIRDHQGRELLDAFAGLYCVNIGYGRLEVADAIHEQAKQHTYVGHASEAIIELSARIIRDWAGMKKVYYGLSGSDANETQVKLVRYYNQKKKIISRQRGYHGSGIVTGSLTGLASFHQHFLPVEGVKHTLCPHFYKAPAGMAQELENLILAEGDTVAAFIGEPVMGTGGIIVPPKGYWEAIQAVLAKYDVLLIADEVVCAFRLGDKMGSQRHAMRPDLITTAKGLTSAYPLSAVIVGEKVWDVIDSAGAMGHGWTYSGHPICAAAALANLDILEREITANAADVGGYLNQQLRQAFEGHPLVGEVRGDGMLAALEFMAD--REARTPFDAALKVGPKVSAACLERGMIARAMPHGDILGPLVLSRAEADEVVGIAKAAVDAVAA 470
59 -50.0005kr6_A mol:protein length:479 4-aminobutyrate transaminase  ali model follow..  20  16....TDTDDLLEMDRAHF-----THLRDHASGELPGRIITGGKGIRIQDSEGREYIDAFAGLYCVNVGYGRTEIADAIYEQAKEHTYVGHSNEPIIELSERIIREWAGMSKVYYGMSGSDANETQIKLVWYYNQKKKIISRQRGYHGSGIMTGSLTGLPAFHNHFLPLEPIRHTTCPHYYRAPAGMADELEKMILAEGDTVAAFIGEPVMGTGGIVPPPEGYWEAIQAVLNKYDILLIADEVVCGFRTGSMFGSHHYGMKPDLITVAKGLTSAYPLSGVIVGEKVWKVLEQGGPIGHGWTYSGHPICAAAALANLDIIERELTGNAADTGAYFQQRMRETFGDHPLVGEVRGVGLMAALEFVAD--KDKRTRFDPSLKVGPRVSAACLEDGMIARAMPHGDILGPLVITRAEVDEIVDIAKQAVDAVAD 470
60 -49.9004e3q_A mol:protein length:473 Pyruvate transaminase  ali model follow..  21  44...................................TVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERHAFFGRMSDQTVMLSEKLVEVSPDSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSVFGLPLPGFVHLTCPHYWRYGEEGARELEETIQREGADIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAEEFPHGFTASGHPVGCAIALKAIDVVMNELAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKDKAS--KTPFDGNLSVSERIANTCTDLGLICRPLGQSVVLCPFILTEAQMDEMFDKLEKALDKVFA 464
61 -49.9004grx_A mol:protein length:465 Aminotransferase  ali model follow..  21  42...................................TVVVTHGEGPYIVDVHGRRYLDANSGLWNMVAGFDHKGLIEAAKAQYDRHAFFGRMSDQTVMLSEKLVEVSPDNGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSVFGLPLPGFIHLTCPHYWRYGEEGARELEDTITREGADIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPMISDEVICGFRTGNTWGCLTYDFMPDAIISSKNLTAGFPMGAVILGPDLAKRVEAAEEFPHGFTASGHPVGCAIALKAIDVVMNELAENVRRLAPRFEAGLKR-IADRPNIGEYRGIGFMWALEAVKDKPT--KTPFDANLSVSERIANTCTDLGLICRPLGQSIVLCPFILTEAQMDEMFEKLEKALDKVFA 462
62 -49.9003nui_A mol:protein length:478 Pyruvate transaminase  ali model follow..  21  44...................................TVVVTHGEGPYIVDVNGRRYLDANSGLWNMVAGFDHKGLIDAAKAQYERHAFFGRMSDQTVMLSEKLVEVSPDSGRVFYTNSGSEANDTMVKMLWFLPQKRKILTRWNAYHGVTAVSASMTGKPYNSVFGLPLPGFVHLTCPHYWRYGEEGARELEETIQREGDTIAGFFAEPVMGAGGVIPPAKGYFQAILPILRKYDIPVISDEVICGFRTGNTWGCVTYDFTPDAIISSKNLTAGFPMGAVILGPELSKRLETAEEFPHGFTASGHPVGCAIALKAIDVVMNELAENVRRLAPRFEERLKH-IAERPNIGEYRGIGFMWALEAVKDKAS--KTPFDGNLSVSERIANTCTDLGLICRPLGQSVVLCPFILTEAQMDEMFDKLEKALDKVFA 464
63 -49.9002ord_A mol:protein length:397 Acetylornithine aminotransferase  ali model follow..  26  13...............................YSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSN-NRPQMELAELLSK-NTFGGKVFFANTGTEANEAAIKIARKYEKKYRILSAHNSFHGRTLGSLTATGQPKYQKPF-------EPLVPGFEYFEFNNVEDLRRKMS---EDVCAVFLEPIQGESGIVPATKEFLEEARKLCDEYDALLVFDEVQCGMRTGKLFAYQKYGVVPDVLTTAKGLGGGVPIGAVIVN-ERANVLEPGD---HGTTFGGNPLACRAGVTVIKELKEGFLEEVEEKGNYLMKKLQEMKEEYDVVADVRGMGLMIGIQFREEVSN-------------REVATKCFENKLLVVPAGNNTIRFPLTVEYGEIDLAVETLKKVLQGI.. 391
64 -49.8004uhm_A mol:protein length:468 OMEGA AMINO ACID-PYRUVATE AMINOTRANSFERASE  ali model follow..  23  37........................PFSANRNFHKDPRIIVAAEGSWLVDDKGRRIYDSLSGLWTCGAGHSRKEIADAVAKQIGT-PGFQYGHPLSFQLAEKIAQMTPTLDHVFFTGSGSECADTSIKMARAYAQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGPLMDVDHLPHTLQPGMAFTKANELLKLIELHDSNIAAVIVEPMSGSAGVIVPPKGYLQRLREICDANDILLIFDEVITAFRMGKATGAEYFGVTPDIMNVAKQVTNGAPMGAVIASSEIYDTFEYAVEFGHGYTYSAHPVACAAGIAALDLLQKELIQQSAELAPHFEKALHGLKGTKNVI-DIRNCGLAGAIQIAARD--------GDAIVRPFEASMKLWKEGFYVRFGGDTLQFGTFNAKPEDLDRLFDAVGEALNGV.. 461
65 -49.7002eo5_A mol:protein length:419 419aa long hypothetical aminotransferase  ali model follow..  21  2.....LSRKIIEESDIYL-------ATSTRDPELFPLVIDHGEGVWIYDVDGNKYLDFTSGIGVNNLGWSHPEVIKIGIEQMQKLAHAAAYNIPQLELAKKLVTYSPGQKKVFFSNSGTEAIEASIKVVK-NTGRKYIIAFLGGFHGRTFGSISLTASKAVQRS-PFMPGVIHVPYPNPYRNPWH-IEFIEDYIFVNPEEVAGIFFEPIQGEGGYVIPPKNFFAELQKLAKKYGILLVDDEVQMGLRTGKLFAIENFNTVPDVITLAKALGGGMPIGATIFRKDLDFKPGM-----HSNTFGGNALACAIGSKVIDIVK-DLLPHVNEIGKIFAEELQGLADD------VRGIGLAWGLEYNEKKVR-------------DRIIGESFKRGLLLLPAGRSAIRVILVISEEEAKQGLDILKKVIKVVK. 419
66 -49.6003gju_A mol:protein length:460 Putative aminotransferase  ali model follow..  20  1.GMLNQSNELNAWDRDHF-----THMGTHARGESPTRIMAGGEGVTVWDNNGRKSIDAFAGLYCVNVGYGRQKIADAIATQAKNHAYVGHGTEASITLAKMIIDRAPKMSRVYFGLSGSDANETNIKLIWYYNEKKKIISRWRGYHG---SGVMTGSLTGLDLFHNAFDLPRAPVLHTEAPYYFRRADKLEEMILAEGPEIAAFIGEPILGTGGIVPPPAGYWEKIQAVLKKYDVLLVADEVVTGFRLGTMFGSDHYGIKPDLITIAKGLTSAYPLSGVIVADRVWQVLVQGGSLGHGWTYSAHPICVAAGVANLELIDEMLVTNAGETGAYFRAELAKAVGGHKNVGEVRGDGMLAAVEFVADKDD--RVFFDASQKIGPQVATALAASGVIGRAMPQGDILGPLCLTREQADIVVSKTADAVKSVFA 458
67 -49.6003fcr_A mol:protein length:458 putative aminotransferase  ali model follow..  20  4.....KNDQLDQWDRDNF-----THLAQHARGESANRVIKTASGVFIEDRDGTKLLDAFAGLYCVNVGYGRQEIAEAIADQAREHSYVGHGTEASITLAKMILDRAPKMSKVYFGLGGSDANETNVKLIWYYNEKKKIISRWRGYHGSGLVTGSLTGLELFHKKFLPVEQVIHTEAPYYFRREDLNVAELEALIEREGADIAAFIGEPILGTGGIVPPPAGYWEAIQTVLNKHDILLVADEVVTGFRLGTMFGSDHYGLEPDIITIAKGLTSAYPLSGSIVSDKVWKVLEQGGPIGHGWTYSAHPIGAAAGVANLKLLDELLVSNAGEVGAYLNATMAEALSQHANVGDVRGEGLLCAVEFVKD--RDSRTFFDAADKIGPQISAKLLEQDKIIARAMPQGDILGFA-TRAEADQVVEGTLRAVKAV.. 456
68 -49.4005lh9_A mol:protein length:458 OMEGA TRANSAMINASE  ali model follow..  25  30...................................TLVIARGDGNYITDIDGQRMLDGVGGLWNVNIGHNRASVKAAIAAQLDEQTFDGIAHPRVFDLAERLTGMFARMARVLFSSGGSDAVETALKMARQYPGRTRFLSLRNGYHGVHMGGTSVGGNGVYHYNHQLLAGCHLLDTPWLYRNPWDCIRQLEEQIALLGQTIAALIAEPVQGAGGVIVPPADYWPRLREVCDRHGILLIADEVVTGFRSGCMLGSRGWGVAPDILCLAKGITAGYPLGATLFNQRIADAIENGQGIMHGYTYSGHPTACAAALAVLDIVEAELPGNAAKVGAQLLEQLQPLVERYAVVGEVRGKGLMIALDLVSD--KRTRQPLDPAAGQPSRIADEARRAGVLVRPIGNKIILSPLTLTRDEAGLMVSALEAAFARC.. 451
69 -49.3002eh6_A mol:protein length:375 Acetylornithine aminotransferase  ali model follow..  26  7...............................YARLPVKFVRGKGVYLYDEEGKEYLDFVSGIGVNSLGHAYPKLTEALKEQVEKLLHVSN-NPWQEELAHKLVKHFWTEGKVFFANSGTESVEAAIKLARKYKNKWKFISFENSFHGRTYGSLSATGQPKFHKGF-------EPLVPGFSYAKLNDIDSVYKLLD---EETAGIIIEVIQGEGGVNEASEDFLSKLQEICKEKDVLLIIDEVQTGIRTGEFYAYQHFNLKPDVIALAKGLGGGVPIGAILAREEVAQSFTPGS---HGSTFGGNPLACRAGTVVVDEV-EKLLPHVREVGNYFKEKLKELGKGK-----VKGRGLMLGLELEREC---------------KDYVLKALEKGLLINCTAGKVLRFPLIIQKEHIDRAISVLREIL..... 375
70 -49.3003lv2_A mol:protein length:462 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  21  28.....TPEQIIAVDGAHL-----HPYSSIGREAVSPVVAVAAHGAWLRDGQPIEVLDAMSSWWTAIHGHGHPALDQALTTQLRV-MFGGLTHEPAARLAKLLVDITPGLDTVFFSDSGSVSVEVAAKMALQYPGKRRLMTWRGGYHGDTFLAMSICDPHGGMHSL-------TDVLAAQVFAPQAYSAAFEAQLAQHAGELAAVVVEPVQGAGGMRFHDPRYLHDLRDICRRYEVLLIFDEIATGFRTGALFAADHAGVSPDIMCVGKALTGGLSLAATLCTADVAHTIGAAGALMRGPTFMANPLACAVSVASVELLGQDWRTRITELAAGLTAGLDTARALPAVT-DVRVCGAIGVIECDRP-------------VDLAVATPAALDRGVWLRPFRNLVYAMPYICTPAEITQITSAMVEVARLVGS 454
71 -49.2004b98_A mol:protein length:448 BETA-ALANINE--PYRUVATE TRANSAMINASE  ali model follow..  23  23........................PFSANRNFQKDPRIIVAAEGSWLTDDKGRKVYDSLSGLWTCGAGHSRKEIQEAVARQLGT-PGFQYGHPLSFQLAEKIAGLLPELNHVFFTGSGSECADTSIKMARAYPQKTKLIGRARGYHGVNVAGTSLGGIGGNRKMFGQLMDVDHLPHTLQPGMAFTRANELLKLIELHDSNIAAVIVEPMSGSAGVLVPPVGYLQRLREICDQHNILLIFDEVITAFRLGTYSGAEYFGVTPDLMNVAKQVTNGAPMGAVIASSEIYDTFEHAVEFSHGYTYSAHPVACAAGLAALDILARDLVQQSAELAPHFEKGLHGLQGAKNVI-DIRNCGLAGAIQIAPRD--------GDPTVRPFEAGMKLWQQGFYVRFGGDTLQFGTFNARPEELDRLFDAVGEALNGI.. 447
72 -49.2001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  23  26...................................VYPVVSAEGCELILSDGRRLVDGMSSWWAAIHGYNHPQLNAAMKSQIDA-MFGGITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYEARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSLPENLFAPAPQSRMDGEWDERDMVGFARLMAAHRHEIAAVIIEPVQGAGGMRMYHPEWLKRIRKICDREGILLIADEIATGFRTGKLFACEHAEIAPDILCLGKALTGGMTLSATLTTREVAETIGEAGCFMHGPTFMGNPLACAAANASLAILSGDWQQQVADIEVQLREQLAPARDAEMVA-DVRVLGAIGVVETTHP-------------VNMAALQKFFVEQGVWIAPFGKLIYLMPYIILPQQLQRLTAAVNRAVQDETF 426
73 -49.2006erk_A mol:protein length:451 Aminotransferase  ali model follow..  19  41...................................NIVIDRAEGIYIVTEDGTRLIDGMSSWWASVHGYNHPKLNAAMIEQLGK-MFGGLTHQPAIDLGKKLLSIVPGLDAIFYADSGSIAVEVALKMALQYPSKCQFASTHSGYYGDTWHAMSVCDPINGMHSLPMQHFVAAPPMGFERDLTQSEREALTEFFVKNSDKLAGFIIEPIQGAGGMRFYSPQYLQLLRKLCDEYDVLLIADEIATGFRSGKLFACEHAAISPDIMTIGKALTGGMTFAATLSTREIADTISDYPALMHGPTFMGNPLACAVACASIDLISYDIEARTENMQAIMNEQLAPAVSLEGVK-EVRCLGAVAVIELNEA-------------VDMPIFQTLLINNGIWVRPFGKLVYIMPYVITDDELTTLCQALLKVVSSYLT 442
74 -49.2003ruy_A mol:protein length:392 Ornithine aminotransferase  ali model follow..  24  15...............................YHPLPIVISKAEGVWVEDPEGNRYMDLLSAYSAVNQGHRHPKIINALIDQANRVTLTSRASDQLGPWYEKVAK-LTNKEMVLPMNTGAEAVETAIKTARRWANRAEIIVCEDNFHGRTMGAVSMSSNEEYKRGF-------GPMLPGIIVIPYGDLEALKAAIT---PNTAAFILEPIQGEAGINIPPAGFLKEALEVCKKENVLFVADEIQTGLRTGKVFACDWDNVTPDMYILGKALGGGVPISCAAANRDILGVFEPGS---HGSTFGGNPLACAVSIAALEVLEEKLTERSLQLGEKLVGQLKEI--DNPMITEVRGKGLFIGIELNEPA---------------RPYCEQLKAAGLLCKETHENVIRIPLVISEEDLEWAFQKIKAVLS.... 392
75 -49.2005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  22  28...................................VFPVERAEGCELILSGGERLVDGMSSWWAAIHGYNHPQLNAAMKTQIDA-MFGGITHAPAIELCRKLVAMTPPLECVFLADSGSVAVEVAMKMALQYESRQRFLTFRNGYHGDTFGAMSVCDPHNSMHSLAENLFAPAPQSRMGGEWDERDMVAFARLMAAHRHEIAAVILEPVQGAGGMRIYHPQWLQRIRQMCDREGILLIADEIATGFRTGRLFACEHAGIAPDILCLGKALTGGMTLSATLTSRQVAETIGEAGCFMHGPTFMGNPLACAVANASLTLLESGWRRQVAAIEAQLREELAPAADSPQVA-DVRVLGAIGVVETTRP-------------VNIAALQQFFVRQGVWVRPFGKLIYLMPYIIQPEQLRRLTQAVNEAVREETF 428

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.