current user: public

If you have questions about the server, please let us know.

Query: 3lys_A mol:protein length:112 Prophage pi2 protein 01, integrase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MDPIKQEISEYFKDWMELYKKNAIDEMTYKGYEQTLKYLKTYMPNVLISEITASSYQRALNKFAETHAKASTKGFHTRVRASIQCLIEEGRLQKDFTTRAVVKGLELast
1 -55.3003lys_A mol:protein length:112 Prophage pi2 protein 01, integrase  ali model  100  1MDPIKQEISEYFKDWMELYKKNAIDEMTYKGYEQTLKYLKTYMPNVLISEITASSYQRALNKFAETHAKASTKGFHTRVRASIQCLIEEGRLQKDFTTRAVVKGLE 106
2 -51.1002khq_A mol:protein length:110 Integrase  ali model follow..  25  2.....ITFADYFYQWYEVNKLPHVSESTKRHYESAYKHIKDHFRHKLLKDIKRTEYQKFLNEYGLTHSYETIRKLNSYIRNAFDDAIHEGYVIKNPTYKAELHASV 102
3 -46.1002kkp_A mol:protein length:117 Phage integrase  ali model follow..  16  2IEPSKITVEQWLNRWLTDYAKPHLRQSTWESYETVLRHVIPTLGSIPLKKLQPADIQRLYASKESGLSPTRVRYIHVVLHEAMSQARESGLLLQNPTEAAKPPRHP 109
4 -43.8002kiw_A mol:protein length:111 Int protein  ali model follow..  10  1......TFKQVADDWLKQYAN-DVKVSSVRAREKAIQHAIERFNTKPIQTIKKHDYQRFVDDISAQYSKNYVDSIVASTNMIFKYAYDTRLIKAMPSEGIKRPKKK 99
5 -42.5002kd1_A mol:protein length:118 DNA integration/recombination/invertion protein  ali model follow..  16  1MEPSKLSYGEYLESWFNTKR-HSVGIQTAKVLKGYLNRIIPSLGNIKLAKLTSLHMQNYVNSLDEGLKRGTIEKIIKVIRNSLEHAIDLELITKNVAAKTKLPKAD 107
6 -42.0002oxo_A mol:protein length:103 Integrase  ali model follow..  15  1.....MTLHSWLDRYEKILASRGIKQKTLINYMSKIKAIRRGLPDAPLEDITTKEIAAMLNGYIDEGKAASAKLIRSTLSDAFREAIAEGHITTNHVAATRAAKSE 101
7 -41.6002kob_A mol:protein length:108 Uncharacterized protein  ali model follow..  11  1....RDSFGDWAEKFLKSKEADGVSVSQLNSYKNYCRNHLSPLYMKSLSEILPADIQSIINET--KLAKNTLKAIRNTASQIFRLAIENRAIDFNPADYVRIPKIA 100
8 -35.6001z1b_A mol:protein length:356 Integrase  ali model follow..  14  70.SDNSVTLHSWLDRYEKILASRGIKQKTLINYMSKIKAIRRGLPDAPLEDITTKEIAAMLNGYIDEGKAASAKLIRSTLSDAFREAIAEGHITTNHVAATRAAKSK 174
9 -34.7006emy_A mol:protein length:317 Int protein  ali model follow..  1....SMTVCQLYAKQIR--HRGNVKHNTKLGRERLMRLEQDRLGSCPIDSVKLSDAKEWALRMEKGLSYKTINNDKRSLKAAFYTAIQDDCIRKNPFDFQLSDVLD 102
10 -25.2002kj5_A mol:protein length:116 Phage integrase  ali model follow..  3.EKNAYTVAQLADEYFERMIAGRWKHPN-IVRSRIEKDIKPAIGSLKVEDVKPRHIDDVLKAVMKRGAPSIANDTLRWLKRMFNYAIKRHIIEYNPAAAFD..... 101
11 -23.1002kj8_A mol:protein length:118 Putative prophage CPS-53 integrase  ali model follow..  13  1.SSNNNSFSAIYKEWYEHKKQVWSVGYATELAKMFDDDILPIIGGLEIQDIEPMQLLEVIRRFEDRGAMERANKARRRCGEVFRYAIVTGRAKYNPAPDLA..... 100
12 -22.2002key_A mol:protein length:112 Putative phage integrase  ali model follow..  11  4.PSDFKSFHDFVASYMKTYSR-RLEIGTFRHHKSCMRKFKEYCEGLQFHELTEDFLRDYLIYMTLCNADSTAQRNLSTIKIYVSAAIKKGYMENDPFKDFGLE... 106
13 -20.5003nrw_A mol:protein length:117 Phage integrase/site-specific recombinase  ali model follow..  10  3.ERPSLSPREARDRYLA-HRQTDAADASIKSFRYRLKHFVEWAEERAMRELTGWKLDEYETFRGSDVSPATLNGEMQTLKNWLEYLARIDVVDEDLPEKVHVPTIL 110
14 -20.5002kkv_A mol:protein length:121 Integrase  ali model follow..  3.NSGAYTFETIAREWHES-NKRWSEDHRSRVLRYLELYIFPHIGSSDIRQLKTSHLLAPIKEVDTSGKHDVAQRLQQRVTAIMRYAVQNDYIDSNPASDMA..... 101
15 -20.4002kj9_A mol:protein length:118 Integrase  ali model follow..  10  7.RNNTRAFKTVAKSWFAT-KTTWSEDYQRSVWTRLETYLFPDIGNKDIAELDTGDLLVPIKKIEKLGYLEIAMRVKQYATAIMRYAVQQKMIRFNPAYDLE..... 105
16 -16.6002khv_A mol:protein length:106 Phage integrase  ali model follow..  11  1.....MTFSECAALYIKAHRSSWKNTKHADQWTNTIKYCGPVIGPLSVQDVDTKLIMKVLDPIWEQ-KPETASRLRGRIESVLDWATVRGYREGDNPARWR..... 96
17 -15.0005c6k_A mol:protein length:292 Integrase  ali model follow..  15  10.PTDKRRLSELTQIWWDLK---GKHEEHGKSNLGKIEIFTKITNDPCAFQITKSLISQYCATRSQGIKPSSINRDLTCISGMFTALIEAEFFGEHPIRGTKRLKEE 113
18 -13.0005vfz_A mol:protein length:318 Gp33  ali model follow..  12VSSGFKGQYPMVNRWRTWQFAQSLSARTVEERVATVRRMAAWCG-VEPEFAQVEQIVSWLAEG-GNWSARTRWTYYGALSAWFLWLQQQGHRHDNPMVMIGRPKRP 115
19 -12.2002a3v_A mol:protein length:320 site-specific recombinase IntI4  ali model follow..  3........SQFLLSVREFMQTRYYAKKTIEAYLHWITRYIHFHNKKHPSLMGDKEVEEFLTYLQGKVATKTQSLALNSLSFLYKEILKTPLSLEIRFQRSQLERK. 101
20 -11.5001a0p_A mol:protein length:290 SITE-SPECIFIC RECOMBINASE XERD  ali model follow..  14  4.........ARIEQFLDALWEKNLAENTLNAYRRDLSMMVEWLHHLTLATAQSDDLQALLAEREGGYKATSSARLLSAVRRLFQYLYREKFREDDPSAHLASPKLP 104
21 -11.0005jjv_A mol:protein length:363 Tyrosine recombinase XerH  ali model follow..  47...NELNQACSSSQLEKVCKARNAGLLGINTYALPLLKFHEYFSKARLKNIDEVMLAEFLSVYTGGLSLATKKNYRIALLGLFSYIDKQNQDENEKSYIYNITLKN 160

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.