current user: public

If you have questions about the server, please let us know.

Query: 3lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst GMNRLRTSFQQTTGQISGHGKRNVGVLKTAFAAVADEMASDQYGTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDETDNRTVAYHPLCHLEIHEQDGLKELHPIETILVGAADRLMTLDEIKALPDIACLLLELPQREIGGVAPAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAAEIAGLFDSIYISFYKGLGGIAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDGQAADISPKLEQVQEETGLGFVGYLVDKDGYCSTEISVGDAYGELDQQTRDAGFARLRQAFSLast
1 -111.0003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model  100  1GMNRLRTSFQQTTGQISGHGKRNVGVLKTAFAAVADEMASDQYGTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDETDNRTVAYHPLCHLEIHEQDGLKELHPIETILVGAADRLMTLDEIKALPDIACLLLELPQREIGGVAPAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAAEIAGLFDSIYISFYKGLGGIAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDGQAADISPKLEQVQEETGLGFVGYLVDKDGYCSTEISVGDAYGELDQQTRDAGFARLRQAFS 357
2 -94.4003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  52  1GMTNTTSYQKTPYKLGGNGPRNVGVLTEALQNI-DDNLESDIYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADRKENRRVAYHPLSHLEIHEQDGLKELQQITPLLLGTANQLLTIDDIKSLEPVSSVLIELPQREIGGQLPAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVSNMFHVYFENSADEIGAILTKIQDETGVGISGY-LQEKSADVCAFEVSVGDAFAEIKNLELVFRCLEKEL. 359
3 -89.1002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  20  1....MGSDKIMIDLRSDT---VTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQR--GDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYS-VNPEDVKTNMVILRTDNLKVNAHG-FIEALRNSGVLANAV-SDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS.... 349
4 -88.6003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  22  2......SHMRYIDLRSDT---VTQPTDAMRQCMLHAEVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQR--GEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADPDDVHFTPTRLVCLENTHNGKVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMVFLQLTS---GESAPLLAFMKARGILFS---GYGELRLVTHLQIHDDDIEEVIDAFTEYLGA...... 341
5 -85.1004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  20  2...........IDLRSDTVTRPSR---AMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCER--GEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQEDHDNTAWMAEQLREAG---ADVMRQDTNMLFVRVGE---ENAAALGEYMKARNVLIN---ASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR...... 333
6 -84.9003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  20  2...........IDLRSDTVTRPSR---AMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCER--GEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQEDHDNAAWMAEQLREAG---ADVMRQDTNMLFVRVGE---ENAAALGEYMKARNVLIN---ASPIVRLVTHLDVSREQLAEVAAHWRAFLAR...... 333
7 -78.6001v72_A mol:protein length:356 Aldolase  ali model follow..  16  1..NGETSRPPALGFSSDNIAGASPEVAQALVKHSSGQ--AGPYGTDELTAQVKRKFCEIFERDVEVFVPTGTAANALCLSAMTPP--WGNIYCHPASHINNDECGAPEFFSNGKLMTVDGPAAKLDIVRLRERHTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAEWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLDLWLRNARKANAAAQRLAQGLEGLGGVEV-LGGTEANILFCRLD-------SAMIDALLKAGFGFYHDRGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQER.. 356
8 -78.4005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  15  4.........KSQQFASDNYSGICPEAWAAMEKANHGH--DRAYGDDQWTERASEYFRNLFETDCEVFAFNGTAANSLALASLCQS--YHSVICSETAHVETDECGAPEFFSNGKLLTAASVNGKLTPQSIREVHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSPAEWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRNHANHCAQLLALLVSDLPGVEL-MFPVEANGVFLQMP-------EHAIEALRAKGWRFYTFIGSGGARFMCSWDTEEERVRELAADIRSIITA...... 346
9 -74.0001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  16  11......AKPKPYSFVNDYSVGMHP---KILDLMARDNMTQHAYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRP--WEAVIATQLGHISTHETGAIEATGH-KVVTAPCPDGKLRVADIESAHMVIPKLVYISNTTEVGTQYTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTDIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNLELGAHSNKMAAILKAGLEACGIRLA--WPSASNQLFPILEN---TMIAELNNDFDMYTVEPLK-DGTCIMRLCTSWATEEKECHRFVEVLKRLVASTA.... 359
10 -51.6002c44_A mol:protein length:471 TRYPTOPHANASE  ali model follow..  37NPFLLDSEDVFIDLLTDSGTGAVTQSMQAAMM-----RGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKK--REQEKGLDRSNYFFDTTQGHSQINGCTVRNVYIKEGNFDLEGLERGNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQRTRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG---VVCQQAGGHAAFVDIPADQFPAQALACELYKVAGIRAVEPCPAELLRLTIPRATTQTHMDFIIEAFKHVKENASN... 448
11 -51.5001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  10  34NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMM-----MGDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKP--GQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDKGDIDLKKLQKAENIAYICLAVTVNLAGGQPVSMANMRAVRELTAAHGIKVFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVKQVRYLGDKLKPIVEPVGGHAVFLDARRDEFPAQSLAASIYVETGVRSMERGILETVRLTIPRRVTYAHMDVVADGIIKLYQH...... 430
12 -50.8001c7g_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  11  34NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMM-----IGDEAYAGSENFYHLEKTVKELFGFKHIVPTHQGRGAENLLSQLAIKP--GQYVAGNMTTTRFHQEKNGATFVDIVRDEAHDASLNLPFKGDIDGAENIAYICLAVTVNLAGGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLRYIEHRVKQVRYLGDKLREAGVPIVEP--TGGHAVFLDARRDQFPAQSLAASIYMETGVRSMERPKLETVRLTIPRRVTYAHMDVVADGIIKLYQH...... 430
13 -50.5006MME Entity 1(prereleased)  ali follow..  11  34NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMM-----MGDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKP--GQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDKGDIDLKKLQKLENIAYICLAVTVNLAGGQPVSMANMRAVRELTEAHGIKVFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVKQVRYLGDKLKPIVEPVGGHAVFLDARRDEFPAQSLAASIYVETGVRSMERGILETVRLTIPRRVTYAHMDVVADGIIKLYQH...... 430
14 -46.9001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  11  33GYNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAM---ITGDEAYAGSRNYYDLKDKAKELFNYDYIIPAHQGRGAENILFPVLLKY--KQKEGKAKNPVFISNFTAAHVELNGCKAINIVTEKGDFDIKKLKENDNIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARIFDMYKYADALTMSAKKDPLLNIGGLVADNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYGQVKYLGDRLREAGIPIQYP--TGGHAVFVDCPGDQFPAQAVINALYLESGVRAVEHADMEFMRLTIARRVTNDHMDYIADALIGLKEKFAT... 443
15 -24.7004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  10  122..............................................PGLRKIEAEICSLFNGGPGCVTSGGTESILMACKAYRDLAFEKEIVAPQSAHAAFNKA---ASYFGMKIVRVPTKMMEVDVRAMRRAISRNTAMLVCSTQFPHGVI---DPVPEVAKLAVKYKIPLHVDGGFLIVFMEKAGYPLEH-VKGVTSISADTHKYGYAPSSLVLYSDKKYRNYQFFVDTDWQGGIISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFV-FGNPQLSVIALGSRDFDI---YRLSNLMTAKGWNLNQLQFPPSIHCITLLHARKRVAIQFLKDIRESVTQIMKN.. 457
16 -24.3003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  11  91..............................................PVTTELQNRCAHLFNAPLGVGTVGSSEAIMLAGLAFKRKWQNKNIVTGANVQVCWEKFARYFEV-ELKEVKLSEGYYVMDPQQAVDMVDENTICVAAILSTLNGEF---EDVKLLNDLLVEKNKEIHVDAA-SGGFIAPFLYPELEWLPLVKSINVSGHKYGLVYAGIVIWRNKEDLPEELIFHINYLGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTERFNIVSKDEGVPLVAFSLKDSSCHTEFEISDMLRRYGWIVPAYTMPPNARVVIREDFSRTLAERLVIDIEKVMRELDEL.. 447
17 -24.2005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  10  93..............................................PRTAEIENRCANLWHAPEGTSTIGSSEACMLAGLAMKFAWRKRNIVISAGYQVCWEKFCVYWDI-DMHVVPMDDDHMSLNVDHVLDYVDDYTIGIVGIMGITY-DLARLDAVVERYNRTTKFPVYIHVDAA-SGGFYTPFIEPELKWLNNVISINASGHKYGLVYPGVVIWRDQQYLPKELVFKVSYLGGELPIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGGFSLINDGHELPLICYELTADSDREWTDLSDRLLMKGWQVPTYPLPKNMRIVVRADFGMSMAHDFIDDLTQAIHDLDQA.. 451
18 -24.0002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  13  122.............................................ASIMYALTNKIFKQLGLNVATPISTGMSISLCLSAA-RKKYGSNVVIYPYASHKSPIKA---VSFVGMNMRLVEGDRVYVPVEDIENAIKKEPCVLSTLTFFPPRNS---DDIVEIAKICENYDIPHIINGAYAIQNNYYLEKLKKAFKYRVDAVVSSSDKNLLTPIGGVYSTDAEFIKEISLSYPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLSKKT-FLDVESPIASCISVNSDPVEIAAKLYNLRVTFGNCYLGTYTHDYIVMNAAIGVRTEDIVNSVSKLEKIL........ 449
19 -23.9002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  13  48........................................DEIKTPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKK--DAWVVMDENCHYSSYVA----ERAGLNIALVPKTDYP-TIEETKKRGEVVLALITYPDGNYG----NLPDVKKIAKVCSEYDVPLLVNGA---YAIGRMPVSLKEI--GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLRRSEKYKNKEVATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFYEISKKAKGGRFFLYRELKSRKIHGIKPGLTRYFK-LSTYGLSDEEVDYVLNAFKEIIEKYS.... 371
20 -23.6003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  13  113......................DEHHIAFLNEVYALQSQSNPLHPDPSTAKFEAEVAHMLGGDAGTVTSGGTESLLLAMKTYRDWARATEAVVPVSAHAAFDKA---AQYFGIKLVRTPDADYRADVAAMREAITPNTVVVAGSAGYPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFLEGVTSVSADTHKYGYGATSVILYRRPDLLHYQYFIAADWPGGLLSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVA-----SDELNIYQVMEEMAGRGWRLNGLHRPPAFHALTLRHTEPGVVDRFLADLQDAVAQVRAH.. 476
21 -23.5003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  14  65..............................................KGTKLLEEKAGSLLNNKDAHIVSGGTEANLMALRCILSKNEHPKIIVPITAHFSFEKG---REMMDLEYIYAPKEDYTIDEKFVKDADYDVDGIIGIAGTTELGTI---DNIEELSKIAKENNIYIHVDAA-LDDKYKKKGVNYKDFSLGVDSITIDPHKMGHCPSGGILFKDIGYKRYLDVDAPYLTEGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVI--EPILNIVAIEDED-----YKEVCKKLRDRGIYVSVCNCVKALRIVVMPHIKREHIDNFIEILNSIKRD...... 397
22 -23.0005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  13  90............................................TCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKE--GDYVVLDKNAHYTSYVAAERAKLNVAEVGYEEYPTYKINLEGYKEVKNVGLILLTHVDGEYG----NLNDAKKVGKIAKEKGIPFLLNCAY---TVGRMPVNGKEV--KADFIVASGHKSMAASAPGILAFSEEFSDKITKTSEMLGCTSRGLPIVLMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPKKDKRRGFFFYDELKKRGIGGIRAGVTKEIKMSV-YGLEWEQVEYVVNAIKEIVESCK.... 411
23 -23.0004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  117............................LKEVYGATALTNPLHDKWPRINAMQAEVQNLFHGSKGLLTHGGTTSIIEAMAAYVIRARAKEIVVPETAHAAFKKAAELTGA-ILITVPVDKKTGAVNPNVMSSYITRNTAVMVGSASFMNGIH---DPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSSEPMVPGVTSISADLHKYGCCPTSVCLFSEDSPALSVYAALNWSGGLYRVAEVYATLSYYGKNKYQEIAKSIIRLRNAIQKELTALVEEGNGLTNPQWSILGFRSNTCNA---HFIADELEKRGWKLNLLQNPDGFHLCLVHTLVGSFETQFIKDLREAVIDVKNY.. 477
24 -22.8005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  12  109......................DEHHIAFLNEVYALQSQSNPLHPDPSTAKFEAEVAHMLGGDAGTVTSGGTESLLLAMKTYRDWARATEAVVPVSAHAAFDKA---AQYFGIKLVRTPDADYRADVAAMREAITPNTVVVAGSAGFPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFLEGVTSVSADTHKYGYGATSVILYRRPDLLHYQYFIAADWPGGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVA-----SDELNIYQVMEEMAGRGWRLNGLHRPPAFHALTLRHTEPGVVDRFLADLQDAVAQVRAH.. 472
25 -22.8005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  13  87..............................................PSMNRMESEIVALLHGEAGALSLGGTESILNATLAYREKARAERMIWPASAHPAFRKAAHLFGF-DVTVAPIDPVTMQVDADFVRDAVDANTVMLVGSANYPYGTI---DPIGALSAIAVEKDVWLHVDGC--WMLPWGEALGYPDILPGVTSISADTHKFGYGPGSVLAWRDASFRRHQYFLMTDWVGGVYGAATWAALRSLGREGYLARAKAIFETAFDMQAAVRAIPELRVLGKP----TFCFAFTSDAFDIYH-VNDFMRQRGWRFNGLQHPDALHMVTGPQTQPGVAERFRQDLGEAVEHARHR.. 431
26 -21.9003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  103..............................................PAVRKMESEVLRMFNAPSGTTTSGGTESLLLACLSAKMYALHHEIIAPVTAHAGFDKAAYYFGM-KLRHVELDPTTYQVDLGKVKKFINKNTVLLVGSANFPHGIA---DDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYK-VPGVTSISCDTHKYGFAPSSVIMYRNSDLRMHQYYVNPAWRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLDIMGNPRYSVISFSSKTLNI---HELSDRLSKKGWHFNALQKPVA-LHMAFTRLSAHVVDEICDILRTTVQELKSESN 442
27 -21.7004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain protein  ali model follow..  13  101...................GPASSVSWLGDIMTSAYNIHAGGSKLAPMVNCIEQEVAKQVGFTEGVFVSGGSMANITALTAARDNKHLGTAYISDQTHSSVAKGLRIIGITDSRIRRIPNSHFQMDTTKLEEAIETDKVVIGTAGTTNTGSI---DPLTEISALCKKHDMWFHIDGA--YGASVLLSPKYKSLLTGTDSISWDAHKWLFQTCAMVLVKDIRNLFHSFHVNPELTRPARGLKLWLTLQVLGSDLIGSAIEHGFQLAVWAEEALNPKKDWEI-VSPAQMAMINFRYKEEQDILNEKISHRILESGYAAIFTTVLNGKTCAIHPEATQEDMQHTIDLLDQYGREIYTEMK 488
28 -21.5004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  16  118.........................................SLEMSPSFSRLETLLAGLFGLGEGVLTSGGSLANLQALAVARNVAFDSVIFASEAAHTSLQKAAMLLGLGTAAVIPVRTADSRMDPEDLRARIDQARCVVATAGTTTTGNI---DPLAEIGAIAREHGLWFHVDAA--YGGALVFSERHRWRLAGIDSITFNPQKWLYVACAMVLFRDAGVLERAFRIPAPYTRHADVVKLWLTLQHIGQQGYARLIDDGYRLAERVVEGVRQRPFLRLAGEIDTNIVCFRGEPERWDDWNAALQALLLREGKIFLSLPVYRGGRVLLNPYTTDAVIDAMFKQIDRFAGRERGQER 486
29 -21.2002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase  ali model follow..  13  109...................TPPLMPAVAAEAMIAALNQSMDSWDQASSATYVEQKVCDKYDLSEGIFTSGGTQSNQMGLMLARDWIADKRIVCSKKSHFTVQKSASWMGLGEKAVMTVDNADGTMDITKLDEVIAQAKAIVGTAGTTDHGAI---DDLDFIADMAVKHDMWMHVDGAYGGALILSSHKSRLKGVERAHSISVDFHKLFYQTCGALLVNDKSNFKFLLHKSIATTKRFDALKVFMTMQNVGPKALGDMYDHLLAQTLEVADMIRTNDQFELLAEPSLSTVLFRATHETADELNKALRLEALTRGIAVLGETIVDGKTALKFTILNPCLTTSDFESLLSKINMLAVEL. 496
30 -21.1003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  17  62.............LGLSQHPDVLDGGVEALRTWGGGAGGSRLVGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGP--GSLIVSDALSHASLVDA---CRLSRARVVVSPHRDVDAVDAALAARTEERAVVVTESVFSADGDLAPLRDLHAV---CRRHGALLLVDEAHGLGVRGTRGQGLLHLAGAPDIVMTTLSKALGS-QGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALR-----LDAEPQRARAVLDRAAELATIAGVTEAPVSAVVSVILGDPEIAVG--AAAACLDRGVRVGCPAGTSRLRLAARASLTDDEMALARQVLTDVLATARA... 398
31 -21.0003wco_A mol:protein length:392 L-seryl-tRNA(Sec) selenium transferase  ali model follow..  12  8NIKRVINATGVVINTNLGRAPLSKDVINFISEIANGYSNLEYNKRGSRIAHIEKYLNELTGAESSFVVNNNAGAVFLVLNTLAEGKE-RGELVEIGGSFRIPDI----KKSGAILREVGYYNKT-KVSRYEGAQNTALLMKVHKSNFPMEGFVEEVKLEDLVKLGHKYGIPTYYDAGKEFGISVDEPNFRDCISLGIDLVSGSGDKLLGGPQAGIIVGKKNLIEKIK--KNPIARALRIDKLTLSGLEMTLKLYFQDEKALRQKAKRLEKLLKDIPGLKISVIKDKAKPGGGSLPELELPTYCVAIRHDRLSSQELSRRLRLAEPPIVCRIRVFHEDLKTIKKTLQELLS....... 391
32 -20.8001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  11  76............................MDLSINKNWIDKEEY---PQSAAIDLRCADLWHAPAGQAVGTNTIGSSEACMLGGMAMKWRPNLVCGPVQICWHKFARYWDV-ELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAA--FLAPFVAPDIVWDFLPRVKSISASGHKFGLAPLGCVIWRDEEALPQELVFNVDYLGGQIGIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPDLSERLRLRGWQVPAFTLGGEARIMCRRGFEMDFAELLLEDYKASLKYLSDH.. 451
33 -20.7005o5c_A mol:protein length:519 Putative decarboxylase involved in desferrioxamine biosynthesis  ali model follow..  13  112...................CPVVLPSLLAEQIMAAVNSSVDTWDQSAGGTLIEQKVLSRIGLPAGIFTSGGTQSNLMAMLLARDSWCAAHVFTSKLSHFSIQKSMAILGLGYDAVIPVDDERYRMDVDCLKQEVQRCLAVVATSGTTDFGSI---DPLGAISELCKHHGMWMHVDAA--YGCGLLVSESHRPRLAGIDSVTVDYHKSFFQTCGAFFVRDKHHLSHVTHKSIQTTRRFDALKMWLTLRVSGPMALGNAFDDILALTQIAHQLLNAHPAIEVLHVPELTTQIFRYVPRPGMNINTNIRKAVFRSGNAVIAGTKVNGRQTLLNPNTTAADIEDVIALIVHYGREQVRG.. 511
34 -20.7001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  11  76............................MDLSINKNWIDKEEY---PQSAAIDLRCADLWHAPAGQAVGTNTIGSSEACMLGGMAMKWRPNLVCGPVQICWHKFARYWDV-ELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAA--FLAPFVAPDIVWDFLPRVKSISASGHKFGLAPLGCVIWRDEEALPQELVFNVDYLGGQIGIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPDLSERLRLRGWQVPAFTLGGEARIMCRRGFEMDFAELLLEDYKASLKYLSDH.. 451
35 -20.4002fn6_A mol:protein length:375 AMINOTRANSFERASE  ali model follow..  12  16..............................KKAVLEVLNSKQLTQGKRSLLFEEALCEFLGVKHALVFNSATSALLTLYRNFEFSADRNEIITTPISFVATANM----LESGYTPVFA----------GIKNDGNIDELALEKLINERTKAIVSVDEVESVQKLCKKHSLSFLSDSSHALGSEYQ-----KKVGGFALASVFSFHKPITT-GGAVVTNDSELHEKMKLFRKSIGHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDNPYFTPLHPLLKDHLYPILMHQKFFTCKKLILESLHKRGILAAEDFYHAEISLPCHANLNLESVQNIAHSVLKTFESFKIE.. 375
36 -20.2001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  12  56.............LGLANHPDLIAAAKAGMDSHGFGMASVRFIGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGA--EDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEAREAGARHVLIATDGVFSMDGVIAN---LKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQK--FARELQKEGIYVTGPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQL..... 397
37 -20.2004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  10  87...................ALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVAKMLGLPEGVLQSTVSESTLIALLAARKNKILEVAYASDQAHSSVEKA---GLISLVKMKFLPDDNFSLRGEALQKAIEEDKFVCATLGTTGVCAF---DCLSELGPICAREGLWLHIDAA--YAGTAFLCPEFRGFLKGIDSFTFNPSKWMMVHCTGFWVKDKYKLQQTMHWQIPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEI-PAKRHLGLVVFRLKGPNSLTENVLKEIAKAGRLFLIPATIQDKL-TVTSQFTTRDDILRDWNLIRDAATLILSQ.. 481
38 -20.0003k40_A mol:protein length:475 Aromatic-L-amino-acid decarboxylase  ali model follow..  11  82...................TANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMGKMLELPAGVIQGTASESTLVALLGAKAKKLKEVGYCSDQAHSSVERA---GLLGGVKLRSVQSENHRMRGAALEKAIEQDVYAVVTLGTTNSCAF---DYLDECGPVGNKHNLWIHVDAA--YAGSAFICPEYRHLMKGIDSFNFNPHKWMLVNCSAMWLKDPSWVVNARHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFEL-AAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPAKIKDVY-AICSRFTQSEDMEYSWKEVSAAADEMEQE.. 474
39 -19.9001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  12  82...................TASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMGKMLQLPEGVIQGSASEATLVALLAARTKVVRRVAYASDQAHSSVERA---GLIGGVKLKAIPDGKFAMRASALQEALERDKFVVATLGTTSCCSF---DNLLEVGPICHEEDIWLHVDAA--YAGSAFICPEFRHLLNGVDSFNFNPHKWLLVNCSAMWVKRRTDLTGARHWQLPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEV-CAEVTLGLVCFRLKGSDGLNEALLERINSARKIHLVPCRLRGQF-AICSRKVESGHVRLAWEHIRGLAAELLAAEE 479
40 -19.9003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  13  54.............LGLTTDTRIIKAAQDALEKYGTGCAGSRFLGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGR--NDYILLDERDHASIIDG---SRLSFSKVIKYGHNNMEDLRAKLSRLPEDSAKLICTD--SMEGDIVNLPELTSI---ANEFDAAVMVDDAHSLGVIGHKGAGTASLNDDVDLIMGTFSKSLAS-LGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFIRSNEKTFW--VTKMLQDDGVFVNPPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQA..... 392
41 -19.9003vp6_A mol:protein length:511 Glutamate decarboxylase 1  ali model follow..  13  104...................TGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITREIVGWSSGIFSPGGAISNMYSIMAARYKYFPEVLFTSEQSHYSIKKAGAALGFGTDNVILIKNERGKIIPADFEAKILEAKYVNATAGTTVYGAF---DPIQEIADICEKYNLWLHVDAA--WGGGLLMSRKHRHKLNGINSVTWNPHKMMGVLLSAILVKEKGILQGCNQMHASYGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMFNGEPEHTNVCFWYIPQSLKVAPKIKALMMESGTTMVGYQPQGDKANFFRMVITQSDIDFLIEEIERLGQDL..... 505
42 -19.9002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  14  55.............MGMTFDPDVIAAGKQALDEFGSGTTGSRVLGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGK--GDYIILDADSHASIYDG---CWLGDAEIVRFRHNSVEDLDKRLGRLPAEAGKLVVLE--SMMGDIAPLQEMVAV---SKKHGAMILVDEAHGMGFFGEHGRGVFEVEADVDFVVGTFSKSVGT-VGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRHAGDKRAHLWKNSRRLHQGLRDM-GYKLGTETAQSAIIAVILTDMAQAVA--LWQGLLEAGLYVNTPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRAT..... 395
43 -19.8006eeq_A mol:protein length:490 4-hydroxyphenylacetaldehyde synthase  ali model follow..  11  98...................ASSSNAGLLGELLCSGLSVIGFTWSSSPAATELENVVAKMLNLPSGVLQANTCEAVLCTLAAARDKALNRVLYCSDQTHFTIHKGAKLIGIRSKNIKSITTKKEKLCPNDLRDAIRSDLYVCGTIGTTALGVV---DPIKELGKVAREFDLWLHVDGA--YGGSACICPEFQHYLDGVDSISMNAHKWLLSNCCFLWLQSPNALIESKDWQISLSRRFRAIKMWMVIRRYGVSNLIEHIRSDVSMAVRFEEMVAADDRFEI-VFPRKFALVCFKLPGRDSELTRELMERVNSSGKAYLSGVQMGRIFFIRCVIGSSLTEERHVDNLWRLIQETAQSI. 488
44 -19.8003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  11  82...................TASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMGKMLELPKGVIQGSASEATLVALLAARTKVIHRVAYSSDQAHSSVERA---GLIGGVKLKAIPDGNFAMRASALQEALERDKFMVATLGTTTCCSF---DNLLEVGPICNKEDIWLHVDAA--YAGSAFICPEFRHLLNGVDSFNFNPHKWLLVNCSAMWVKKRTDLTGARHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEI-CVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCHLRDKF-AICSRTVESAHVQRAWEHIKELAADVLRA.. 477
45 -19.7002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  14  57.............LGMGQHPVVLAAMHEALEAVGAGSGGTRNIGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEG---IKRNAGPKRIFRHNDVAHLRELIAADDPAAPKLIAFE--SMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAELMHRIDIFNGTLAKAYGV-FGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAEGQKLRDAQQMHAKVLKMRLKALG---MPIIDHGSHIVPVVI-GDPVHTKAVSDMLLSDYGVYVQPPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA.... 401
46 -19.7003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  12  54.............LGLADHPALIKTAQTVVEQYGFGMASVRFIGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGP--EDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKGARFKLIATDGVFSMDGIIAD---LKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLEEGPQLRKQLQENSRYFRAGMEKLG---FQLVPGNHPIIPVMLGDAQLATN--MADHLLQEGIYVVGPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKL..... 396
47 -19.7005k8b_A mol:protein length:403 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase  ali model follow..  12  30.......................................DHMRNDRWKTRDMEQLLCEKMNVKHAHLLSSGTAALQTAMMA-AGIGAGDEVIVPPFTFV-------------ASVEAIFMAGAVPIFAEIDETLCLSPEGIEAVITPRTKAINLVHKMDEIKAICKKHNLVLLEDACQAIGGS-YKGQALGTIGD-VGCYSFDSVKTITC-GGAVITNNTEIYDNAHMFSDHMGLNFRISEMNAALGLAQLRKLDTIIDIQRKNKKAIKDAMASIPEVSFREIPDPEGDSALSFMLPTEARTQEISKKLAANGV-KSDAIMSRTISMLIKLSWTDAQIAERIENIKKAFAQLE.... 397
48 -19.7006eei_A mol:protein length:490 Tyrosine decarboxylase 1  ali model follow..  11  93...................SNSSVAGFLGEMLSAGLGIVGFSWVTSPAATELEMIVAKLLNLPESKGNGGGVIQGSASEAVLVVLIAARDVYSSDQTHSALQKACQIAGIHPENCRVLTSTNYALRPESLQEAVSRDLFLCANVGTTSSTAV---DPLAALGKIANSNGIWFHVDAA--YAGSACICPEYRQYIDGVDSFNMNAHKWFLTNCSLLWVKDQDSLTLAKDWQIPLGRRFRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDPNFEI-VTPRIFALVCFRLEKKCNNRNRELLDAVNSSGKLFMSHTALSGKIVIGAPLTEEKHVKEAWKIIQEEASYLLHK.. 490
49 -19.6002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  12  97...................TGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTREIIGWPGGIFSPGGAISNMYAMMIARFKMFPEIAFTSEHSHFSLKKGAAALGIGTDSVILIKDERGKMIPSDLERRILEAKLVSATAGTTVYGAF---DPLLAVADICKKYKIWMHVDAA--WGGGLLMSRKHKWKLSGVNSVTWNPHKMMGVPLSALLVREEGLMQNCNQMHASYGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMFDGKPQHTNVCFWYIPPSLKVAPVIKARMMEYGTTMVSYQPLGD--VISNPAATHQDIDFLIEEIERLGQD...... 497
50 -19.6002jis_A mol:protein length:515 CYSTEINE SULFINIC ACID DECARBOXYLASE  ali model follow..  16  111...................SGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVRALVGWSSGIFCPGGSISNMYAVNLARYQRYPDALFTSKECHYSIQKGAAFLGLGTDSVRVVKDERGKMVPEDLERQIGMAELVSATSGTTVLGAF---DPLEAIADVCQRHGLWLHVDAA--WGGSVLLSQTHRHLLDGIDSVAWNPHKLLAAGLSALLLQDTSNL-DTGDKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVNSALTCADMDFLLNELERLGQDL. 509
51 -19.5003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  13  83............................ISAVQPKAAGSSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLLTLRHKRPKAKYIIWPRIDQKSCFKS----VTAGFEPVVIENVDLKAVEAKIQELGPEHILCLHSTTACFAPRVP--DRLEELAVICANYDIPHVVNGLQSSKCMHLIQQGAR--VGRIDAFVQSLDKNFMVPVGGAIIFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAELQTPHNPISLAMTLKTIDGHHDKAVTQLGSMLFTRQVS-ADNYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNIVRKE.. 446
52 -19.5002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  14  75.............MGMTFDPDVIAAGKEALEKFGSGTNGSRMLGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGK--GEYVILDADSHASIYDG---CQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLE--SMLGDIAP---LKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYELEGQIDFVVGTFSKSVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRTAHEKRERLWSNARALHGGLKAM-GFRLGTETCDSAIVAVMLEDQEQAAM--MWQALLDGGLYVNMPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAV..... 415
53 -19.5003w1h_A mol:protein length:452 L-seryl-tRNA(Sec) selenium transferase  ali model follow..  11  68NIKRVINATGVVINTNLGRAPLSKDVINFISEIANGYSNLEYNKRGSRIAHIEKYLNELTGAESSFVVNNNAGAVFLVLNTLAE--GKEVIISRGELV-GSFRIPDIMKKSGAILREVGTTNKT-KVSDYEGAQNTALLMKVHKSNFYMEGFVEEVKLEDLVKLGHKYGIPTYYDAGKEFGISVDEPNFRDCISLGIDLVSGSGDKLLGGPQAGIIVGKKNLIEKIK--KNPIARALRIDKLTLSGLEMTLKLYFEDEKALRQKAKRLEKLLKDIPGLKISVIKDKAKPGGGSLPELELPTYCVAIRHDRLSSQELSRRLRLAEPPIVCRIRVFHEDLKTIKKTLQELLS....... 451
54 -19.4002po3_A mol:protein length:424 4-dehydrase  ali model follow..  13  50............................................GGPLVREFEERVAGLAGVRHAVATCNATAGLQLLAHAA-----TGEVIMPSMTFAATPHA----RWIGLTPVFADIDPDTGNLDPDQVAAAVTPRTSAVVGVHLWGRPCAADQLRKV---ADEHGLRLYFDAAHALGCA-VDGRPAGSLGD-AEVFSFHATKAVNA-GGAVVTDDADLAARIRALHNAGGTNAKMSEAAAAMGLTSLDAFPEVIDRNRRNHAAYREHLADLPGVLVADHDRHGQYVIVEIDEATTGIHDLVMEVLKAEGV-HTERLAARVLSLPTGTAIGDDDIRRVADLLRLCATRGRELTA 391
55 -19.4001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  12  50.............LGLSHHPQIIRAWQQGAEQFGIGSGGSGHVGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAK--EDRIAADRLSHASLLEA---ASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQV---TQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVPELLVVTFGKGFGV-SGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLDEGDARREKLAALITRFRAGVQDLP---FTLADSCSAIQPLIVGDNSRALQ--LAEKLRQQGCWVTAPAGTARLRLTLTAAHEMQDIDRLLEVLHGN......... 383
56 -19.3006eew_A mol:protein length:500 Aromatic-L-amino-acid decarboxylase  ali model follow..  11  103...................ATVSSAAFLGEMLSTALNSVGFTWVSSPAATELEMIVAQILKLPKFSGTGGGVIQNTTSESILCTIIAARECYGSDQTHTMFPKTCKLAGIYPNNIRLIPTTVEGISPQVLRKMVEDDVFLCATLGTTSTTAT---DPVDSLSEIANEFGIWIHVDAA--YAGSACICPEFRHYLDGIDSLSLSPHKWLLAYCTCLWVKQPHLLLRAKNWQIATGRKFRSLKLWLILRSYGVVNLQSHIRSDVAMAKMFEEWVRSDSRFEI-VVPRNFSLVCFRLSLHVEEVNKKLLDMLNSTGRVYMTHTIVGGIYMVGSSLTEEHHVRRVWDLIQKLTDDLLKE.. 499
57 -19.2005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  12  67.............LALSKHPEVLDAMHKTIDKYGCGAGGTRNIGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKMKDLVIFSDELNHASMIVG---IKHANVKKHIFKHNDLNELEQLLQSYPKSVPKLIAFE--SMAGSVAD---IEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEVMDRVDMITGTLGKSFGS-VGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIVPVLI-GNADLAKQASDILINKHQIYVQAARGTERLRITPTPGHTNDLSDILINAVDDVFNEL..... 430
58 -19.2004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  14  91.............MGMTFDPDVIAAGKEALEKFGSGTNGSRMLGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGK--GEYVILDADSHASIYDG---CQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLE--SMLGDIAP---LKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYELEGQIDFVVGTFSASVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRTAHEKRERLWSNARALHGGLKAM-GFRLGTETCDSAIVAVMLEDQEQAAM--MWQALLDGGLYVNMPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAV..... 431
59 -19.1002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  11  50.............LALANHPLIKARLAKSLLEEQQSLFMSASFQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQP--NTNVYIDFFAHMSLWEG---ARYANAQAHPFMHNN---HLRMLIQRHGPGIIVVDSIYSTLG----TIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLALTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLESADNRRQHLDRMARKLRIGLSQLG-------TIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYG..... 384
60 -19.1004xau_A mol:protein length:389 Putative aminotransferase  ali model follow..  18  25...........................PTALDRVAEVFASGYLGQGPRVAEFESALAARLGNPRVVSVHSGTSGLCLALRLLDAPEERDEVLSTPLTFEATNWA----LADGRRIT-VDPATLTMDLDDLERKISPATRAIIVVH--WTGYPVDLDRLAGILD-EREHGFRPAVDCAHAWGASYR-----VPLGSHGNMCVFSFQKHLTC-GGLLTLPGDELHERAMLRRAEWGLKWHMTDLNAAIGLANLETVDEQLRLHRENAAFYDKELTGVPGLELLQRSPDREGSF-YVYDVKVDDRPAFHRKMEAAGIMALDSVYDRMVSLPVGWWLTEQDREHVVATIRSGW........ 383
61 -19.1006enz_A mol:protein length:530 Acidic amino acid decarboxylase GADL1  ali model follow..  12  126...................AGLDYYSLAARIITEALNPSIYTYEVSPVFLLVEEAVIECVGWKEGIFNPGGSVSNMCAMNLARYRHCPDILFTSAECHYSMKKAASFLGIGTQNVYFVEDGRGKMIPEDLEKQIWQARLVCATSGTTVLGAF---DPLDEIAEVCERHGLWLHVDAS--WGGSALVSRKHRRLLHGIDSVAWNPHKMLMAGISALLVKDKSYSAKATYLFQQCSRRPDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREGFKLLMEPEYTNVCFWYIPRKLSLVAPAIKEKMMKKGSLMLGYQPHRG--VVISPQVSREDMDFLLDEIDSLGRDM..... 524
62 -19.1003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  14  21.................DYSATTPVDPRVAEKMMQFMTMDGTFGNEEAVDIARNQIADLVGPREIVFTSGATESDNLAIKANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAQRNGIIDLKELEAAMRDDTILVSIMHNNEIGVVQD---IAAIGEMCRARGIIYHVDATQ---SVGKLPIDLSQL--KVDLMSFSGHKIYG--IGALYVRRKP---RVRIEAQMHGGGHERGMRMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLVEGESLIMALKDLAVSSGSACTSASLERALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRD... 395
63 -19.0005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  14  52.............LGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGR--GTTLFSDALNHASLIDG---ARLSRADVQIYPHCDTDALSAMLEASDADVKVIVSDTVFSMDGDIAPLPRLLEL---AEQHGAWLIVDDAHGFGVLGPQGRGAIALRSPNLISIGTLDKAAGV-SGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLEEGDARRAHLQQLIGRTRAMLKATP---WLPVDSHTAVQPLIIGANDATLE--IAATLDRAGLWVPAPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA.... 396
64 -18.9001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  12  9..HQFPGLANKTYFNFGGQGILPTVALEAITAMYGYLQENGPFS-QQLIAQLRQALAETFNPNTITITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIAIVQAIAARFGITYRFFPTLNQGDAAAVLANHLGPKTRLVILSHLWNTGQVLP---LAEIMAVCRRHQVRVLVDGAQ---SAGSLPLDFSRL--EVDYYAFTGHKWFAGPAGGGLYIHGDCLGEIN----YVGWRSFEVATSAYPQYAGLLAALQRYQAICQRSEFLWRGLNQLPHVHCATSAPQAGLVSFTVDS--PLGHRAIVQKLEEQRIYLRTIADPDCIRACCHYITDEEEINHLLARLADF......... 388
65 -18.8003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  11  64.............LALANHPLIKARLAKSLLEEQQSLFMSASFQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQP--NTNVYIDFFAHMSLWEG---ARYANAQAHPFMHNN---HLRMLIQRHGPGIIVVDSIYSTLG----TIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLALTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLESADNRRQHLDRMARKLRIGLSQLG-------TIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFR 403
66 -18.8005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  13  50.............LGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGK--DATIFSDALNHASLIDG---TRLSRATVQVYPHADTATLGALLEACTSQTKLIVTDTVFSMDGDIAPLAELLAL---AERHGAWLVVDDAHGFGVLGPQGRGALALRSPHLVYVGTLGXAAGV-AGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLDEGDARRAHLAALIERTRALLRRTR---WQPVDSHTAVQPLVIGSNEATLA--AMRALDAHGLWVPAPAGTSRLRISLSAAHSFDDLARLETALLRASEEA..... 393
67 -18.8001b9h_A mol:protein length:388 PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)  ali model follow..  15  37.............................................GDEVNSFEREFAAHHGAAHALAVTNGTHALELALQV-MGVGPGTEVIVPAFTFISSSQAGAVTVP-----VDVDAATYNLDPEAVAAAVTPRTKVIMPVH--MAGLMADMDALAKI---SADTGVPLLQDAAHAHGAR-WQGKRVGELDS-IATFSFQNGKLMTA-GGAVVFPDGETEKYETAFLKIAGSNMRLNEFSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADMAMFRIPGLTEERRNALVDRLVEAGL........................................... 317
68 -18.6004lc3_A mol:protein length:391 Putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase  ali model follow..  14  23..............................IQGVVEVLRSGWITTGPQCQKFEAALSEYCGGRPVRVFNSGTCTLEIGLRI-AGVGPGDEVITTPASWVSTSNV----IETGATPVFADIDPVTRNIDLDKLEQAITPRTKAIIPVFLSGLPVDMDRLYAI---ARAHKLRVIEDAAQAFGSTWH-----KRIGAIGDLVSFSFHKNLTT-GGALVLNNEDEAVLAQKYRDVLGGKYNLTDVAARVGLGQLPHLERFTAQRRALARAYFAAFDGGAAAKLGVGLPVAHMFLVTLPLERLTITAEFMAQMKERGI-HAERYGASTVTLPLFTQMTEGDVRRVVDAVNQICEQYGK... 385
69 -18.4006eem_A mol:protein length:512 Tyrosine/dopa decarboxylase  ali model follow..  101...................SSGSIAGFLGEMLSTGFNVVGFNWMSSPAATELESIVGQMLTSSDGSSGGGGVLQGTTCEAILCTLTAARDVYASDQTHCALQKAAQIAGINPKNVRAIKTSKAGLSPNSLQSAILADIFLCATVGTTSSTAV---DPIGPLCAVAKLYGIWVHIDAA--YAGSACICPEFRHFIDGVDSFSLNAHKWFFTTCCCLWVKDSDSLVKAKDWQIALSRRFRSMKLWLVLRSYGVANLRTFLRSHVKMAKHFQGLIGMDNRFEIVVPRTFAMVCFRLKPTAIFEVNVKLLESVNASGKIYMTHAVVGGVYMVGATLTEERHVTGAWKVVQEHTDAILGA.. 512
70 -18.3003dr4_A mol:protein length:391 Putative perosamine synthetase  ali model follow..  14  49.............................................GRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVA-MGIGPGDEVIVPSLTYIASANS----TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQICDMDPILEV---ARRHNLLVIEDAAEAVGAT-YRGKKSGSLGD-CATFSFFGNAIITGEGGMITTNDDDLAAKMRLLRPIVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGMYTVRLGEGLSTTRDQVIKDLDALGI-IAEACGVDGLNLPTHAGLTEADIDRVIAALDQVL........ 384
71 -18.3004zas_A mol:protein length:404 CalS13  ali model follow..  14  36..............................STRVSAVLSSGRLEHGPTVAEYEAAVGSRIGNPRVVSVNCGTAGLHLALSLASEHDGPGEVLTTPLTFEGTNWP----LANGLRIR-VDPATLNMDLDDLAAKISPATRAIVVVH--WLGYPVDLNRLRAVVDAGYDRRPLVVEDCAQAWGATYR-----APLGTHGNVCVYSTGKILTGSGGFVVLPDDDLYDRLRLRRAEWGYRFILNEIGGAIGLSNLERVDELLRRHRENAAFYDKELAGIDGVEQTERADDREPAF-WMYPLKVRDRPAFMRRLLDAGIATLDRVADRVVHIPVGWWLTEDDRSHVVETIKSGW........ 398
72 -18.3006ewj_A mol:protein length:427 Putative capsular polysaccharide biosynthesis protein  ali model follow..  10  16......................PPDITEAEITEVVDTLRSGWITTGPKTKELERRLSLYTQTPKTVCLNSATAALELILRV-LEVGPGDEVIVPAMTYTASCSV----THVGATPV-IQADTFEMDYDLLEQAITEKTKVIIPVE--LAGIVCDYDRLFQVVEKKRDNRIVIVSDSAHALGSTYK-----QPSGSIADFTSFSFHKNFTTAEGGSATDDEEMYKEFQILSVTPAYKCNMTDIMASLGLVQLDRYPSLLQRRKDIVDRYDSGFAGSRIHPLAHKTETVHLYITRVEGASLEERNLIIQELAKAGIASAYAFFENEITLPLHTKLSDEEVDYIIETFKTVSEKVLTLSK 413
73 -18.1006blg_A mol:protein length:379 dTDP-4-amino-4,6-dideoxygalactose transaminase  ali model follow..  12  15...........................TELDYMQSAMNSGKLCGDGGFTRRCQQWMEQRFGTAKALLTPSCTASLEMAALL-LDIQPGDEVIMPSYTFVSTANA----VLRGAKIVFVDIRRDTMNIDETLIEAAITDKTRAIVPVHYAGVACEMDTIMAI---ADKYNLFVVEDAAQGVMST-YKGRALGTIGH-IGCFSFHETKNYTA-GGATLINDRTLVERAEIIREKIGSSYLMSDLQAAYLWAQLEAAERINQQRLALWQNYYDALLPLARLPTVPADCGQNAHMFYIKLRDIEDRSRLIAWLKEAEI-YTTQESERLVRLPLFYNLSVVNQRTVINSLLSYFS....... 379
74 -18.1003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  100...........................DISAVQPKAAGSSLLNKITNSLVLDIIKLAGVHTVANCFVVPMATGMSLTLCFLTLRHPKAKYIIWPRIDQKSCFKS----ITAGFEPVVIENVDLKAVEAKVQELGPDCILCIHSTTSCFAPRVP--DRLEELAVICANYDIPHIVNGVQSSKCMHLIQQGAR--VGRIDAFVQSLDKNFMVPVGGAIIFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSELHTPHNPISLAMTLKTLDEHRDKAVTQLGSMLFTRQVS-TNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAVRKE.. 464
75 -18.1004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  12  56.............LNLSSAHNLKHAIVNGFDKYGFGSKGSNIVGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSK--HDSIFADKYIHASIIDG---IKLSQAKLRRYKHQQ----LSQLQDIYDGKSFITTEGVFSTSGSITQLDKLAKITP-------KLIVDEAHSFGVLGKNGRGAIN-YKNCLICVFPLGKAFGG-VGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELVSKDLSPIRSIQLNNANLAIR-LKDKLFENKIIVSCPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYE..... 388

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.