current user: public

If you have questions about the server, please let us know.

Query: 3nra_A mol:protein length:407 aspartate aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst GMSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYRALast
1 -122.0003nra_A mol:protein length:407 aspartate aminotransferase  ali model  100  1GMSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGAPIEGRPVDFSHGDVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDYVSADETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYRA 407
2 -109.0001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  20  2......ALSDRLELVSASEIRKLFDIAAG---------KDVISLGIGEPDFD--TPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKKQNGIEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTY----EEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLDGM-FERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSWVEEMRKEYDRRRKLVWKRLNEM-GLPTVKPKGAFYIFPRIRDTGLTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAYEKLEEAMDRMERVLKERK. 387
3 -107.0004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  20  3.MDLSKRFNKNLNKIEVSMIRQFDQSISD---------PDVLKLTLGEPDFA--TPKHIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKEKYHLTYNPDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTR-----SNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEY---LPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAM-KFKIIKPDGAFYIFAKIPVQGQDSFKFLQDFAKEKAVAFIPGVAFGKYGEGYLRISYAASMETIKEAMKRLKEFMEQYA. 392
4 -102.0001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  24  2.....RGLSRRVQAMKPSATVAVNAKALELRRQGV----DLVALTAGEPDFD--TPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTP-EETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETL----PEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHF----SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAFVEMAREAYRRRRDLLLEGLTAL-GLKAVRPSGAFYVLMDTSPIAPDEVRAAERLL-EAGVAVVPGTDFA--AFGHVRLSYATSEENLRKALERFARVLGR... 384
5 -102.0001xi9_A mol:protein length:406 putative transaminase  ali model follow..  19  1..AGSIRASKRALSV-EYAIRDVVLPARELEKKGI----KVIRLNIGDPVFDFQPPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKRKNGVDITP-DDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTI----EEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEG-EHISPGSLTK--DVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVPWKNDKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPPIEILEEAMDRFEKFMKERLK 399
6 -101.0001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  22  2......KLAARVESVSPSMTLIIDAKAKAMKAEGI----DVCSFSAGEPDFN--TPKHIVEAAKAALEQGKTRYGPAAGEPRLREAIAQKLQRDNGLCYGA-DNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTT----VETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAASPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDCVQEMLAAFAERRRYMLDALNAMPGLECPKPDGAFYMFPSIAKTGRSSLDFCSELLDQHQVATVPGAAFG--ADDCIRLSYATDLDTIKRGMERLEKFLHGI.. 387
7 -99.7001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  19  9.MHNKFDLPKRYQGSTKSVWVEYIQLAAQY---------KPLNLGQGFPDY--HAPKYALNALAAAANSPANQYTRGFGHPRLVQALSKLYSQLVDRTINPMTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNTISSADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLPGM-WERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFESPECYFNSISGELMAKRDYMASFLAEV-GMNPTVPQGGYFMVADWSSLARKDYRFTKWMTKSVGLQGIPPSAFYSEGEDFVRYCFFKKDENLQKAAEILRKWKGS... 428
8 -99.1002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  18  11..RGSHMISNKLANIPDSYFGKTMGRKIEHGPL------PLINMAVGIPDG--PTPQGIIDHFQKALTIPENQYGAFHGKEAFKQAIVDFYQRQYNVTLDKEDEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL-----EPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDA-KNPSILASENG-KDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKA-DLPFVHAKGGIYVWLETPP-GYDSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLALDDQKLDEAAIRLTELAYLYE. 398
9 -99.1005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  20  2.......NAKRIEGLDSNVWVEFTKLAAD---------PSVVNLGQGFPDI--SPPSYVKEELSKAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDSSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLPGM-WERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWDPECYFNSLPKELEVKRDRMVRLLNSV-GLKPIVPDGGYFIIADVSSLGAYDYKFVKWMTKHKKLTAIPVSAFCDSFEKLVRFCFIKKDSTLDAAEEIFRAW...... 410
10 -98.2001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  19  1.MTNNPIPQSKLPQLGTTIFTQMSALAQQ---------HQAINLSQGFPDF--DGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ-----PPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHPQL-RERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNES-RLEILPCEGTYFLLVDYSAVTLDDVEFCQWLTQEHGVAAIPLSVFCPFPHKLIRLCFAKKESTLLAAAERLRQL...... 386
11 -97.9003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  20  2.....SLKNSSRSAVDPFIVMDVMEAARRAEEAGR----RIIHMEVGQPGT--GAPRGAVEALAKSLETDALGYTVALGLPALRQRIARLYGEWYGVDLDP-GRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTA----PENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALE-----LTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALDCDAE-LQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVSDLTDDSRAFAAEILEKAGVAVTPGLDFDPEGAGTLRFSYARATADIEEGLDRLEAFMQARG. 383
12 -97.2002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  18  5..KIMDVFSDRVLLTEESPIRKLVPFAEMAKKRGV----RIHHLNIGQPDL--KTPEVFFERI-YENKPEVVYYSHSAGIWELREAFASYYKRRQRVDVKP-ENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRR----MEEGFAIP-QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEF----ASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELP--VEDAEEFARWMLTDFNTMVAPLRGFYLTGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCS 398
13 -97.2002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  23  1......MLSKRLLNFESFEVMDILALAQKLESEGK----KVIHLEIGEPDF--NTPKPIVDEGIKSLKEGKTHYTDSRGILELREKISELYKDKYKADIIP-DNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF------------TVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEG-KCYSAIEFDEN-LEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKETEEINSMIKEFDRRRRLVLKYVKDF-GWEVNNPIGAYYVFPNIGE---DGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYANSYENIKEGLERIKEFLNK... 370
14 -97.1004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  21  3....KQLQARRLDGIDYNPWVEFVKLASE---------HDVVNLGQGFPDF--PPPDFAVEAFQHAVSGDFNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLK-ELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGM-WERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEQPSSYFVQFPQAMQRCRDHMIRSLQSV-GLKPIIPQGSYFLITDISDFKRYDRRFVKWMIKNKGLVAIPVSIFYKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELEN 424
15 -96.9002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  23  2......ATVSRLRPYATTVFAEMSALATRI---------GAVNLGQGFPDE--DGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLV---PDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFDGM-AERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEI-GFAVHDSYGTYFLCADPRPLGYDSTEFCAALPEKVGVAAIPMSAFCDPAAGLVRFTFCKRDDTLDEAIRRLSVLAERPAT 398
16 -96.8001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  21  3..SDKIMVSRRISEIPISKTMELDAKAKALIKKGE----DVINLTAGEPDFP--TPEPVVEEAVRFLQKGEVKYTDPRGIYELREGIAKRIGERYKKDISP-DQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETF----MSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTD-EFTSILDVSEG-FDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNS---YMVQTFKERKNFVVERLKKM-GVKFVEPEGAFYLFFKVRG---DDVKFCERLLEEKKVALVPGSAFL--KPGFVRLSFATSIERLTEALDRIEDFLNS... 382
17 -96.4003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  14  24.VANKYFTSNTAKDVWSLTNEAAAKAANNSKNQGR----ELINLGQGFFSY--SPPQFAIKEAQKALDPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKA-ENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINQRNTRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSPEI-GQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDALKYFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIKDFRISHWLINELGVVAIPPTEFYKAAENLLRFAVCKDDAYLENAVERLKLLKDYL.. 447
18 -95.6005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  23  2.....TDRVALRAGVPPFYVMDVWLAAAERQRTHG----DLVNLSAGQPSA--GAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEP-DAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCG----PQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCAW---QTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFDTAGGSFVRISFAGPSGDIEEALRRIGSWLPS... 387
19 -95.3005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  21  66.SSVDMSLSPRVQSLKPSKTMVITDLAATLVQSGV----PVIRLAAGEPDFD--TPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKEENGLSYAP-DQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTK----ISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHTSFASLPDM-YERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYNDSSSLALYFLDKFQVAMVPGDAFG--DDSCIRISYATSLDVLQAAVEKIRKALEPLRA 471
20 -95.0004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  18  19GAMSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGN----KVLKLNIGNPAFGFDAPDEILVDVIRNLPTA-QGYCDSKGLYSARKAIMQHYQARGMRDVTV-EDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCD----ESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAP--DLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHEGLEMLASMRLCANVPAQHAIQTALGGYQSISETPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYH. 423
21 -93.5002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  20  1GMAESRRRFARIDRLPPYVFNITAELKMAARRRGE----DIIDLSMGNPDG--PTPPHIVEKLCTVAQREDTHYSTSRGIPRLRRAISHWYRDRYDVQIDPESEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLV----PGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQVPGA-KDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREA-GWMVENPKASMYVWAKIPEPHLGSLEFAKKLLQDAKVSVSPGIGFGDYGDDHVRFALIENRDRLRQAVRGIKAMFRADGL 400
22 -93.0001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  22  2......RLHPRTEAAKESIFPRMSGLAQRL---------GAVNLGQGFPSN--PPPPFLLEAVRRALG-RQDQYAPPAGLPALREALAEEFAVE-------PESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDL---TPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERPR----RLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKRREGFYEALREGYRRRRDLLAGGLRAM-GLRVYVPEGTYFLMAELPG------WDAFRLVEEARVALIPASAFYDPPKDLFRFAFCKTEEELHLALERLGRVVNSPRE 373
23 -92.1002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  23  3............RVPEPSVFLVVDEAKRKARERGV----GLIDLSIGSTDL--PPPEAPLKALAEALNDPTTYYCLKSCTLPFLEEAARWYEGRYGVGLDPRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL------REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEG-EAPSPLALPGA-KERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGV--LSLLPPRATMYLWGRLPE-GVDDLEFGLRLV-ERGVALAPGRGFGPGGKGFVRIALVRPLEELLEAAKRIREALD.... 376
24 -91.2003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  15  34..TIDVQRNENFGKLRAGPEIARRRKAHQEKNPDA----KIISLGIGDTTE--PLPKYIADAAGLATREGYSGYGAEQGQGALREAVASTFYGHAGRAA---DEIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGF----DGIEYMVCNPPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGA-DEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQEGLKEMNAMIKFYKENAQILKTTFTEM-GFSVYGGDDAPYIWVGFP--GKPSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFGSRENILEAVRRFKEAYGKRNA 442
25 -89.5001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  17  1.MSSWDVSMSNHAGLVFNPIRTVSDNA-----KPSPSPKPIIKLSVGDPTLD--KNLLTSAAQIKKLKEACNGYFPTVGSPEAREAVATWWRNSFVHKEEVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCR----PENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDFTSVADFETT--VPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKKTDVEFFEKLLEEENVQVLPGTIFH--APGFTRLTTTRPVEVYREAVERIKAFCQRHAA 415
26 -89.4003jtx_A mol:protein length:396 aminotransferase  ali model follow..  18  2.......MNTLLKQLKPYPFARLHEAMQGISAPE----MEAVPLHIGEPKH--PTPKVITDALTASLHEL-EKYPLTAGLPELRQACANWLKRRYGLTVDADNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-----PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQLRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQH-VIDNRRLYQEKFERVIPILQQV--FDVKLPDASFYIWLKVPD--GDDLAFARNLWQKAAIQVLPGRFLGNPGEGYVRIALVADVATCVKAAEDIVSLYR.... 396
27 -87.2003ele_A mol:protein length:398 Amino Transferase  ali model follow..  21  1GMVVNESMYQLGSVRSAIRELFEYGKKRAAIVGK----ENVYDFSIGNPSI--PAPQIVNDTIKELVTDALHGYTSAQGDVETRAAIAEFLNNTHGTHFNA-DNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPAD-----TEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFVTKY----YDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGACAPSLFQKMIVKCQGA-----TGDINAYKENRDLLYEGLTRI-GYHCFKPDGAFYMFVKAL--EDDSNAFCEKAK-EEDVLIVAADGFG--CPGWVRISYCVDREMIKHSMPAFEKIYKKYN. 397
28 -87.2002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  15  21..KTKVSRNSNMSKLQAGPEIARRRSAHLLKYPDA----QVISLGIGDTTE--PIPEVITSAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIG---DDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDD-NPRSIFEIPGA-EEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTEGLEAMHKVIGFYKENTNIIIDTFTSL-GYDVYGGKNAPYVWVHFPN--QSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHRENILEACRRFKQLYK.... 426
29 -86.4006DK6 Entity 1(prereleased)  ali follow..  15  3.LINENFLKLKAGYLFPEIARRVKAFTEGNPEAAQ----RLIRCGIGDVTE--ALPEAVRYAMHEAVDETFKGYGPEQGYDFLRNAIADNDYKARGLPIEA-DEIFISDGSKCDTGN-ILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAG--LKCTPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIEGA-RDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKSRRHSTKFNGASYIVQKGAEALYTDGKSQTKALIEHYMGNAALLVEACKNA-GLSVFGGVNAPYVWVGCPA-GLTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFNSRANVEEVCRRIAAL...... 410
30 -84.5003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  16  16.....DNLNPKVLKCEYAVRGEIVIHAQRLQEQLKTDHPDLLQREEIKTLFSADSISRAKQILAMIPGRATGAYSHSQGIHGLRDAIASGIASRDGFPANA-DDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLN----ESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDKKFHSFKKIVRSLLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNIPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICANKAPDAFYALRLLESTGIVVVPGSGFGQVGTWHFRCTILPQEDKIPAVISRFTVFHEAFMS 486
31 -83.3004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  14  33GGSTKLVRNVNLEKLKNNPEINRRELEHIEKHPNV----QLISLGTGDTTE--PIPEQITSHMSNSTVEGYRGYGLEQGNKTLRKAIAETFYRDLHVK---SNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPCGPNNPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDG-SPRSIYEIPGA-REVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSGGLKEIRSVNNYYKENRKILMDTLVSL-GLKVYGGVNAPYLWVHFKGS--KSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTK 444
32 -83.2004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  18  29..TSFRRIASSKHAQRTLQPLNNLTDNMKPSRSTK----SNLRLSIGDPTVNLKTPDIVTEAMVDVVRSGKNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLD----PSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDTN--VPRLILGGTAKYQVCPGWRVGWSILIDDWAVGMERLTQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSYFSDMEFYEKLLDEENVQVLPGEIFG--MSGFLRATVSRPSAVLNEAVDRIIEFCERHK. 437
33 -83.1003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  18  16..SMWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNK----TMISLSIGDPTVNLPTDPEVTQAMKDALDSGYNGYAPSIGFLSSREEIASYYHCP-EAPLEA-KDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLL----PEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLS--TDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDQRILGPCTIVQGALKSILRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFNDVEFTERLVAEQSVHCLPATCFE--YPNFIRVVITVPEVMMLEACSRIQEFCEQHY. 419
34 -83.1003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  15  2......KRNPHFVSLTKNADLQKRVAQFRLENPQH----TVINLSIGDTTQ--PLNASVAEAFASSIARTCRGYGPDFGLPALRQKLSEDFYRGF-----DAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEI---IALPCLQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDA-RFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ--LEAIHYYRENSDLLRKALLAT-GFEVFGGEHAPYLWVKPTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPALQS. 394
35 -83.0003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  16  52....IKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCT--YPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLD----EENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPCRFHSFKKVLYEMNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLLSVRCPPVSGQAAMDIVVNPPVAGEESFEQFAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPMAPDMFYCMKLLEETGICVVPGSGFGREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLE 489
36 -82.4003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  18  2............MTFEPYPFERLRALLKEITPK-----KRGLDLGIGEPQF--ETPKFIQDALKNHTH-SLNIYPKSAFEESLRAAQRGFFKRRFKIELKE-NELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLT----KENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSLLELAGNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWLDDRH-AEFFRNIYANNLKLARKIFKNTL-----IYPYSFYVYLPVQ----NGENFAKTLYQNEGIITLPALYLGRNGADYVRLALVYDTPLLEKPLEIIETYRENH.. 375
37 -81.9004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  18  11..RGSHMSSLRPRREDPPVLEEWYRRHLG------PDIHDISSSGVHPYSFA--EIRDVCRIPAADLDAVVMDDSVSQGGEGVRRAIADRYAGG------DADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGR----AVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADPGAD----GGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAERAVRHADELIGARAAEARHNLAHLTGWMAAHEEVRWTPPEGGVCALPVFRELPQEVERFCLELLERHRTLLVPGTAFG--APHGARLGFGGPQEDFRAGLDGLSRFLRERAA 398
38 -81.6003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  19  2.....NVRPSDMSNKTFNPIRAIVDNMKVKPNPNK----TVISLSIGDPTVNLPTDPEVTQAMKDALDSGYNGYAPSIGYLSSREEVASYYHCP-EAPLEA-KDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLL----PEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATLS--TNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEILSQRILGPCTIVQGALKSILRTPQEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEHFNDVEFTERLIAEQSVHCLPATCFE--YPNFFRVVITVPEVMMLEACSRIQEFCEQ... 400
39 -81.2003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  15  1GMNREKQNELHIKDLGMASIRDLVALVTNLE---KATGTKFCRMEMGVPGL--PAPQIGIETEIQKLREGVASYPNLDGLPELKQEASRFAKLFVNIDIPA-RACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLF----EYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDEPLYQPSVAN-YTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPALYALSSGATHSAQWGMAAMLKACNDNFRDSVIEYGRKARIMKKMFLDVYDKDGNEPLADGFYFT-VGYKGMDSSKLIEKFVRYGMCAITLK-TTGSKRNEAMRICTSLLPESFPDLEKRLQMLNAE... 436
40 -80.1003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  13  77........YINTDGIRERLFAFLDPDKNDEDKFLI----DAVNYCHTELGLN--RDKVVAEWVNGAVANN--YPVPDRCLVNTEKIINYFLQELSDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLH--SYEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSVV------PYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVRLCADSRSIGLYHTAGLSTPQQIMEALFSMTHLLTSDTNTHYYSLIDIYRLNFEQVDFLLKLAEKNGVVLVDGVGFG-AKPGELRVSQANLPTEYALIGKQVLELLKEYYE 527
41 -80.0001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  16  2.....RMLSRNATFNSHGQDSSYFLGWQEYEKNPVHNTNGIIQMGLAENQLAKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRTGEIVPIHCT----SSNGFQITETALEEAYNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKDVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKS-GISCLNGNAGLFCWVDMRHLFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLERTLDLAMQRLKAFVGEYYN 434
42 -79.2003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  16  1........GMKLPRFGVEEWLNVHENSAIYDIAG----VSISSLTLEEL----ALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYTG-------KPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIE----EENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELDVPSII------EVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALAHYQEILERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVKIAV-DMPMEDFCLQLLQEHGVLLVPGNRFE--RDGYVRLGFACEQETLIKGLEKLSQFLRRFDK 373
43 -76.5006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  12  9.VPRGSHMHPQATPAPGAPLLDLTQHEIQALTMKY----NLADAHTHQRQS--ASQQSIVSRLPQLWYEA-EEGLQATYEKRFTEAFFQLHRQPTAL---VKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPID------ESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMYEENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVDSAADRLASVREVLTRNRECARKTLDGS-ILEYQEPVVKSVAWFRVDHPE-LTATDVHRLLSADGVYVLPGRYFPSKGDAYVRMALAREPEMFADAMALTRQVLDRHG. 406
44 -75.8005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  18  6............................QLKENLTQWAYLALNSELNIADGH--ARQALSPGQQKIVNELPVLWAESEQRPEAHQAYFTLLGQ-HGYPAEP-GRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEED---------ALHGADLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAA-HYDHYAVLQEA-GCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSDAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVE--VAFAGRTGTEVWEEL-QRHHVFALPCRQFHSDGDHMVRIALSRSTEPLEKSVQVLRTVLET... 375
45 -74.4001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  14  1......ILSKLATNEEHGENSPYFDGWKAYDSDPLKNPNGVIQMGLAENQLKRNPKGSICSEGIKSFK-AIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGQLIPIHCE----SSNNFKITSKAVKEAYENKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILDENKDLVHIVYSLSKDMGLPGFRVGIIYSFDDVVNCARKMSSFGVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVV-GIKCLKNNAGLFCWMDLRPLFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGVDIALARIRRFVGVEK. 428
46 -74.2003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  16  1GMTFSLFGDKFT---RHSGITRLMEDLNDGLRT-----PGAIMLGGGNPAHIPAMQDYFQTLLTDMVESGKCNYDGPQGKTALLNALAVLLRETLGWDIEP-QNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFVSANIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVPFPG----IIFSEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNRLSETVIKPFYYQRVQQTIAIIRRYERCLIHKPEGAIFLWLWFKDL-PITTELLYQRLKARGVLMVPGHYFFPGTHQCMRMNYVPEPDKIEAGVKILAEEIERAWR 415
47 -74.0002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  14  64.LSYSYMTVGVGGLAKLDGIEGRFERAEHRDQEGVKFLGKSLSYVRDQLGLD--PAAFLHEMVDGILG---CNYPVPPRMLTVSEQIVRQYIVREMAGGAESVDLFAVEGGTAAMALRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIH--ADPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSVC------PRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQ------LPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQNYYTLIDLQNVQSSTGDMLFRVADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRALRRLAD... 519
48 -73.4003if2_A mol:protein length:444 Aminotransferase  ali model follow..  15  1GMKFSKFGQKFT---QPTGISQLMDDLGDALKSD----QPVNMLGGGNPAKIDAVNELFLEKANSSAIISMANYSNPQGDSAFIDALVGFFNRHYDWNLTS-ENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDGEYRVDFEALEALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYSDAHLNW----DNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVANDQLSDNEIKPFYQKQATLAVKLLKQA-PLMIHKPEGAIFLWLWFKDLPISTLDLYERLKAK-GTLIVPSEYFFPGAHECIRMSIAADEQTLIDGIKVIGEVVRELYD 442
49 -73.1002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  14  70......TTVGVGGLAKIDGIEGRFERAENRDQEGVRFLGKSLSYVRDQLGLD--PAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSENLFAVEGGTAAMALKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN--ADPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAIC------PENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDHTLKQLIRRRETTLYRELGMPPLRD-ENAVDYYTLIDLQDVQSSTGDMLFRIADETGIVLLPGRGFG-SNRPSGRASLANLNEYEYAAIGRALRKMAD... 520
50 -72.4003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  15  77.......LAKIEGIEGRFERYIAENRDQEGVRFLG----KSLSYVRDQLGLD--PAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSENLFAVEGGTAAMAMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIN--ADPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSLFA------ICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDRLVAQLIRRREATLYRELGT-PPQRDENAVDYYTLIDLQDVQSSTGDMLFRIADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRLRQMADELYA 524
51 -68.7002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  13  2AMNLAQSLNEQLQQSNATAFAMLSDLGQNMLSQSAEAKSTTYNATIGMATNKDGKMSSLDAMFNDLTPDEIFPYAPPQGIEELRDLWQQKMLRDNELSIDNMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQT----YPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSLFTALTNLHSNPIRLDGATKEFFAWGFRVGFMTFGEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFIQTLKERYEVTKEVVYADQYH-SHWQAYDFNSGYFMAIKVHDV--DPEALRKHLIDKYSIGVIALNATD------IRIAFSCEKDDIPHVFDSIAKAIDDLR. 430
52 -63.7004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  15  1SNAMPMTIKRATWNNGPDLAFDINNKANAAIEK--YGREAVINAALGTLLDDKGKIPSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKP--EGYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEF-FTDDFAFNIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEKFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGSKEIIEEFEASLAHSARCNWSNGTHAAQNILKIYEQELVDLRNMLKSRADVFVTAAKEN-KLTMIPYFGGFFTFIPT-----DKAFDIVKDLEKENIFTIPSAKGI-------RVAICVGEEKIPKLVQRLAFYTNK... 412
53 -63.6005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  10  1.....SSWWTHVEMGPPDPILGVTEAFKRDTNS------KKMNLGVGAYRDDNGLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRY----YDPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGM---KPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLA--HAIHQVTK........... 401
54 -63.1001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  12  1.......MLGNLKPQAPDKILALMGEFRADPRQGK------IDLGVGVY--DATGHTPIMRAVHAAEQETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRY----FDAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMASFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMLGATPEQVKRIKEEFGIYMVGDS----------RINIAGNDNTIPILARAIIEVG..... 393
55 -62.6003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  13  1.......MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSGLYYNEDGIIPQL--QAVAEAEARLNAQPHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRATIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPW----YDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMTGLSAAQVDRLREEFGVYLIASG----------RMCVAGNTANVQRVAKAFAAVM..... 397
56 -62.3004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  13  2......AMFEHIDAYPGDPILTLNENFQKDPRD------QKVNLSIGIYFDAEGMGAVREAETALQRDSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIATLGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPY----YDEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLASNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKQRGMTGLTESQVDALREVHGVYILRSG----------RMCVAGNDSNVGIVADAIGKVLKSGA. 402
57 -62.0003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  12  1.......MFENITAAPADPILGLADLFRADERP------GKINLGQGVYKDETGVLTSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY----YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---TKEQVLRLREEFGVYAVASG----------RVNVAMTPDNMAPLCEAIVAVL..... 396
58 -61.8003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  10  6....SVAAKHAKGKKLKDVIFVTAGQAQADAKE--NGRENVVNGTLGDEEGNLVFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKECFGNFRP--EGHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL------DEHNNFNHEAFQNRVKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKFSHLPKETCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVTWSNICRPAMRTMANIVADPEAERNCYYQLIRDRADIFKQEAAQV-GLPMLPYRGGFFITIPTD----SANAICEELKKEHIYVIALANGIRIAACGIPKCQMTGLAEKIYNAMKSLGKL...... 418
59 -61.7003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  13  2...........VKLENSRKPEKISNKNIPM--------DFVVNLDHGDPTAY--EEYWRKMGDRCTVGCDLMSYFSDMTEPELEDAIKDLHGVVGNAATED-RYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEGD---------------AWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYTPIT---------RRQDHDIMLFTFSKITGHAGSRIGWALVKDKVAKKMVEYIIVNSIGVSKESQVRTAKILNESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYPAFAWLGTKEETDLVSELRRHKVMSRAGERCG-SDKKHVRVSMLSREDVFNVFLERLANMKLIKS. 388
60 -61.7003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  10  1.....SSWWTHVEMGPPDPILGVTEAFKRDTNS------KKMNLGVGAYRDDNGKPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRY----YDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWAVRHIEQGINVCLCQSYAKNMGLYGERVGAFTVVKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGM--LKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLA--HAIHQVTK........... 401
61 -61.4003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  19  6.....................SIEDLRARNTMKWTRYGQGVLPLWVAESDF--STCPAVLQAITDAVQREAFGYQPDG--SLLSQATAEFYADRYGYQARP-EWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT--------GGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDG-QHTVAAGVSDTAASVCITITAPSKAWNIAGLKCAQIIFSPSDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKIPGAKITPMQATYLMWIDFRDTTIEG-SPSEFFIEKAKVAMNDGAWFGEDGTGFCRLNFATSREVLEEAIDRMAKAVSHHT. 377
62 -60.9002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  1.......MFENITTAPADPILGLADLLRADERP------GKIDLGMGVYNDETGKTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAY----YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLC--EAIVAVL............ 396
63 -60.8001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  1.......MFENITATTADPILGLADLFRADERPGK------IDLGIGYKDET--GKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY----YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFALYNERVGACTLVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMSGLTKEQVLRLREEFGVYAVASG----------RVNVAMTPDNMAPLCEAIVAVL..... 396
64 -60.8003t32_A mol:protein length:383 Aminotransferase, class I/II  ali model follow..  16  24......................................EELIHAWIADMDF--EVPQPIQTALKKRIEHPIFGYTLPP--ENIGDIICNWTKKQYNWDIQK-EWIVFSAGIVPALSTSIQAFTKENESVLVQPPIYPPFFEMVTTNNRQLCVSPLQK---QNDTYAIDFEHLEKQFQQGVKLMLLCSPHNPIGRVWKKEELTKLGSLCTKYNVIVVADEIHSDIIYADHTHTPFASLSEELAARTITCMAPSKTFNIAGLQASIIIIPNEKLRQTSIQYRQGFHGLNIFAYTAMQSAYTECNDWLNEIRFYIEDNAKFACEYIKDIPTLSVMKPEGSFLLWIDCSALNLSQDERTKLLEEKGKIIVEPGEKYGLGGEEHIGINIGCPRSVLEEILNRLRHTFS.... 383
65 -60.6004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  13  15....SMSLFSAVELAPRDPILGLNEAFNADTRP------TKVNLGVGVYTNEDGKRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVALGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPY----YDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIIARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGM---TSAQVDRLREEFGIYAVSTG----------RICVALNTRNLDVVANAIAAVLK.... 414
66 -60.5004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  12  1...MAVGTFENITAAPADPILGLADLFRADERP------GKINLGIGVY--DETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY----YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---TKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL..... 400
67 -60.0004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  14  5..TLEAQTQGPGSMGKPDPILGLGQDFRMDPAK------RKVNLSIGVY--DDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGRQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSY----YDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVRHLVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLANNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGM---TREQVELLRSEYHIYMTLNGRAAVSGLNSTNVEYVS--QAIHNVTK........... 403
68 -59.9001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  11  1.......MFENITAAPADPILGLADLFRADERP------GKINLGIGLYYDETGKITSVKKAEQYLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY-----DAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL............ 396
69 -59.8003l8a_A mol:protein length:421 Putative aminotransferase, probable beta-cystathionase  ali model follow..  16  45............................TYKWKTSENNPELLQMWVADMDF--LPVPEIKEAIINYGREHIFGYNYFN--DDLYQAVIDWERKEHDYAVVK-EDILFIDGVVPAISIALQAFSEKGDAVLINSPVYYPFARTIRLNDHRLVENSLQI---INGRFEIDFEQLEKDIDNNVKIYLLCSPHNPGGRVWDNDDLIKIAELCKKHGVILVSDEIHQDLALFGNTHHSLNTLDASYKDFTIILSSATKTFNIAGTKNSFAIIQNESLRRQYRQLANNQHEVPTVGMIATQAAFQYGKPWLEELKTVIEGNIKLVIKELEAKTKIKVMEPEGTYLVWLDFSAYAIAQPQLSEKLQNEAKVVLNDGAHFGKEGKYFARLNVATPKNTVQEALSRIISVFGK... 415
70 -59.8003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  1..............MQPVLVFKLTADFREDPDPRKVNLGGAYRTDDCHPWV---PVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWARYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMESNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFS-NPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATVTKIAENLYFQSDYKDDDD. 415
71 -59.5003dzz_A mol:protein length:391 putative pyridoxal 5`-phosphate-dependent C-S lyase  ali model follow..  17  27......................................EKELPMWIAEMDF--KIAPEIMASMEEKLKVAAFGYESVP--AEYYKAVADWEEIEHRARPKE-DWCVFASGVVPAISAMVRQFTSPGDQILVQEPVYNMFYSVIEGNGRRVISSDLIY---ENSKYSVNWADLEEKLTPSVRMMVFCNPHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLVLTDEDITPAFTVDWDAKNWVVSLISPSKTFNLAALHAACAIIPNPDLRARESFFLAGIGEPNLLAIPAAIAAYEEGHDWLRELKQVLRDNFAYAREFLAKVPEVKVLDSNASYLAWVDISALGMNAEDFCKYLREKTGLIISAGNGYRGNGHEFVRINLACPKELVIDGMQRLKQGVLNLN. 390
72 -59.5004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  14  1...........MAMGKPDPILGLGQDFRMDPAK------RKVNLSIGVY--DDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGRQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSY----YDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLASNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMTGLTREQVELLRSEYHIYMTLNG----------RAAVSLNSTNVEYVSQAIHNVTK.... 390
73 -59.4001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  10  22EHGRAFLDGIISEGSPKCECNTCYTGPDCSEK----IQGCSADVASGDGLFL--EEYWKQHKEASAVRMSYFFNPVSNFIFELEKTIKELHEVVGNAAAKD-RYIVFGVGVTQLIHGLVIS-LSPNMTATPDAPESKVVAHAPFYPVFREQ---TKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYTPIKYKA---------DEDILLFTMSKFTGHSGSRFGWALIKESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKTGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRKCEWEEDKDCYQTFQNGRINTQNGVGFE-ASSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRK 427
74 -59.3001c7n_A mol:protein length:399 CYSTALYSIN  ali model follow..  16  31......................................NEVVPLSVADMEF--KNPPELIEGLKKYLDETVLGYTGPT--EEYKKTVKKWMKDRHQWDIQT-DWIINTAGVVPAVFNAVREFTKPGDGVIIITPVYYPFFMAIKNQERKIIECELLE---KDGYYTIDFQKLEKLSDKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPGYEHTVFQSIDEQLADKTITFTAPSKTFNIAGMGMSNIIIKNPDIRETKSRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVHPEIKAPLIEGTYLQWIDFRALKMDHKAMEEFMIHKAQIFFDEGYIFGDGGIGFERINLAAPSSVIQESLERLNKALKDLKN 395
75 -59.1002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  13  1.......MFENITTAPADPILGLADLLRADERP------GKIDLGMGVYN-DETGKTPVLTSVKKAENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAY----YDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL---TKEQVLRLREEFGVYAVASG----------RVNVAMTPDNMAPLCEAIVAVL..... 396

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.