current user: public

If you have questions about the server, please let us know.

Query: 3ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350
# Score Template Links and tools%idFirst GETQPESAAFTAPSTDNPIRINFNENPLGMSPKAQAAARDAVVKANRYAKNEILMLGNKLAAHHQVEAPSILLTAGSSEGIRAAIEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDNWAFDIEGLKAAVAAYSGPSIVYLVNPNNPTGTITPADVIEPWIASKPANTMFIVDEAYAEFVNDPRFRSISPMITQGAENIILLKTFSKIHAMAGMRVGYAVAHPTVIALMGRYVAGEKINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNFVFHQLVVPLKDYQTHMADAGVLIGRAFPPADNWCRISLGTPQEMQWVADTMREFRKKSWILast
1 -112.0003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model  100  1GETQPESAAFTAPSTDNPIRINFNENPLGMSPKAQAAARDAVVKANRYAKNEILMLGNKLAAHHQVEAPSILLTAGSSEGIRAAIEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDNWAFDIEGLKAAVAAYSGPSIVYLVNPNNPTGTITPADVIEPWIASKPANTMFIVDEAYAEFVNDPRFRSISPMITQGAENIILLKTFSKIHAMAGMRVGYAVAHPTVIALMGRYVAGEKINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNFVFHQLVVPLKDYQTHMADAGVLIGRAFPPADNWCRISLGTPQEMQWVADTMREFRKKSWI 354
2 -98.5004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  24  12.GLPVYVPGKT---VPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCVQLKAALARHLGFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPL-TDHTFDLYAMLATVTDRT--RLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAIDEAYVEYIRDGMRPDSLGLV-RAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDKVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSRTQDFVEQAADARIVVRPY---GTDGVRVTVAAPEENDAFLRFARRWRSDQ.. 354
3 -98.5003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  22  10.NLSNYEPGKKEYGVKEVIKLASNENPFGTPPKAIECLRQNANKAHLYPDDSMIELKSTLAQKYKVQNENIIIGAGSDQVIEFAIHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITHNLDEFKKLYETHKDEI--KLIFLCLPNNPLGECLDASEATEFIKGVNEDCLVVIDAAYNEFASFKDSKKHLEPCIKEFDNVLYLGTFSKLYGLGGLRIGYGIANANIISAFYKLRAPFNVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDENSTDLSEKLLKKGIIIRNLKSYGLNAIRITIGTSYENEKFFTEFDKILR.... 365
4 -97.7003ffh_A mol:protein length:363 Histidinol-phosphate aminotransferase  ali model follow..  23  12.GLSSYKPGKAELGLTKITKLSSNENPLGTSKKVAAIQANSSVETEIYPDGWASSLRKEVADFYQLEEEELIFTAGVDELIELLTRVLLDTTTNTVMATPTFVQYRQNALIEGAEVREIPLLQDGEHDLEGMLNAIDEKT--TIVWICNPNNPTGNYIELADIQAFLDRVPSDVLVVLDEAYIEYV-TPQPEKHEKLV-RTYKNLIITRTFSKIYGLASARVGYGIADKEIIRQLNIVRPPFNTTSIGQKLAIEAIKDQAFIGECRTSNANGIKQYEAFAKRFKVKLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSGALGFPTAVRITIGKEEDNSAVIALLEKLL..... 363
5 -95.3004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  25  16.SLPASVPFVRQHGRKIAARIGANESGFGPAPSVLLAIRQAAGDTWKYADPENHDLKQALARHLGTSPANIAIGEGIDGLLGQIVRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADDR-EDLEGLLAAVGRE-NAPLVYLANPDNPMGSWWPAERVVAFAQALPETTLLVLDEAYCETAPRDALPPI---SLIDKPNVIRARTFSKAYGLAGARIGYTLSTPGTAQAFDKIRNHFGMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDRAIVDRLMSDHGIFIRMPGAPLNRCIRISTAPDAEMDLLAAALPEVIRS... 372
6 -93.5003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  21  1GMSVGEAMDTEVRAAAQAVCLAFNENPEAVEPRVQAAIAAAAARINRYPFDAEPRVMRKLAEHFSCPEDNLMLVRGIDECFDRISAEF--SSMRFVTAWPGFDGYRARIAVSGLRHFEIGLTDDLLLDPNDLAQV----SRDDCVVLANPSNPTGQALSAGELDQLRQRAG---KLLIDETYVDYSSFR------ARGLAYGENELVFRSFSKSYGLAGLRLGALFGPSELIAAMKRKQWFCNVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEANFVLVENA-AGERTLRFLRERGIQVKDAGFGLHHHIRISIGREEDNDRLLAALAEYSDHS.. 337
7 -93.2003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  22  12.SMKGYIPGYQPPDIASWIKLNTNENPYPPSPEVVKAILEELGALRIYPSASSQKLREVAGELYGFDPSWIIMANGSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTGDFRIAGFPE------RYEGKVFFLTTPNAPLGPSFPLEYIDELARRCAG--MLVLDETYAEFAESNALE-----LVRRHENVVVTRTLSKSYSLAGMRIGLAIARPEVIAALDKIRDHYNLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPDDGKRVYDGLYARKVLVRHFSPLLAHGMRISIGTREEMEQTLAALKEIGE.... 353
8 -91.0003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  26  17.GEHAYGAPQL----NVDIRLNTNENPYPPSEALVADLVATVDELNRYPERDAVELRDELAAYIAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAK-QPDIVFVTTPNNPTGDVTSLDDVERIINVAPG--IVIVDEAYAEFSPSP---SATTLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHAAWQAFLDRGVLIRDV--GIAGHLRTTIGVPEENDAFLDAAAEIIKLN.. 365
9 -89.5004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  22  22.GKAPYGAPQL----AVPVRLNTNENPHPPTRALVDDVVRSVRELHRYPDRDAVALRADLAGYLTLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRANDFGLDVDVAVAAVVDR-KPDVVFIASPNNPSGQSVSLPDLCKLLDVAPG--IAIVDEAYGEFSSQP---SAVSLVEEYPSKLVVTRTMSKAFAFAGGRLGYLIATPAVIDAMLLVRLPYHLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDANFVLFGEFADAPAAWRRYLEAGILIRDV--GIPGYLRATTGLAEENDAFLRASARIATD... 369
10 -86.8001fg3_A mol:protein length:356 HISTIDINOL PHOSPHATE AMINOTRANSFERASE  ali model follow..  23  16.NLTPYQSARR-LGGNGDVWLNANEYPTAVEFQLTQQ------TLNRYPECQPKAVIENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTLDNWQLDLQGISDKLD---GVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAIVVADEAYIEFCPQASLAG----WLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVIAPYPLSTPVADIAAQALSPQGIMRERVAQIIAEREYLIAALKEIPCQVFDSETNYILARFK-ASSAVFKSLWDQGIILRDQNPSLSGCLRITVGTREESQRVIDALRAE...... 354
11 -86.4002f8j_A mol:protein length:347 Histidinol-phosphate aminotransferase  ali model follow..  20  1..MGSDKIMNPETEKRDKTYLALNENPFPFPEDLVDEVFRRLNSLRIYYDSPDEELIEKILSYLDLSKNNVSVGNGADEIIYVMMLMF----DRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLRIPEVN-------VGEGDVVFIPNPNNPTGHVFEREEIERIL---KTGAFVALDEAYYEFHGESYVD-----FLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMFAKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEKERLLEHLRTKNVAVR----SFREGVRITIGKREENDMILRELEVF...... 340
12 -86.1003euc_A mol:protein length:367 Histidinol-phosphate aminotransferase 2  ali model follow..  22  20.AMGAYHVPDS----HGLVKLDAMENPYRLPPALRSELAARLGELNRYPVPSSEALRAKLKEVMQVPAGEVLLGNGSDEIISMLALAAARPGAKVMAPVPGFVMYAMSAQFAGLEFVGVPLRADFTLDRGAMLAAMAEH-QPAIVYLAYPNNPTGNLFDAADMEAIVRAAQGSVLVVVDEAYQPFAQESWMS-----RLTDFGNLLVMRTVSK-LGLAGIRLGYVAGDPQWLEQLDKVRPPYNVNVLTEATALFALEHVAVLDEQAAQLRAERSRVAEGMAAHGVTVFPSAANFLLARVP-DAAQTFDRLLARKVLIKNVSPLLANCLRVTVSTPEENAQFLEAFAASLQD... 367
13 -78.8003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  18  7.GGDLMIHGGDIYTERELLDYSSNINPLGIPKSFLNNIDEGIKNLGVYPDVNYRRLNKSIENYLKLKDIGIVLGNGASEIIELSISLF----EKILIIVPSYAEYEINAKKHGVSVVFSYLDENMCIDYEDIISKIDD---VDSVIIGNPNNPNGGLINKEKFIHVLKLAEEKKTIIIDEAFIEFTGDPSS--SFVGEIKNYSCLFIIRAMTKFFAMPGIRFGYGINNKEIAAKIKAKQNPWNINCFAEMAAINCLKDTNYIEESLLWIKKERKRFIEELNKIGFRVFSPHANFVLCRLENSGEKLYDSLLKEDIVIRRCC---DSFVRFAIKDEKKNTKFLRALKGVENN... 360
14 -78.1003fkd_A mol:protein length:350 L-threonine-O-3-phosphate decarboxylase  ali model follow..  18  13.............LSSEIVNFSTTVWTDGDKDHLEKHLVENLNCIRHYPEPDAGTLRQMLAKRNSVDNNAILVTNGPTAAFYQIAQAF--RGSRSLIAIPSFAEYEDACRMYEHEVCFYPSNEDIGEADFS---------NMDFCWLCNPNNPDGRLLQRTEILRLLNDHP-DTTFVLDQSYVSFTTEE---VIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLGVEVHPSGTTFFLLRLKKAAELKKYMLEEYNMLIRDAS---ESYVRITTQRPAQNQLFIKALETFLEKYE. 343
15 -77.0001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  20  9GGNIREPATVLGISPDQLLDFSANINPLGMPVSVKRALIDNLDCIERYPDADYFHLHQALARHHQVPASWILAGNGETESIFTVASGL--KPRRAMIVTPGFAEYGRALAQSGCEIRRWSLREADGWQLDAILEALTPDL--DCLFLCTPNNPTGLLPERPLLQAIADRCKSNINLILDEAFIDFIPHE---TGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAMARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLTVYPGRANYLLLRCEREDIDLQRRLLTQRILIRSCA---SRYYRVAIRSAAQNERLLAALRNVLTG... 359
16 -51.2003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  17  22...............DFVVNLDHGDPTAYEEYWRKMGDRCTVSDMTNLCWFLEPELEDAIKDLHGTEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEGD-----------AWGFDKKGPYIELVTSPNNPDGTIR--ETVVNRPDD--DEAKVIHDFAYYWPHYTP--------ITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKKMVIVNSIGVSKESQVRTAKILNSENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKEETDLVSELRRHKVMSRAGER--KKHVRVSMLSREDVNVFLERLANMKLI... 386
17 -46.3001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  17  26................GAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYPPAGLPALREALAEEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDEGFRLDLSALEKALTPRT--RALLLNTPMNPTGLVFGERELEAIARLARADLFLISDEVYDELYYGERPRRLREFAPE---RTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQSFSAPTPLQAGVAEALKREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLM-AELPGWDAFRLVEEARVALIPASA--KDLFRFAFCKTEEEHLALERLGRVVNS... 370
18 -46.0002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  17  16......AKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTTYLKSCTLPFLEEAARWYE-PRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLREDGLADLKAVPEGVWREA--KVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIDNPYVDQVYEGEAPSPLA-LPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGDFNQYAGVLRMGVEALKPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEDDLEFGLRLVERGVALAPFGPGGKGFVRIALVRPLEELEAAKRIREALD.... 376
19 -45.2003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  15  17.........KEITPKKRGLDLGIGEPQFETPKFIQDALKNHTHSLNIYPKSAFESLRAAQRGFFELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPS-LNEKELQEV--DLVILNSPNNPTGRTLSLEELISWVKLALKDFILINDECYSEIYENTPPPSLLEACMEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAGYTSANAIQKASEAAWLDDRHAEFFRNIYANNLKLARKIFKNT---LIYPYSFYVYLPVQNGENFAKTLYQNEGIITLPALY--ADYVRLALVYDTPLEKPLEIIETYREN... 374
20 -44.1005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  11  2.TTQPQLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELVLWAESEQSEAHQAYFTLLGAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGADLSAELL-----SSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEGTVLALDTSFRGFDAAAHY-DHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDIGVSPLILALIREFSRDDGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVERVGRTGTEVWEELQRHHVFALPCRQ--DHMVRIALSRSTEPEKSVQVLRTVLET... 375
21 -44.0003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  16  48......AANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDIVNQYPTRGRPSLINSLIKLYSLKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPIGEEWTIDFEQFEKAITSKT--KAVIINTPHNPIGKVFTREELTTLGNICVKNVVIISDEVYEHLYFTDSFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNELLSYAAKAHTCFASPSPLQEACANSINKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLNKGKDFRISHWLINELGVVAKEHEKAAENLLRFAVCKDDAYENAVERLKLLKDY... 446
22 -43.7004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  16  27.VLEEWYRRHLGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAMDDSVSQGGEGVRRAIADRYGGDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGVRDGEIDPDVLAGLVTPGT--AAVIVNFPHNPTGVTLSPQGLRALKERTAAGAVLVWDAATAEIAHRWEVLADPGAD---GGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDTLFLSPLVELVAERAVRHDELIGARAAEARHNLAHLTGWMAAHEVRWTPPEGGVCALAGPQEVERFCLELLERHLLVPGTAFGAPHGARLGFGGPQEDRAGLDGLSRFLRE... 395
23 -43.6001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  19  22......KALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQKTKYPPAGIPELREALAEKFSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETEEGFVPDPERVRRAITPRT--KALVVNSPNNPTGAVYPKEVLEALARLAVEDFYLVSDEIYEHLLYEGEHFSPGRVAPE---HTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSTTSPDTIAQWATLEALASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLPIAPDEVRAAERLLEAGVVVPGTDFAAFGHVRLSYATSEENRKALERFARVLGRA.. 385
24 -43.3002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  18  28..FGKTMGRKIEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTINQKYAFHGKEAFKQAIVDFYQ-KEDEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEPPYLPDWSKVDSQIIDKT--KLIYLTYPNNPTGSTATKEVFDEAIAKFKGDTKIVHDFAYGAFGFDAKNPSILA-SENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTNAGMFGALQDAAIYALNYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVTPPGYDSEQFEQFLVQESILVKPFGENGNRYVRISLALDDQKDEAAIRLTELAYL... 396
25 -43.3001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  18  26......KAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQK-VKYDPRGIYELREGIAKRIDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETSKNFQPSLEEVEGLLVGKT--KAVLINSPNNPTGVVYRREFLEGLVRLAKKNFYIISDEVYDSLVYTDEFTSILD-VSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSTSCINTVAQYAALKALEVDN--SYMVQTFKERKNFVVERLKKMGVKFVPEGAFYLFFKVRGDDVKFCERLLEEKALVPGSAFLKPGFVRLSFATSIERTEALDRIEDFLNS... 382
26 -43.2003jtx_A mol:protein length:396 aminotransferase  ali model follow..  14  16.RLHEAMQGISAPEGMEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLELRQACANWLK-ADNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANCPAPFNPDWRSISEEVWKRT--KLVFVCSPNNPSGSVLDLDGWKEVFDLQDKGFIIASDECYSEIYFDGNKPLGCAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTGSAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDDLAFARNLWQKAAIQVLPGRF--EGYVRIALVADVATVKAAEDIVSLYR.... 396
27 -43.2003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  13  30.DLVALVTNLEKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREASIYPNLDGLELKQEASRFADIPARACVPTVGSMQSFLVANRTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKDVIVIEDLAYFGMDFRKDYSHYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPYALSSGATHSAQWGMAAMLDGEYNFRDSVIEYGRKARIMKKMFLDNGFNIVPLADGFYFGYKGMDSSKLIEKFVRYGMCAKTTGSKRNEAMRICTSLLPESPDLEKRLQMLNAEG.. 437
28 -43.2003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  15  63.........QEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLSGYAEQGQGALREAVASTFGRAADEIFISDGSKCDIARI-QMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMNHFFPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCGASNIVQAGGLACLQPEKEMNAMIKFYKENAQILKTTFTEMGFSVYGDDAPYIWVGFGKPSWDVFAEILERNIVTTPYGPAGEGFVRASAFGSRENLEAVRRFKEAYGK... 439
29 -43.0003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  15  19.......SAIYDIAGVSISSLTLEE-LFALSGTNPEDFYKKLQGLNYGWIEGSPAFKKSVSQLYGVKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIENGWLPDLEKLRQLIRPTT--KMICINNANNPTGAVMDRTYLEELVEIASEGAYILSDEVYRSFSELD-----VPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDMICAGVFDDLVAQLALAHQEILERNRHILEENLAILDQWIEEELVSYIRPAVVFVKIAVDMPMEDFCLQLLQEHLLVPGNRFERDGYVRLGFACEQETIKGLEKLSQFLRR... 370
30 -42.9002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  17  37...............EDIIDLSMGNPDGPTPPHIVEKLCTVAQRTHGYTSRGIPRLRRAISHWYR-PESEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLGIDFFNELERAIRESIPKP--RMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVDLAYADIVYDGWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSDYGTFTPLQVAAIAALEDQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVW-AHLGSLEFAKKLLQDKVSVSPFGDYGDDHVRFALIENRDRRQAVRGIKAMFRA... 397
31 -42.8004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  16  29................DVVNLGQGFPDFPPPDFAVEAFQHAVSGLNQYKTFGYPPLTKILASFFG-PLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLSSNWQLDPMELAGKFTSRT--KALVLNTPNNPLGKVFSREELELVASLCQQDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQVFHCPTQSQAAVAESFERSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLIDEPYDRRFVKWMIKNKGLVAVPHQKHFDHYIRFCFVKDEATQAMDEKLRKWKVE... 421
32 -42.5001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  19  20.........DIAAGMKDVISLGIGEPDFDTPQHIKEYAKEALDKLTHYPNIGLLELREAIAEKLK-PKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTEDEFRLNVDELKKYVTDKT--RALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVIDEVYEHFIYDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMATCPVTFIQYAAAKALRSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFDTGLTSKKFSELMLKEARVASAFGKAGEGYVRISYATAYEKEEAMDRMERVLKE... 385
33 -42.4001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  17  31................QAINLSQGFPDFDGPRYLQERLAHHVAQANQYPMTGVQALREAIAQKTE-ADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPHFRVDWQEFAALLSERT--RLVILNTPHNPSATVWQQADFAALWQAIAGEIFVISDEVYEHINFSQQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQTFSVNTPAQLALADMLREPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLL-STLDDVEFCQWLTQEHGVAAIPLSVFHKLIRLCFAKKESTLAAAERLRQL...... 386
34 -42.4003ele_A mol:protein length:398 Amino Transferase  ali model follow..  16  29.........AAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDLHGYSAQGDVETRAAIAEFLHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADTEFQIDFDALEERINAHT--RGVIINSPNNPSGTVYSEETIKKLSDEIGRPIFIIADEPYREIVYDGIKVPFVTKY---YDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAA-VCAPSLFQKMIVKCQG----ATGDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMF-LEDDSNAFCEKAKEEDVIVAADGFGCPGWVRISYCVDREMKHSMPAFEKIYKK... 395
35 -42.2002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  18  26................GAVNLGQGFPDEDGPPKMLQAAQDAIAGVNQYPGPGSAPLRRAIAAQRR-PETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLGRGFALDADALRRAVTPRT--RALIINSPHNPTGAVLSATELAAIAEIAVANLVVITDEVYEHLVFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQSYVGGAPFQPAVALALDEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCGYDDSTEFCAALPEKVGVAASQQADVWNHLVRFTFCKRDDTDEAIRRLSVLAER... 395
36 -42.2006DK6 Entity 1(prereleased)  ali follow..  17  36...............QRLIRCGIGDVTEALPEAVRYAMHEAVDELKGYPEQGYDFLRNAIADNDPIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLENGFVPDIPQEKA--DLIYLCYPNNPTGAVATRPQLEAWVKYAREGSVLLYDAAYEAFIQDPTIPHSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQ-GASYIVQKGAEALYTDKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVCPAGLTSWQMFDKMLNENVVITPFGSAGEGYFRISAFNSRAN--VEEVCRRIAA.... 409
37 -42.2001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  16  38................KPLNLGQGFPDYHAPKYALNALAAAANSANQYRGFGHPRLVQALSKLYS-PMTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKADWVLDNNELEALFNEKT--KMIIINTPHNPLGKVMDRAELEVVANLCKKNVLCVSDEVYEHMVFEPFEHIRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQVYTCATPIQEAIAVGFEPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVTDARKDYRFTKWMTKSGLQGEPNKHLGEDFVRYCFFKKDENQKAAEILRKWKGSS.. 429
38 -41.9006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  11  43................NLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQATYERFTEAFFQLHRLVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPL--YPIDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDDKLLLIDFCFASFTPELARFDMYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHT-LNVSPFVLNMLTQYVRDADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAHPELTATDVHRLLSADGVYVLPGRY--DAYVRMALAREPEMADAMALTRQVLDR... 404
39 -41.6002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  19  20......LAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEKTHYDSRGILELREKISELYDIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF------TVESLEEALSDKT--KAIIINSPSNPLGEVIDREIYEFAYEN---IPYIISDEIYNGLVYEGKCYSAIE-FDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLSAPTISQYAALKAFEKEREINSMIKEFDRRRRLVLKYVKDFGWEVNPIGAYYVFPNIGEDGREFAYKLLKEKFVAIGFGSKGKNYIRISYANSENIKEGLERIKEFLNK... 370
40 -41.5003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  16  27.........RLENPQHTVINLSIGDTTQPLNASVAEAFASSIARCRGYPDFGLPALRQKLSEDFYVDAKEIFISDGAKVDLFRL-LSFFGPNQTVAIQDPSYPAYLDIARLTGAKIIALPCLQE-----NAFFPEFPEDTHIDILCLCSPNNPTGTVLNKDQLRAIVHAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTGASIPAQEAGVAGLSILP-QLEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWQANISDRDLFDFFLREHIAITPFGRSGSGFVRFSSLGKREDLAACERLQMAPAL... 392
41 -41.4003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  16  39...............GRPVDFSHGDVDAHPTPGAFDSAGVQSGGVQAYEYRGDLGIRDLLAPRLA-ARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDTRAGLDLTGLEEAFKAGA--RVFLFSNPNNPAGVVYSAEEIGQIAALAARGATVIADQLYSRLRAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQASLRAAGYSQAVLRGWFDEPGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFKLAVAPAEFVKILRLQGVVVTEFSPHTADSVRLNFSQDHEAVAAARRIVTLVER... 404
42 -41.3004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  19  26.........QSISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDA-SHYGMAGLLALRQAASAFVK-PDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTRSNFVLTPEMLEEAILKEGELKAVILNYPTNPTGVTYSRQQIKNLAEVLKKPIFVISDEVYAELTYTGESHVSIAEYLP--DQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQVTAATTSVQFAAIEALTGKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIF-QGQDSFKFLQDFAKEKAVAVAFGKYGEGYLRISYAASMETKEAMKRLKEFMEQ... 390
43 -41.2002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  19  38................RIHHLNIGQPDLKTPEVFFERIYENKPEVVYYHSAGIWELREAFASYYDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIQNLESFINERT--KGIVLSNPCNPTGVVYGKDEMRYLVEIAERGLFLIVDEVYSEIVFRGEFASALSIESD---KVVVIDSVSKKFSACGARVGCLITRNEELISHAMKQGRLAPPLLEQIGSVGLLNDDSFFDFVRETYRERVETVLKKLEEHG--TKPSGAFYITAELPEDAEEFARWMLTDLRGFYLTPGLGKKEIRIACVLEKDLSRAIDVLMEGLKM... 395
44 -41.2003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  16  22......AARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETALGYVALGLPALRQRIARLYDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVP---ADFAGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAGASFISDEIYHGIEYEAKAVTALEL----TDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMCAPHASQVAALAALDCDAELQANLDVYKANRKLMLERLPKAG--APPDGAFYVYADVSDDSRAFAAEILEKAGVAVTPGLDFAGTLRFSYARAADIEEGLDRLEAFMQA... 381
45 -41.2005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  13  25................SVVNLGQGFPDISPPSYVKEELSKAADNMNQYRGFGHPALVKALSCLYG-PNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSDWTFDPRELESKFSSKT--KAIILNTPHNPLGKVYTRQELQVIADLCVKDTLCISDEVYEWLVYTGHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQFYTCATPLQAALAEAFWPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIDEPYDYKFVKWMTKHKKLTASKSKPHFEKLVRFCFIKKDSTDAAEEIFRAW...... 410
46 -41.1002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  14  56...............AQVISLGIGDTTEPIPEVITSAMAKKAHELSGYAEQGAKPLRAAIAKTFGIGDDDVFVSDGAKCDISRL-QVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKGSIIVYDSAYAMYMSDDNPRSIFE-IPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCGASNISQAGALACLTPEEAMHKVIGFYKENTNIIIDTFTSLGYDVYGKNAPYVWVHFPSSWDVFAEILEKTHVVTTPFGPGGEGFVRVSAFGHRENLEACRRFKQLYK.... 426
47 -41.1004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  16  71................QLISLGTGDTTEPIPEQITSHMSNFAHGLRGYLEQGNKTLRKAIAETFHVKSNEVFVSDGAQSDISRL-QLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVNSFFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDAKTNGSIIIFDSAYAAFIEDGSPRSIYE-IPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSGASNIAQAGGLACLSGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGVNAPYLWVHFGSKSWDVFNEILENTHIISGFGPGGEEYLRISGFGRRDHVEASKRLQNFFNT... 441
48 -40.5004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  15  44......EAKRLEEEGNKVLKLNIGN-GFDAPDEILVDVIRNLPTAQGYDSKGLYSARKAIMQHYDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCSSDWFPDLDDIRAKITPRT--RGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFDEIYDKILYDDAEHHSIAPLAPD-LLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEMRLCANVPAQHAIQTALQSISEFITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFNIHDDQKMVLDFLLQEKVLLTAFNWPWPDHFRIVTLPRVDDELSLSKFARFLSG... 421
49 -40.5001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  17  30...............IDVCSFSAGEPDFNTPKHIVEAAKAALEQKTRYPAAGEPRLREAIAQKLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTETQFKVSPEQIRQAITPKT--KLLVFNTPSNPTGMVYTPDEVRAIAQVAVEGLWVLSDEIYEKILDDAQHLSIGAASPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGTSNVCTFAQYGAIAAYESQDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFKTGRSSLDFCSELLDQHATVPGAAFGADDCIRLSYATDLDTKRGMERLEKFLHG... 386
50 -40.3005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  18  22......AAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLQLGYVALGIPELRDAIAADYTVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTQMLAEIDPPL--RGVVVASPANPTGTVIPPEELAAIASWCDADVRLISDEVYHGLVYQGAPQTSC--AWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFCPPVLSQIAAVSAFTPEAEADGNLASYAINRSLLLDGLRRIGIDRLTDGAFYVYADVSDDSLAFCSKLLADTGVAIAPGIDFGSFVRISFAGPGDIEEALRRIGSWLPS... 387
51 -40.1005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  18  99...............VPVIRLAAGEPDFDTPKVVAEAGINAIREFTRYLNAGITELREAICRKLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTSNNFLLDPKDLESKLTEKS--RLLILCSPSNPTGSVYPKSLLEEIARIIAKRLLVLSDEIYEHIIYAPATHTSFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGSSGASSIAQKAGVAALGGGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFGLINDSSSLALYFLDKFAMVPGDAFGDDSCIRISYATSLDVEKIRKALEPLRATVSV 475
52 -40.0001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  16  26........AKPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEANGYPTVGSPEAREAVATWWRIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCENDWEADLDEIRRLKDDKT--KLLIVTNPSNPCGSNFSRKHVEDIVRLAEERLPLFSDEIYAGMVFKGKDPNATFTSVADFETRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGM--PCTVVQAALGEALLNPQEHLDQIVAKIEESAMYLYNHIGECGLAPTPRGAMYLMSRIDKTDVEFFEKLLEEEQVLPGTIFHAPGFTRLTTTRPVEVREAVERIKAFCQR... 412
53 -39.5003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  16  48...............KTMISLSIGDGNLPTDPEVTQAMKDALDSYNGYPSIGFLSSREEIASYYHLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLEKSWEIDLKQLEYLIDEKT--ACLIVNNPSNPCGSVFSKRHLQKILAVAARCVPILADEIYGDMVFSDCKYEPLATLSTDVP-ILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLGPCTIVQGALKSILCRGEFYHNTLSFLKSNADLCYGALAAIGLRPVPSGAMYLMVGIEENDVEFTERLVAEQHCLPATCFEYPNFIRVVITVPEVMLEACSRIQEFCEQ... 417
54 -39.5001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  14  32.........HEVHNTNGIIQMGLAENQL-EAAAFKKNGESIFAELALFQDYHGLAFKKAMVDFMAFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRGVEIVPIHCTSSNGFQIEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGILISDEIYSGTAFSSPSFISVMEVLKDRQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGVSSQTQHLLSAMLSDKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGFCWVDMRHEMELWKKIVYEVHLNISSCHCTEPGWFRVCFANLPELDLAMQRLKAFVGE... 431
55 -38.9003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  16  31...............KTVISLSIGDGNLPTDPEVTQAMKDALDSYNGYPSIGYLSSREEVASYYHLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLEKSWEIDLKQLESLIDEKT--ACLVVNNPSNPCGSVFSKRHLQKILAVAERCVPILADEIYGDMVFSDCKYEPMATLSTNVP-ILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLGPCTIVQGALKSILQRQEFYQDTLSFLKSNADLCYGALSAIGLQPVPSGAMYLMVGIEENDVEFTERLIAEQHCLPATCFEYPNFFRVVITVPEVMLEACSRIQEFCEQ... 400
56 -38.8001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  15  30.........HPLKNPNGVIQMGLAENQLNPKGSICSEGIKSFKAIANFQDYHGLEFRKAIAKFMEFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRGVQLIPIHCESSNNFKIEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNILVCDEIYAQFVSIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSNDDVVNCARKMSSFGLVSTQTQYFLAAMLSDDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGFCWMDLRPEMSLWRVIINDVKLNVSSFECQEPGWFRVCFANMDDVDIALARIRRFVGV... 426
57 -38.7004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  16  55.........KPSRSTKSNLRLSIGDGNLKTPDIVTEAMVDVVRSFNGYPTVGADNLRQVVSTYWRLKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLSKSWECDLRAAAGMVDSHT--KAFVIINPSNPCGSNFSRAHVSDIIDFCQQQIPLISDEIYAEMVLNNGIFTSVADF-DTNVPRLILGGTAKYQVCPGWRVGWSILIDDWAVGMERLTQ-AGVNSICQEAIARTLCPTECTEHIVTQLEAGAKVYARLLEHDGISMEPQASMFVMLKLNKSDMEFYEKLLDEEQVLPGEIFGMSGFLRATVSRPSAVNEAVDRIIEFCER... 435
58 -38.5001xi9_A mol:protein length:406 putative transaminase  ali model follow..  17  23......PARELEKKGIKVIRLNIGD-DFQPPEHMKEAYCKAIKEHNYYDSEGLPELRKAIVEREDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTEEDWQPDIDDIRKKITDRT--KAIAVINPNNPTGALYDKKTLEEILNIAGEEIPVISDEIYDLMTYEGEHISPGSL--TKDVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARLCPNTPAQFAAIAGLTPMDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIF-PWKNDKEFVLDVLHNAHVLSGFGEYGAGHFRAVFLPPIEIEEAMDRFEKFMKE... 396
59 -37.4003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  14  103...............IDAVNYCHTELGLNRDKVVAEWVNGAVANNYPVPDRCLVNTEKIINYFLQAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLKNDWEIEPNEIEKLKDPSI--KALIVVNPTNPTSKEFDTNALNAIKQAVEKKLMIISDEVYGAFV------NFKSIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLD-LRQLHKRYSSVVLCADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLTNNFEQVDFLLKLAEKNLVDGVGFGAKPGELRVSQANLPTEALIGKQVLELLKE... 524
60 -36.8004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  16  28......NAAIEKYGREAVINAADDKGKIIALPSVYDRLDEMDRSIASYPIEGEKDYRKIVIDTL--GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFTDDFAFNIDVYKEAIDERDSDRIASLINGNNPTGYSLSDEEWDEVITFLKEKITLIVDVAYLEFAGDGDQQRKFFEKFSNLPRVVVAFSMSKSHTAYGLRSGAAVGSKEIIEEFEAARCNWSNGTHAAQNILIELEREQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPTDKAFDIVKDLEKENIFT-----PSAKGIRVAICGEEKIPKLVQRLAFYTNK... 412
61 -36.6003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  15  28.....AQADAKENGRENVVNGTDEEGNLVFLKTVKEEYLSLSDSHVGYPIAGIPDFLCAAEKEC--GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLDEHNNFNHEAFQNRVNEKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNVIIGIDVAYLDYSGEKDEVRAFFNKFSHLPKTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNNICRPAMRTMANIVADPAKRNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTDSANAICEELKKEHIYV------LANGIRIAACPKCQMTGLAEKIYNAMKS... 414
62 -36.3003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  15  104...............GKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYII-ESVNLFAVEGGTAAMSMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIALNWQYPDSELDKLKDPAI--KIFFCVNPSNPPSVKMDERSLERVVAEHRPDLMILTDDVYGTFADGFQ-----SLFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKQMTLFSLFALMDESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLVKQSSTGDMLFRIADETLLPGRGFGSDRPSGRASLANLNEYAAIGRALRQMADE... 521
63 -35.8001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  13  56...............GCSADVASGDEEYWKQHKEASAVLVSPWHRMSYFFNPVSELEKTIKELHEAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLR---------HAVIKGCKSIYDMVYYWPHYTP--------IKYKADEDILLFTMSKFTGHSGSRFGWALIDESVYNNLLNYMTTEGTPRETQLRSLKVLKERDLNTFGFKKLRERWVNITALLDQSDRRMRPPSPSYAWVKCEWEEDKDCYQTFQNRINTQNGVG--SRYVRLSLIKTQDDDQLMYYLKDMVKA... 424
64 -35.7002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  13  103...............GKSLSYVRDQLGLDPAAFLHEMVDGILGC--NYPVPPRMTVSEQIVRQYPPESVDLFAVEGGTAAMSLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIDNGWQYSDAELDKLKDPDV--KIFFCVNPSNPPSVKMDQRSLDRVRAIVAEDLLILTDDVYGTFADEFQ-----SLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRATLYRELGMPPLENPNSVNYYTLIDLQNTGDMLFRVADETGIVLGRGFGSDRPSGRASLANLNEYGRALRRLADELYEQY. 525
65 -35.5003if2_A mol:protein length:444 Aminotransferase  ali model follow..  17  33.PVNMLGGGNPAKIDAVNELFLETYKALGNDNDTGKANSSAIISMANYSNPQGDAFIDALVGFFNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEYRVDFEALENLPALKEGIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRDIPLIIDNAYGMPFPNIIYSDAH---LNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLTRFGAAIATPLVANDRIKQLSDNEIKPFVKLLKQALGDYPLMIHKPEGAIFLWDLPISTLDLYERLKAKGTLIVPSEY--HECIRMSIAADEQTKVIGEVVRELYDN... 443
66 -35.3003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  15  26..........DGLRTPGAIMLGGGNPAH-MQDYFQTLLTDMVESLCNYGPQGKTALLNALAVLLDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFVSAEGQFKYHVDFEHLHIGEET--GMICVSRPTNPTGNVITDEELMKLDRLANQNIPLVIDNAYGVPFPGIIFSEARPLWN---PNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLGGMGPAMMCEMIKRNDLLRLSETVIKPTIAIIRRYLSEERCLIHPEGAIFLWLWFKDTTELLYQRLKARGVLMDKPWPHTHQCMRMNYVPEPDKKILAEEIERAWREG.. 417
67 -35.3002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  12  40........SQSAEAKSTTYNATIGMATNKDGKMFASSLDAMFNDLFPYPPQGIEELRDLWQQKM--NMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQT-FDKDGHYTTDSLVEALQSYNKDKVIMILNPNNPTGYTPTHKEVTTIVEAIKAKVIAVVDDAYYGLFYEDVYTQSLFTALTNLHSPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKEVLEAKVSGPLPTQSAVKHVLKNEQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMA--DVDPEALRKHLIDKSIGV----ALNATDIRIAFSEKDDIPHVFDSIAKAIDD... 428
68 -34.9002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  15  104...............GKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYII-ESVNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAISLNWQYPDSELDKLKDPAI--KIFFCVNPSNPPSVKMDQRSLENIVAEHRPDLMILTDDVYGTFADDFQ-----SLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLVKQSSTGDMLFRIADETLLPGRGFGSNRPSGRASLANLNEYAAIGRALRKMADE... 521
69 -34.4003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  17  91....................LDSPSFPEDAKKRARRILQACGGNLGSYASQGVNCIREDVAAYITADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEEWALNVNELRRAVQEAKDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLDEVYQDFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMD-SREKESVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFQMAPDMFYCMKLLEETGICVVPGSREGTYHFRMTILPPVEKKTVLQKVKDFHIN... 486
70 -33.8003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  12  85...............PDLLQREEIKTLFSADSRAKQILAMIPGRTGAYSHSQGIGLRDAIASGIAANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESWGLETSDVKKQLEDARSVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLDEVYQEFHSFKKIVRSLGYGEEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASYKAEKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFNKAPDAFYALRLLESTGIVVVPGS---TWHFRCTILPQEDKPAVISRFTVFHEA... 483
71 -32.2004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  13  8.PILGLGQDFRMDPAKRKVNLSIGVRDDADQPFVLECVKQATLGTMDYPVTGIASFVEEAQKLCRIASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYPATKGLNLAGMLECLDKAPEGSVILVHAAHNPTGVDPTHDDWRQVCDVIKRNHIPFVDMAYQGFATGQLDYDVPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLELKACGSVHDWMMAYTGLTREQVELLRSEYHIYMTLNG-------RAAVSNSTNVEYVSQAIHNVTK.... 390
72 -31.7003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  11DPILGLADLFRADERPGKINLGDETGKTPVLTSVKKAEQYLLENTKNYGIDGIPEFGRCTQELLLINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYAENHTLDFDALINSLNEAQGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEGWLPLFDFAQQGFARGLEEDAGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMNPPAHGASVVATILSNDALLTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKMFSFSGLTKEQVLRLREEFGVYAVASG-------RVNVATPDNMAPLCEAIVAVL..... 396
73 -31.3005iwq_A mol:protein length:434 ASPARTATE AMINOTRANSFERASE  ali model follow..  15  58................................GKGDFKAADGTDVRNYGGLDGIDIRQIWADLLGVPVEQVLAGDASSLNIDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNED-GPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVAGNPNRFWAFTSTSKIT-LAGAGVSFFLTSAENRKWYTGHAGIRGINKVNQLAHARYFGDRAVMRKHAASLAPKFNKVLEILDSR---TVPAGGYFISLDVVPTASRVAELAKEAGIALTGAGSSYPKNLRLAPSPVEELEVAMDGVATCVLL... 418
74 -31.3003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  15  23...............QGVLPLWVAESDFSTCPAVLQAITDAVQREAFGYQPDGSLLSQATAEFYAARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT--GGINLHDVEKGFQA--GARSILLCNPYNPLGMVFAPEWLNELCDLAHRDARVLVDEIHAPLVFDGQHTVAAGVSDTAASVCITITAPSKAWNIAGLKCAQIISNPSDAEHWQQLSPVIGASTLGLIAAEAAYRYTDFLNQEVAYLKNNHDFLLHEIPKRGAKITPMQATYLFRDTTIEGSPSEFFIEKAKVAMNDFGEDGTGFCRLNFATSREVEEAIDRMAKAVSH... 375
75 -31.2002egy_A mol:protein length:397 Alpha-aminodipate aminotransferase  ali model follow..  17  53..............................AEAAARILREKGEVALQYSPTEGYPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEE-GPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPARKRLLQMVMEGLVVVEDDAYRELYFGEARLPSLFELAREYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQGADLPMLNQMLVHELLKESERLERVRRVYREKAQAMLHALDRE---TRPKGGMFVWMELPKSAEGLFRRALEENVAFVPANGGGENTLRLSYADREGIAEGVRRLGRALKG... 392

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.