current user: public

If you have questions about the server, please let us know.

Query: 3l07_A mol:protein length:285 Bifunctional protein folD, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst SNAMILIDGKSLSKDLKERLATQVQEYKHHTAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLELIDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAYAVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVGDVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNRLast
1 -116.0003l07_A mol:protein length:285 Bifunctional protein folD  ali model  100  1SNAMILIDGKSLSKDLKERLATQVQEYKHHTAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLELIDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAYAVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHVDGKIVGDVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR 285
2 -112.0003p2o_A mol:protein length:285 Bifunctional protein folD  ali model follow..  54  1SNAMTLLDGKALSAKIKEELKEKNQFLKSK-GIESCLAVILVGDNPASQTYVKSKAKACEECGIKSLVYHLNENITQNELLALINTLNHDDSVHGILVQLPLPDHICKDLILESIISSKDVDGFHPINVGYLNLGLESGFLPCTPLGVMKLLKAYEIDLEGKDAVIIGASNIVGRPMATMLLNAGATVSVCHIKTKDLSLYTRQADLIIVAAGCVNLLRSDMVKEGVIVVDVGINRLSGKIVGDVDFEEVSKKSSYITPVPGGVGPMTIAMLLENTVKSAKNRL. 284
3 -110.0004a5o_A mol:protein length:286 BIFUNCTIONAL PROTEIN FOLD  ali model follow..  49  2HMTAQLIDGKAIAANLRQQIAQRVTERRQQGLRVPGLAVILVGTDPASQVYVAHKRKDCEEVGFLSQAYDLPAETSQDDLLALIDRLNDDPAIDGILVQLPLPAHLDASLLLERIHPDKDVDGFHPYNIGRLAQR-MPLLRPCTPKGIMTLLASTGADLYGMDAVVVGASNIVGRPMALELLLGGCTVTVTHRFTRDLADHVSRADLVVVAAGKPGLVKGEWIKEGAIVIDVGINRQDGRLVGDVEYEVAAQRASWITPVPGGVGPMTRACLLENTLHAAEHLHD 286
4 -109.0005o22_A mol:protein length:289 Bifunctional protein FolD  ali model follow..  53  3..AAKIIDGKTIAQQVRSEVAQKVQARIAAGLRAPGLAVVLVGSNPASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDTLNADNTIDGILVQLPLPAGIDNVKVLERIHPDKDVDGFHPYNVGRLCQRA-PRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLNGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVEYHD 285
5 -108.0006ape_A mol:protein length:298 Bifunctional protein FolD  ali model follow..  47  5NRGVVLLDGQALAYSIEKDLKNKIQIITVQVHKRPKLAVILVGKDPASITYVNMKIKACERVGMDFDLKTLQENVTEAELLSLIKDYNTDQNISGVLVQLPLPRHIDSKMVLEAIDPSKDVDGFHPLNIGKLCTQK-ESFLPATPMGVMRLLKHYHIEIKGKDVAIIGASNIIGKPLSMLMLNAGASVSVCHILTKDISFYTQNADIVCVGVGKPDLIKASMLKKGAVVVDIGINHLDGRIVGDVDFTNAQKVAGFITPVPKGVGPMTIVSLLENTLIAFEKQQR 289
6 -108.0004b4u_A mol:protein length:303 BIFUNCTIONAL PROTEIN FOLD  ali model follow..  43  14GHMALVLDGRALAKQIEENLLVRVEALKAKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMAMGE-AAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKA.. 295
7 -107.0005nhs_A mol:protein length:296 Bifunctional protein FolD  ali model follow..  48  9PVPARILDGRRIAEDLLDELKTRVDARLAAGQPRPGLAVVLVGGDPASTVYVRNKRRAAEKVGIEAFDYDLPAGTGEAELLSLIDQLNADPKIHGILVQLPLPGIADASRLIHRIDPRKDVDGFHPQNVGHLALRE-FGLRPCTPRGIVTLLAHTDQPVRGRNATIVGVSNHVGRPMALELLIAGCTVSCCHKFTPVLQTHVRDADILVVAVGRPGLIPGDWVKPGAVVIDVGINRLDGRLVGDVGFEAAAQRASWITPVPGGVGPMTVATLMQNTIEAADAALR 295
8 -107.0002c2x_A mol:protein length:281 METHYLENETETRAHYDROFOLATE DEHYDROGENASE-METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE  ali model follow..  41  1.VGAIMLDGKATRDEIFGDLKQRVAALDAA-GRTPGLGTILVGDDPGSQAYVRGKHADCAKVGITSIRRDLPADISTATLNETIDELNANPDCTGYIVQLPLPKHLDENAALERVDPAKDADGLHPTNLGRLVLG-TPAPLPCTPRGIVHLLRRYDISIAGAHVVVIGRGVTVGRPLGLLLTRRNATVTLCHTGTRDLPALTRQADIVVAAVGVAHLLTADMVRPGAAVIDVGVSRTDDGLVGDVHPD-VWELAGHVSPNPGGVGPLTRAFLLTNVVELAERR.. 281
9 -106.0001dia_A mol:protein length:306 METHYLENETETRAHYDROFOLATE DEHYDROGENASE/CYCLOHYDROLASE  ali model follow..  45  3..PAEILNGKEISAQIRARLKNQVTQLKEQPGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSEINTEEVINAIAPEKDVDGLTSINAGRLARGDNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLE 296
10 -106.0004a26_A mol:protein length:300 PUTATIVE C-1-TETRAHYDROFOLATE SYNTHASE, CYTOPLASMIC  ali model follow..  41  4.PSAQIIDGKAIAAAIRSELKDKVAALRELGGRVPGLASIIVGQRMDSKKYVQLKHKAAAEVGMASFNVELPEDISQEVLEVNVEKLNNDPNCHGIIVQLPLPKHLNENRAIEKIHPHKDADALLPVNVGLLHYGREPPFTPCTAKGVIVLLKRCGIEMAGKRAVVLGRSNIVGAPVAALLMKENATVTIVHSGTSDMIDYLRTADIVIAAMGQPGYVKGEWIKEGAAVVDVGTTPVPDRLVGDVCFEEAAARAAWISPVPGGVGPMTIAMLLENTLEAFKAALG 298
11 -105.0005tc4_A mol:protein length:316 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial  ali model follow..  47  1.MEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLD-QYSMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGATVTISHRYTEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLR 299
12 -104.0004cjx_A mol:protein length:319 C-1-TETRAHYDROFOLATE SYNTHASE, CYTOPLASMIC, PUTATIVE  ali model follow..  38  18..EAVVIDGRAVAKAIQKELTEEVALLERRKGRRPGLSTIICGKRKDSQTYVRLKRKAAAACGFRNFSVELPANVTQEALEREVIRLNEEEACHSIVVQLPLPPHIDKVAALSKIKPEKDADCLLPVNVGQLHIRRNPAIVPCTASAVMELLRCSGVEICGKRVVVLGRGDIAGLPVATLLANEDATVTVVHSPLCDIADIVRASDIVVSAAGQPGLVRGEWIKLGAAVIDVGTTPVADRLVGDVCFDVARKRAAYITPVPGGVGPVTVSMLLKNTLTMFKRSVR 311
13 -99.3003ngl_A mol:protein length:276 Bifunctional protein folD  ali model follow..  34  1...MKILRGEEIAEKKAENLHGIIERS----GLEPSLKLIQIGDNEAASIYARAKIRRGKKIGIAVDLEKYD-DISMKDLLKRIDDLAKDPQINGIMIENPLPKGFDYYEIVRNIPYYKDVDALSPYNQGLIALN-REFLVPATPRAVIDIMDYY--GYHENTVTIVNRSPVVGRPLSMMLLNRNYTVSVCHSKTKDIGSMTRSSKIVVVAVGRPGFLNREMVTPGSVVIDVGINYVNDKVVGDANFEDLSEYVEAITPVPGGVGPITATNILENVVKAAEFQKN 274
14 -88.0001edz_A mol:protein length:320 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE  ali model follow..  27  2SKPGRTILASKVAETFNTEIINNVEEYKKTNGQGPLLVGFLANNDPAAKMYATWTQKTSESMGFRYD---LRVIEDKDFLEEAIIQANGDDSVNGIMVYFPVFGNAQDQYLQQVVCKEKDVEGLNHVYYQNLYHNRLKSILPCTPLAIVKILEFLKIRLYGKKCIVINRSEIVGRPLAALLANDGATVYSVDVNNDLLKKCSLDSDVVITGVPSENYFPTEYIKEGAVCINFAC--------TKNFSDDVKEKASLYVPMTGKV---TIAMLLRNMLRLVRNVEL 316
15 -14.5004q39_A mol:protein length:260 PYLD, pyrrolysine synthase  ali model follow..  14  1......................SMALLTPDDLININMQLQKADSAVQEVTGLDIKGICKALYGTFSSSEKVPVTSGNGIIGNFSASLHAITQYFGFDSFVTDMPDV--SGYYEAVQNGAEI--FLAHNLKNGKMANNQ---PCTGIIYAEIASRY-LKADSKDVLVVGLGK-VGFPGAEHLVQKDFRVYGYDADETLLERAPKKFSIIFEATPCANTIPEAVLSENCVLSTPGIPC-------SEELRDKYEVQLIAEPLGIGTASMLYSVL............. 260
16 -13.1003d4o_A mol:protein length:293 Dipicolinate synthase subunit A  ali model follow..  15  1...............................GMLTGKHVVIIGGDARQLEIIRKLSTFDAKIGFDQLDDGFIGVTKMRIDEVDWNTVD--------AILLPISGTNEAGKVDTIFSNESKKTNRTLVKLMERDDIAIYNSIPTAEGTIMMAIQHTDFTIHGANVAVLGLGR-VGMSVARKFAALGAKVKVGAREISKAAQELRDVDVCINTIPA-LVVTANVLPSHTFVIDLASKP------GGTDFRYAEKKALLVPGLPGIVAPKTAGRILADVLVKLLAEPS 293
17 -12.3002rir_A mol:protein length:300 Dipicolinate synthase, A chain  ali model follow..  15  4................................MLTGLKIAVIGGDARQLEII----RKLTEQQADIYLVGFDQLDHGFTGAVKCNIDEIPFQQIDSII-LPVSATTGEGVVSTVFSNEE-FSGISNAYLENIAAQAKRKLVKLFERTIMLAIQHTDYTIHGSQVAVLGLGR-TGMTIARTFAALGANVKVGARSSDELKEHVKDIDICINTI--SMILNQTVLTPKTLILDLASRP------GGTDFKYAEKKALLAPGLPGIVAPKTAGQILANVL........ 287
18 -10.8001nyt_A mol:protein length:271 Shikimate 5-dehydrogenase  ali model follow..  13  6........................................VFGNPIAHSKSPFIHQQFAQQLNIEHPYGRV--LAPINDFINTLNAFFS-AGGKGANVTVPFKEEAFADELTERAALAGAVNTLMRLEDGRLLGDNTDGV------GLLSDLERLSFIRPGLRILLIGAGG-ASRGVLLPLLSLDCAVTITNRTVSRAEELAKEFDLIINATGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLAWCEQRGSKRNAD-------GLG-----MLVAQAAHAFL.... 250
19 -10.3003pgj_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  10  1......MSSGVDLGTENLYFQSNAMASQID-------QYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQ--CVPVDGFTEAAKHFFA-QGGRGCNVTVPFKEEAYRDRLTERARLAGAVNTLKKLDDGEILGDNTDGE------GLVQDLLAQQVLLKGATILLIGAGGAARGVLKPLLDQQPASITVTNRKAQAFEQLKQSYDVIINSTGELPAIDPVIFSSRSVCYDMMYGKGYTVFNQWARQHGCAQAID-------GLG-----MLVGQAAESFM.... 272
20 -9.7903oj0_A mol:protein length:144 Glutamyl-tRNA reductase  ali model follow..  15  5................................................................................................................................................KVSIPSIVYDIVRKNGGNKILLVGNGM-LASEIAPYFSYPQYKVTVAGRNIDDIDSLIKNNDVIITATSSKTIVEERSLMPGKLFIDLGNPPNIERGNNVITLDEIYEISK.............................. 132
21 -9.5003pwz_A mol:protein length:272 Shikimate dehydrogenase 3  ali model follow..  7........................................VIGRPINHTKSPLIHGLFAQASNQQLEYGAI--EGSLDDFEAQVLQFRS-EGGKGMNITAPFKLRA---ELADRRSERAQLAR--AANALKFEDGRIVAENFDGIGLLRDIEENLGEPLRNRRVLLLGAGGAVRGALLPFLQAGPSELVIANRDMAKALALRNSFDIVVNATADLPPLPADVLGEAALAYELAYGKGLTPFLRLAREQGQARLAD-------GVG-----MLVEQAAEAFA.... 251
22 -9.3601p74_A mol:protein length:272 Shikimate 5-dehydrogenase  ali model follow..  14  6........................................VWGNPIAQSKSPLIQNKLAAQTHQTMEYIAK--LGDLDAFEQQLLAFFE-EGAKGCNITSPFKERAYQDEYSQRAKLAEACNTLKKLDDGKLYADNTDGI------GLVTDLQRLNWLRPNQHVLILGAGG-ATKGVLLPLLQAQQNIVLANRTFSKTKELAETYDLVINATGGTASVDAEILKLGSAFYDMQYAK-------DTPFIALCKSLGLTNVSDG------FGMLVAQAAHSFH.... 251
23 -9.2304k28_A mol:protein length:269 Shikimate dehydrogenase family protein  ali model follow..  14  11........................................IVGSPIAQVKSPQNFNTWFNHNNCNLAMLPI--DLHEAALDSFADTLRGWQNLRGCVVTVPYKQALANDGLSERAAALGSINVIRRERDGRLLGDNVDG------AGFLGAAHKHGFEPAGKRALVIGCGGVGSAIAYALAEAGIASITLCDPSTARMGAVCELFDLVASPVGMGT-ALLATLQPDTLVADVVTSPEITPLLNRARQVGCRIQTG.............................. 247
24 -9.0803fbt_A mol:protein length:282 chorismate mutase and shikimate 5-dehydrogenase fusion protein  ali model follow..  15  10........................................LIGEKLGHSHSSYIHKLIFEKVGIKGIYNLF--EVPKEKLKESVDTFKI--KCGGLNVTIPYKVEV---KELYEISEKARKIG----AVNTLKFSREGISGFNTDIGFGKMLSKFRVEIKNNICVVLGSGGAARAVLQYLKDNFAKDIYVVTRNPEKTSEIYGKGDVIITPKGMESPVDKEVVAKFSSAVDLIYNPVETLFLKYARESGVK--------AVNGLY-----MLVSQAAASEE.... 249

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.