current user: public

If you have questions about the server, please let us know.

Query: 3nio_A mol:protein length:319 Guanidinobutyrase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# Score Template Links and tools%idFirst MDKNLHQPLGGNEMPRFGGIATMMRLPHVQSPAELDALDAAFVGVPLDIGTSLRSGTRFGPREIRAESVMIRPYNMATGAAPFDSLNVADIGDVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVNDHMFGEKIAHGTTFRRAVEEDLLDCDRVVQIGLRAQGYTAEDFNWSRKQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCQGLDLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVLPGVVRRLast
1 -108.0003nio_A mol:protein length:319 Guanidinobutyrase  ali model  100  1MDKNLHQPLGGNEMPRFGGIATMMRLPHVQSPAELDALDAAFVGVPLDIGTSLRSGTRFGPREIRAESVMIRPYNMATGAAPFDSLNVADIGDVAINTFNLLEAVRIIEQEYDRILGHGILPLTLGGDHTITLPILRAIKKKHGKVGLVHVDAHADVNDHMFGEKIAHGTTFRRAVEEDLLDCDRVVQIGLRAQGYTAEDFNWSRKQGFRVVQAEECWHKSLEPLMAEVREKVGGGPVYLSFDIDGIDPAWAPGTGTPEIGGLTTIQAMEIIRGCQGLDLIGCDLVEVSPPYDTTGNTSLLGANLLYEMLCVLPGVVRR 319
2 -104.0001gq6_A mol:protein length:313 PROCLAVAMINATE AMIDINO HYDROLASE  ali model follow..  38  2......ERIDSHVSPRYAQIPTFMRLPHD---PQPRGYDVVVIGAPYDGGTSYRPGARFGPQAIRSESGLIHGVGIDRGPGTFDLINCVDAGDINLTPFDMNIAIDTAQSHLSGLLKANAAFLMIGGDHSLTVAALRAVAEQHGPLAVVHLDAHSDTNPAFYGGRYHHGTPFRHGIDEKLIDPAAMVQIGIRGHNPKPDSLDYARGHGVRVVTADEFGELGVGGTADLIREKVGQRPVYVSVDIDVVDPAFAPGTGTPAPGGLLSREVLALLRCVGDLKPVGFDVMEVSPLYDHGGITSILATEIGAELLYQYARAHRT 311
3 -100.0003nip_A mol:protein length:326 3-guanidinopropionase  ali model follow..  47  1MSNDHPQPLDAAEIPRFAGIPTFMRLPAF---TDPAALQVGLIGVPWDGGTTNRAGARHGPREVRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPLSVGGDHLVTLPIFRALGR-ERPLGMVHFDAHSDTNDRYGDNPYTHGTPFRRAIEEGLLDPLRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVVGAGPTYVSFDVDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGATMMFELLCLLAESAAR 316
4 -96.6004dz4_A mol:protein length:324 Agmatinase  ali model follow..  37  19......SVYGSSIENTYAGVLSFMRRNYT---RDLDGVDVVVSGVPLDLATTFRSGARLGPSAVRAASVQLAELNPYPWFDPFDDLAVIDYGDCWFDAHHPLSIKPAIVEHARTILQSDARMLTLGGDHYITYPLLIAHAQKYGPLSLIHFDAHCDTWADDAPDSLNHGTMFYKAVKDGLIDPKASVQVGIRTWN--------DDYLGINVLDAAWVHEHGARATLERIESIVGGRPAYLTFDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLGGVNLIGADVVEVAPAYDQSEITAIAAAHVACDLLCLWRQRKAG 322
5 -92.6001wog_A mol:protein length:305 agmatinase  ali model follow..  32  1........MSGPAHLPYGGIPTFARAPLVQP-DGDWQADVAALGVPFDIALGFRPGARFAPRALREASLRSVPPFTGLDGKTLQGVTFADAGDVILPSLEPQLAHDRITEAARQVRGRCRVPVFLGGDHSVSYPLLRAFAD-VPDLHVVQLDAHLDFTDTRNDTKWSNSSPFRRACEA-LPNLVHITTVGLRGLRFDPEAVAAARARGHTIIPMDDVTADL----AGVLAQLPRGQNVYFSVDVDGFDPAVIPGTSSPEPDGLTYAQGMKILAAAANNTVVGLDLVELAPNLDPTGRSELLMARLVMETLCEVFDHV.. 304
6 -91.9003lhl_A mol:protein length:287 Putative agmatinase  ali model follow..  27  3................................LNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPFLDLDLED-YNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKAVHEKYNDIYVIHFDAHTDLREEYNNSKNSHATVIKRIWD--IVGDNKIFQFGIRS--GTKEEFKFATEEKHTYMEIGGI------DTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREFQEIFKIISNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIKE 280
7 -89.2003pzl_A mol:protein length:313 Agmatine ureohydrolase  ali model follow..  30  6.........NGREKDHASELRSIFSLKKIADANGYEEAKYVVFGIPFDNTSSYRRGSKYAPDSIRGAYVNLESYEYSYGIDLLA-SGMADLGDMEE-SEDVEYVIDTVESVVSAVMSDGKIPIMLGGEHSITVGAVRALPK---DVDLVIVDAHSDFRSSYMGNKYNHACVTRRALD--LLGEGRITSIGIRSV--SREEFEDPDFRKVSFISSFDVKKNGIDKYIEEVDR--KSRRVYISVDMDGIDPAYAPAVGTPEPFGLADTDVRRLIERL-SYKAVGFDIVEFSPLYD-NGNTSMLAAKLLQVFIASREKYYKE 303
8 -87.5003m1r_A mol:protein length:322 Formimidoylglutamase  ali model follow..  25  12.........EAGSSFKDRDVTKMSDLI--ATWDGQDIKGPALIGVPLSKSSISHSGASFAPGTIRQALKHSSAYSAELGEHVVS-ELLYDLGDIDIHVTDIVKSHHHIFQTMHALLSDHPVPLILGGDNSISYSTIKAIAQTKGTTAVIQFDAHHDVRNTEDG-GPTNGTPFRRLLDEEIIEGQHLIQLGIREFSNSQAYEAYAKKHNVNIHTMDMIREKGLIPTIKEILPVVQDDFIFISVDMDVLDQSHAPGCPAIGPGGLYTDELLEAVKYIQQPNVAGIEIVEVDPTLDFRDMTSRAAAHVLLHALKGMKLSPFK 322
9 -82.9002a0m_A mol:protein length:316 ARGINASE SUPERFAMILY PROTEIN  ali model follow..  20  4..............AARTDDPRLLSLFSA---QREEDADIVIIGFPYDEGCGGRAGAKKGPAAFRFFLQRLGSVNNLELNVDASHLKLYDAGDITAS--TLEEAHEKLESKVFTVLARGAFPFVIGGGNDQSAPNGRAMLRAFGDVGVINVDSHLDVRPPLQDGRVHSGTPFRQLLEESSFSGKRFVEFACQGSQCGALHAQYVRDHQGHLMWLSEVRKKGAVAALEDAFGLTGK-NTFFSFDVDSLKSSDMPGVSCPAAVGLSAQEAFDMCFLAKTPTVMMMDMSELNPLVE-EYRSPRVAVYMFYHFVLGFATRPKP 306
10 -81.1004rhm_A mol:protein length:351 Arginase  ali model follow..  20  2.............GSSSSGLVPRGSHMF----------SKFLMNVKGVTPRGSDWANRLGPVALFGYGAGMPRRAPLLDCDHYAELTIHDKGPIECPPETSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFDDIVIVHFDAHPDVSD--------PRSPLRVLLDKGLL--KGVVSVGNRQV--SSEDRKVRKLHKMFYMDMHAIYSKG----LFCIRDIRNDYPVFISIDADVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDNVGLTAIALSKIIKEGILKAYSISTH 319
11 -78.6004rhi_A mol:protein length:351 Arginase  ali model follow..  19  2.............GSSSSGLVPRGSHMFS------KFLMNVKGVTPRG----SDWANRLGPVALFGYGAGMPRRAPLLDCDHYAELTIHDKGPIECPPETSDEWYLGSLEASTELLEKGYVPVSVGGDGSATLSMVEAYKRLFDDIVIVHFSARPSVSD--------PRSPLRVLLDKGLL--KGVVSVGNRQV--SSEDRKVRKLHKMFYMDMHAIYSKG----LFCIRDIRNDYPVFISIDASVLDPAFAPAVDSPVAGGLSTRDLLHIMNGIRGPKVVGIDVYGYNPDLDNVGLTAIALSKIIKEGILKAYSISTH 319
12 -73.8001pq3_A mol:protein length:306 Arginase II, mitochondrial precursor  ali model follow..  26  2......................................SVAVIGAPFSQG-QKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSGNLHGQPVSFLLRELCISSASIVYIGLRDV--DPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTRE 305
13 -73.1005ynl_A mol:protein length:362 Arginase  ali model follow..  21  14.ETAAAKFERQHMDSPDLGTDDDDKMSPATSPFLATPRTAGIVGCPFSGG-QPKAGVHSGPLQLIESGLLNDIENLGWTVDALAVSIVSDTPDPDIGRLKVSRVTKDVADRVYAHASKGQLTVTLGGDHSLAMGTVSGTFKAYPEACLIWVDAHADINTPHTTSGRLHGCPVSFLLGLDCLKPERIVYIGLRDI--DAGERKILKDNNIKCFSMFHVDKYGIGKVVEMALDHVRTRPIHLSFDVDALDPSVAPSTGTAVRGGLTFREGHYICEAIETNLLVSLDIMEINPSLGALASVA-QTVDVGRSLVRCALGET.. 354
14 -73.1001d3v_A mol:protein length:323 PROTEIN (ARGINASE)  ali model follow..  22  2.................................SSKPKPIEIIGAPFSKG-QPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSGNLHGQPVAFLLKELCISAKDIVYIGLRDV--DPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKRE 309
15 -72.5001t5f_A mol:protein length:314 Arginase 1  ali model follow..  22  2......................................PIEIIGAPFSKGCP-RGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLAVIWVDAHTDINTPLTTSSGNAGQPVAFLLKELAISAKDIVYIGLRDV--DPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSAFGTKRE 304
16 -72.4001wva_A mol:protein length:322 Arginase 1  ali model follow..  24  2.................................SAKSRTIGIIGAPFSKG-QPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTSGNLHGQPVSFLLKELCISAKDIVYIGLRDV--DPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLARE 309
17 -70.6002eiv_A mol:protein length:291 Arginase  ali model follow..  28  3......................................RVAVVGVPMDLGAN-RRGVDMGPSALRYARLLEQLEDL--------GYTVEDLGDVPVSLARASRAAALVLKERLAALPEGVFPIVLGGDHSLSMGSVAGAAR-GRRVGVVWVDAHADFNTPESPSGNVHGMPLAVLSGLGAVDPKDVVLVGVRSL--DPGEKRLLKEAGVRVYTMHEVDRLGVARIAEEVLKHLQGLPLHVSLDADVLDPTLAPGVGTPVPGGLTYREAHLLMEILESGRVQSLDLVEVNPILDERNRTAEMLVGLALSLLGKRI..... 290
18 -68.9001xfk_A mol:protein length:336 Formimidoylglutamase  ali model follow..  19  16......DPEDGQAGRRVHHIACPIQVGEL----ANQEPGVALIGFECDAGVKGRTGAKHAPSLIKQALANLAWHH---------PIPIYDLGNIRCEGDELEQAQQECAQVIQQALPHA-RAIVLGGGHEIAWATFQGLAQHFPRIGIINFDAHFDLRSELAPVRPSSGTPFNQIHHFCQQQDFHYACLGVSRASNTPALFERADKLGVWYVEDKAFSPLSLKDHLTQLQHFIDDDYLYLTIDLDVFPAASAPGVSAPAARGVSLEALAPYFDRILHYKLMIADIAEYNPSFDIDQHTARLAARLCWDIANAMAEQVQS 332
19 -66.9006dkt_A mol:protein length:296 Arginase  ali model follow..  23  2....................................DKTISVIGMPMDLGQA-RRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPIIKNDEELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYDAHGDLNTLESPSGNIHGMPLAVSLGIGKIKPENVVIIGARSL--DEGERKYIKESGMKVYTMHEIDRLGMTKVIEETLDYLACDGVHLSLDLDGLDPNDAPGVGTPVVGGISYRESHLAMEMLYDAIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKL..... 295
20 -66.5001cev_A mol:protein length:299 PROTEIN (ARGINASE)  ali model follow..  26  3......................................PISIIGVPMDLGQT-RRGVDMGPSAMRYAGVIERLERLHYDIPIGKAERLHEQGDSRLRNKAVAEANEKLAAAVDQVVQRGRFPLVLGGDHSIAIGTLAGVAKHYERLGVIWYDAHGDVNTAESPSGNIHGMPLAASLGFGKIKPEHVVLIGVRSL--DEGEKKFIREKGIKIYTMHEVDRLGMTRVMEETIAYLKEDGVHLSLDLDGLDPSDAPGVGTPVIGGLTYRESHLAMEMLEAQIITSAEFVEVNPILDERNKTASVAVALMGSLFGEKL..... 298
21 -65.3004q3p_A mol:protein length:385 Arginase  ali model follow..  21  12...............GSHMMLKSVATPYQDEKPKLLYTSANFLGIPTNRG-QPKIGTYQGPELIRKSNFFQLVAEDGIQLTDCGDIIPVELNEAEDPQRRVEELMKQSNKHTVELSGSKSTPVIVGGDHSMATGTILGHAEAKPDLCVLWIDAHGDINTPLNSSGNMHGMPLSFLVKELCLNASNIAYIGLRDL--DAHETHDIRKHGIAYFTMLDVDRMGIEAVIKEALLAVLEKAIHLSFDIDALDPLVAPSTGTAVPGGLTLREGLRICEEVSATKLSVVELAELNPLLGSQEKTQSSAVHILRACLGHCRSGHLP 357
22 -65.3004ity_A mol:protein length:330 Arginase  ali model follow..  24  3................................GSGMAKKMSIVLAPFSGGQP-HSGVELGPDYLLKQGLQQDMEKLGWDTKVVEARKASDNGDRIGRVKRTAECTEKIYKCVRRVAEQGRFPLTIGGDHSIALGTVAGVLSVHPDAGVIWVDAHADINTMSGTSGNLHGCPLSILLGLDVLKPNKIAYIGLRAV--DDEEKKILHDLNIAAFSMHHVDRYGIDKVVSMAIEAVGTEPVMVSYDVDTIDPLYVPATGTPVRGGLSFREALFLCERIECGRLVALDVVECNPLLAATESHVNDTISVGCAIARCMMGETLL 315
23 -63.0004g3h_A mol:protein length:330 Arginase (RocF)  ali model follow..  17  1.......................................MILVGLEAELGAS-KRGTDKGVRRLREALSATHGDVIKQTITQERCVLYKEFRYAKNFEDYYLFCKENLIPCMKEVFEKKEFPLILSSEHANMFGIFQAFRSVHKKIGILYLDAHADIHTAYDSSKHIHGMPLGMVLNRVEIDPKCLVYFGVRST--EQSERDVIRELQIPLFSVDAIRE-NMQEVVQKTKESLAVDIIYLSLDLDIMDGKLFTSTGVRENNGLSFDELKQLLGLLLESRLKAVEVTEYNPTVSIKHNNEKQVLEILDLIINSCKIKDKK 315
24 -59.7003mmr_A mol:protein length:413 Arginase  ali model follow..  17  79................................NNYINNNDNNNDNNNDNNNDNNNNCYIPNGVIKEKKHDLSNNKMNNFYGNYEENNVISTNDKYKNNCEIGIFSKNLFDTMSNELRKKNFVLNIGGDHGVAFSSILSSLQMYQNLRVIWIDAHGDINIPESPSGNYHGMTLAHTLNLTYLKPENTAIIGIRDI--DAYEKIILKKCNINYYTIFDIEKNGIYNTICTALEKISNCPIHISLDIDSVDNVFAPGTGTVAKGGLNYREINLLMKILETKRVVSMDLVEYNPSLDEVDKKVHGDSLPILDNATKTGKLCLE 396

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Godzik A. JAFA: a protein function annotation meta-server. Nucleic Acids Res. 2006 Jul 1;34(Web Server issue):W379-81.