current user: public

If you have questions about the server, please let us know.

Query: 3op7_A mol:protein length:375 Aminotransferase class I and II, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEELFALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYTGVKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELDVPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALAHYQEILERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVKIAVDMPMEDFCLQLLQEHGVLLVPGNRFERDGYVRLGFACEQETLIKGLEKLSQFLRRFDKENLast
1 -103.0003op7_A mol:protein length:375 Aminotransferase class I and II  ali model  100  1GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEELFALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYTGVKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELDVPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALAHYQEILERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVKIAVDMPMEDFCLQLLQEHGVLLVPGNRFERDGYVRLGFACEQETLIKGLEKLSQFLRRFDKEN 375
2 -90.1004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  25  20PRREDPPVLEEWYRRHLGPDIHDISSSGVHPYSFAEIRDV----CRIPAADLDAVVMDDSVSQGGEGVRRAIADRYAGGDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWLADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAERAVRHADELIGARAAEARHNLAHLTGWMAAHEEVRWTPPEGGVCALPVFRGPQEVERFCLELLERHRTLLVPGTAFGAPHGARLGFGGPQEDFRAGLDGLSRFLRERAAGR 400
3 -84.7001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  24  4AARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPFNTPKHIVEAAKAALEQGKTRYGPAAGEPRLREAIAQKLQRYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDCVQEMLAAFAERRRYMLDALNAMPGLECPKPDGAFYMFPSIAKGRSSLDFCSELLDQHQVATVPGAAFGADDCIRLSYATDLDTIKRGMERLEKFLHGI.... 387
4 -83.2001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  25  9SRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPFPTPEPVVEEAVRFLQKGEVKYTDPRGIYELREGIAKRIGEISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNS---YMVQTFKERKNFVVERLKKM-GVKFVEPEGAFYLFFKVRG--DDVKFCERLLEEKKVALVPGSAFLKPGFVRLSFATSIERLTEALDRIEDFLNS..... 382
5 -82.9005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  20  73SPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPFDTPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKEYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYASFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSA-NDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVLQAAVEKIRKALEPLRATV 473
6 -81.6003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  22  5NSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPTGAPRGAVEALAKSLETDALGYTVALGLPALRQRIARLYGELDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKATALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALDCDAE-LQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVSDTDDSRAFAAEILEKAGVAVTPGLDFDGAGTLRFSYARATADIEEGLDRLEAFMQARGE.. 384
7 -81.5001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  24  5SRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEAFVEMAREAYRRRRDLLLEGLTAL-GLKAVRPSGAFYVLMDTSPAPDEVRAAERLL-EAGVAVVPGTDFAAFGHVRLSYATSEENLRKALERFARVLGR..... 384
8 -81.4005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  20  5VALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPETAEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDTSDSLAFCSKLLADTGVAIAPGIDFDGGSFVRISFAGPSGDIEEALRRIGSWLPS..... 387
9 -80.7001xi9_A mol:protein length:406 putative transaminase  ali model follow..  25  15.........YAIRDVVLPARELEKKGIKVIRLNIGDPFQPPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGSPGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVWKNDKEFVLDVLHNAHVLFVHGSGFGGAGHFRAVFLPPIEILEEAMDRFEKFMKERLKE. 400
10 -79.8001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  22  1.MALSDRLELVSASEIRKLFDIAAGMKDVISLGIGEPFDTPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKK-PKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERKAVEEMRKEYDRRRKLVWKRLNEM-GLPTVKPKGAFYIFPRIRDGLTSKKFSELMLKEARVAVVPGSAFGGEGYVRISYATAYEKLEEAMDRMERVLKERKL.. 388
11 -79.1003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  16  9KKLGTDNAPGQEVRQSAAGLEALIRGGRPVDFSHGDV-PTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAA-ARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDDETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKAVAPAEFVKILRLQAGVVVTPGTEFSTADSVRLNFSQDHEAAVAAARRIVTLVERYRA.. 407
12 -78.7003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  19  22PSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPLPTDPEVTQAMKDALDSGKNGYAPSIGFLSSREEIASYYHCLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDQRILGPCTIVQGALKSILRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQHYH.. 420
13 -78.7004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  26  27SSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPFDAPDEILVDVIRNLPTA-QGYCDSKGLYSARKAIMQHYQAVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHEGLEMLASMRLCANVPAQHAIQTALGGYQSIFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKHDDQKMVLDFLLQEKVLLVQGTAFNWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQ.. 424
14 -78.3001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  20  8MSNHAGLVFNPIRTVSD-NAKPSPSPKPIIKLSVGDPLDKNLLTSAAQIKKLKEACNGYFPTVGSPEAREAVATWWRNIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDADFETTVPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKTDVEFFEKLLEEENVQVLPGTIFHAPGFTRLTTTRPVEVYREAVERIKAFCQRHAA.. 415
15 -78.3002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  20  11SDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQPLKTPEVFFERI-YENKPEVVYYSHSAGIWELREAFASYYKRVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIP-QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPV-EDAEEFARWMLTDFNTMVAPLRGFYGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCSSR 400
16 -77.9004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  22  6SKRFNKNLNKIEVSMIRQFDQSISDIPDVLKLTLGEPFATPKHIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKE-PDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTR-SNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVS-LPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAM-KFKIIKPDGAFYIFAKIPVGQDSFKFLQDFAKEKAVAFIPGVAFGGEGYLRISYAASMETIKEAMKRLKEFMEQYAD.. 393
17 -77.9004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  19  47............LNNLTDNMKPSRSTKSNLRLSIGDPLKTPDIVTEAMVDVVRSGKNGYPPTVGADNLRQVVSTYWRRLKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIADFDTNVPRLILGGTAKYQVCPGWRVGWSILIDDWAVGMERLTQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSKSDMEFYEKLLDEENVQVLPGEIFGMSGFLRATVSRPSAVLNEAVDRIIEFCERHKK.. 438
18 -77.8002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  24  3SKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEPFNTPKPIVDEGIKSLKEGKTHYTDSRGILELREKISELYKDIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF--------TVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYESAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKEEREINSMIKEFDRRRRLVLKYVKDF-GWEVNNPIGAYYVFPNIG--EDGREFAYKLLKEKFVALTPGIGFGGKNYIRISYANSYENIKEGLERIKEFLNK..... 370
19 -77.5003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  19  5PSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPLPTDPEVTQAMKDALDSGKNGYAPSIGYLSSREEVASYYHCLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDQRILGPCTIVQGALKSILQRPQEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEENDVEFTERLIAEQSVHCLPATCFEYPNFFRVVITVPEVMMLEACSRIQEFCEQ..... 400
20 -77.5003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  21  31SNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFFYSPPQFAIKEAQKALDPMVNQYSPTRGRPSLINSLIKLYSELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDALKYFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSNKGKDFRISHWLINELGVVAIPPTEFYIENLLRFAVCKDDAYLENAVERLKLLKDYL.... 447
21 -77.3002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  17  11FARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPGPTPPHIVEKLCTVAQREDTHYSTSRGIPRLRRAISHWYRD-PESEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREA-GWMVENPKASMYVWAKIPAHLGSLEFAKKLLQDAKVSVSPGIGFGGDDHVRFALIENRDRLRQAVRGIKAMFRADGLLS 402
22 -76.1001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  21  9QSKLPQLGTTIFTQMSALA-----QQHQAINLSQGFPFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTER-ADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQ-PPHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSSVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNES-RLEILPCEGTYFLLVDYSSTLDDVEFCQWLTQEHGVAAIPLSVFCADKLIRLCFAKKESTLLAAAERLRQL........ 386
23 -76.0002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  20  4VSRLRPYATTVFAEMSALA-----TRIGAVNLGQGFPEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRR-PETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPDRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEI-GFAVHDSYGTYFLCADPRGYDDSTEFCAALPEKVGVAAIPMSAFCDPALVRFTFCKRDDTLDEAIRRLSVLAERPATGV 400
24 -76.0002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  20  17SNKLANIPDSYFGKTMGRK--IEHGPLPLINMAVGIPGPTPQGIIDHFQKALTIPENQYGAFHGKEAFKQAIVDFYQR-KEDEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLE-PPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKA-DLPFVHAKGGIYVWLETPPGYDSEQFEQFLVQEKSILVAPGKPFGGNRYVRISLALDDQKLDEAAIRLTELAYLYE... 398
25 -75.7004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  18  7ARRLDGIDYNPWVEFVKLA-----SEHDVVNLGQGFPFPPPDFAVEAFQHAVSGDLNQYTKTFGYPPLTKILASFFGE-PLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDSIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFERPSSYFVQFPQAMQRCRDHMIRSLQSV-GLKPIIPQGSYFLITDISDEPYDRRFVKWMIKNKGLVAIPVSIFYSDHYIRFCFVKDEATLQAMDEKLRKWKVELEN.. 424
26 -75.5001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  20  4HPRTEAAKESIFPRMSGLA-----QRLGAVNLGQGFPNPPPPFLLEAVRRAL-GRQDQYAPPAGLPALREALAEEFA-VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKRREGFYEALREGYRRRRDLLAGGLRAM-GLRVYVPEGTYFLMAEL-----PGWDAFRLVEEARVALIPASAFYPKDLFRFAFCKTEEELHLALERLGRVVNSPREAE 375
27 -75.2002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  20  8.........SVFLVVDEAKRKARERGVGLIDLSIGSTLPPPEAPLKALAEALNDPTTGYCLKSCTLPFLEEAARWYEG-PRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL--REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYESPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKG--VLSLLPPRATMYLWGRLPEGVDDLEFGLRLV-ERGVALAPGRGFGGKGFVRIALVRPLEELLEAAKRIREALD...... 376
28 -74.0004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  18  46..KLKNNYLFPEINRRELEHIEKHPNVQLISLGTGDTEPIPEQITSHMSNSTVEGYRGYGLEQGNKTLRKAIAETFYHVKSNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSGGLKEIRSVNNYYKENRKILMDTLVSL-GLKVYGGVNAPYLWVHFK-GSKSWDVFNEILENTHIITVPGSGFGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTKHF 446
29 -73.7001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  19  16PKRYQGSTKSVWVEYIQLA-----AQYKPLNLGQGFPYHAPKYALNALAAAANSPDNQYTRGFGHPRLVQALSKLYSQ-PMTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFERICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFESPECYFNSISGELMAKRDYMASFLAEV-GMNPTVPQGGYFMVADWSDARKDYRFTKWMTKSVGLQGIPPSAFYGEDFVRYCFFKKDENLQKAAEILRKWKGS..... 428
30 -72.8005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  19  3AKRIEGLDSNVWVEFTKLA-----ADPSVVNLGQGFPISPPSYVKEELSKAFIDNMNQYTRGFGHPALVKALSCLYGKIPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWDPECYFNSLPKELEVKRDRMVRLLNSV-GLKPIVPDGGYFIIADVSSEPYDYKFVKWMTKHKKLTAIPVSAFCDEKLVRFCFIKKDSTLDAAEEIFRAW........ 410
31 -72.3003ele_A mol:protein length:398 Amino Transferase  ali model follow..  18  10QLGSVRSAIRE-LFEYGKKRAAIVGKENVYDFSIGNPIPAPQIVNDTIKELVTDALHGYTSAQGDVETRAAIAEFLNNFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPAD-TEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGVPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGVCAPSLFQKMIVKCQGA-----TGDINAYKENRDLLYEGLTRI-GYHCFKPDGAFYMFVKAL-EDDSNAFCEKAKEE-DVLIVAADGFGCPGWVRISYCVDREMIKHSMPAFEKIYKKYNK.. 398
32 -72.0003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  17  45..KLRAGYLFPEIARRRKAHQEKNPDAKIISLGIGDTEPLPKYIADAMAKATREGYSGYGAEQGQGALREAVASTFYGRAADEIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQPELKEMNAMIKFYKENAQILKTTFTEM-GFSVYGGDDAPYIWVGFP-GKPSWDVFAEILERCNIVTTPGSGYGGEGFVRASAFGSRENILEAVRRFKEAYGKRNAS. 443
33 -71.1002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  17  30MSKLQAGYLFPEIARRRSAHLLKYPDAQVISLGIGDTEPIPEVITSAMAKSTIEGYSGYGAEQGAKPLRAAIAKTFYGIGDDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPELEAMHKVIGFYKENTNIIIDTFTSL-GYDVYGGKNAPYVWVHFP-NQSSWDVFAEILEKTHVVTTPGSGFGGEGFVRVSAFGHRENILEACRRFKQLYK...... 426
34 -70.6003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  20  8.VSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTQPLNASVAEAFASSIARLSSGYGPDFGLPALRQKLSEDFYRVDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKIIALPCLQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ--LEAIHYYRENSDLLRKALLAT-GFEVFGGEHAPYLWVKPQANISDRDLFDFFLREYHIAITPGIGFGGSGFVRFSSLGKREDILAACERLQMAPALQS... 394
35 -70.6006DK6 Entity 1(prereleased)  ali follow..  17  10KLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDVEALPEAVRYAMHEAVDETFKGYGPEQGYDFLRNAIADNDYKIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKRRHSTKFNGASYIVQKGAEALYTDEKSQTKALIEHYMGNAALLVEACKNA-GLSVFGGVNAPYVWVGCPAGLTSWQMFDKMLNEANVVITPGSGFGGEGYFRISAFNSRANVEEVCRRIAAL........ 410
36 -70.5003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  18  1GMTFEPYPFERLRALLKEITP----KKRGLDLGIGEPFETPKFIQDALKNHT-HSLNIYPKSAFEESLRAAQRGFFKRLKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPAGNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWLDDRH-AEFFRNIYANNLKLARKIFKNTL-----IYPYSFYVYLPVQ---NGENFAKTLYQNEGIITLPALYLGGADYVRLALVYDTPLLEKPLEIIETYRENHA... 376
37 -70.4003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  14  17ELHIKDLGMASIRDLVALVTNLKATGTKFCRMEMGVPLPAPQIGIETEIQKLREGVASYPNLDGLPELKQEASRFAKDIPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPALYALSSGATHSAQWGMAAMLKACND-FRDSVIEYGRKARIMKKMFLDVYDKDGNEPLADGFYFTVGYKGMDSSKLIEKFVRYGMCAITLKTTGSRNEAMRICTSLLPESFPDLEKRLQMLNAE..... 436
38 -69.0003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  19  56FTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNL-PEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSEMGPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLLSVRCPPVSGQAAMDIVVNPPVAGEESFEQLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFQMAPDMFYCMKLLEETGICVVPGSGFGGTYHFRMTILPPVEKLKTVLQKVKDFHINFLEK. 490
39 -69.0003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  17  77YINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELLNRDKVVAEWVNGAVANNY--PVPDRCLVNTEKIINYFLQEAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVVRLCADSRSIGLYHTAGLSTPQQIMEALFSMTHLDETDTNTHYYSLIDIYNNFEQVDFLLKLAEKNGVVLVDGVGFGAPGELRVSQANLPTEYALIGKQVLELLKEYYEE. 528
40 -68.7003jtx_A mol:protein length:396 aminotransferase  ali model follow..  19  3NTLLKQLKPYPFARLHEAMQGISAEGMEAVPLHIGEPHPTPKVITDALTASLHEL-EKYPLTAGLPELRQACANWLKR-ADNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGAAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQH-VIDNRRLYQEKFERVIPILQQV--FDVKLPDASFYIWLKVP-DGDDLAFARNLWQKAAIQVLPGRFLAGEGYVRIALVADVATCVKAAEDIVSLYR...... 396
41 -68.7003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  14  76.................REVLALCDHPDLLQREEIKT-DSISRAKQILAMIPGRATGAYSHSQGIHGLRDAIASGIASANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLETSDVKKQLEINVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKFHSFKPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNIPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICNKAPDAFYALRLLESTGIVVVPGSGFGGTWHFRCTILPQEDKIPAVISRFTVFHEAFMSE. 487
42 -66.1002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  17  89............FIAEHRDQEGVKFLGKSLSYVRDQLLDPAAFLHEMVDGILGC---NYPVPPRMLTVSEQIVRQYIPPESVDLFAVEGGTAAMALRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPES------AKKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQMVLFSLFAVQQSSTGDMLFRVADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRRLADELYEQ 524
43 -65.3005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  15  6................QLKENLTQWAYLALNSELNIAGHARQALSPGQQKIVNELPVLWAESEQRPEAHQAYFTLLGQAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGA-----DLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSDAADGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVERVAFAGRTGTEVWEEL-QRHHVFALPCRQFHGDHMVRIALSRSTEPLEKSVQVLRTVLET..... 375
44 -65.0006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  16  16HPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQATYEKRFTEAFFQLHRQLVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPL--YPIDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVRSAADRLASVREVLTRNRECARKTLDGS-ILEYQEPVVKSVAWFRVDHPELTATDVHRLLSADGVYVLPGRYFYGDAYVRMALAREPEMFADAMALTRQVLDRHGR.. 407
45 -64.6002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  19  88..........ERYIAENRDQEGVRFLGKSLSYVRDQLLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIR-ESVNLFAVEGGTAAMALKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDRTLKQLIRRRETTLYRELGMPPLR-DENAVDYYTLIDLQKQSSTGDMLFRIADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRALRKMAD..... 520
46 -64.3003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  19  90............YIAENRDQEGVRFLGKSLSYVRDQLLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIR-ESVNLFAVEGGTAAMAMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSLFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDRTLKQLIRRREATLYRELGTP-PQRDENAVDYYTLIDLQKQSSTGDMLFRIADETGIVLLPGRGFGSRPSGRASLANLNEYEYAAIGRLRQMADELYAQ. 525
47 -63.1003if2_A mol:protein length:444 Aminotransferase  ali model follow..  17  1GMKFSKTQPTGISQLMDDLGDALKSDQPVNMLGGGNP--GNDNDTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDGELENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVANKQLSDNEIKPFYQKQATLAVKLLKQA-PLMIHKPEGAIFLWLWFKDLPISTLDLYERLKAKGTLIVPSEYFFAHECIRMSIAADEQTLIDGIKVIGEVVRELYDNK 444
48 -63.1003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  17  1GMTFSLFGDKSGITRLMEDLNDGLRTPGAIMLGGGNPAHIPDYFQTLLTDMVESGKCNYDGPQGKTALLNALAVLLRDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVPFPGISEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNRLSETVIKPFYYQRVQQTIAIIRRYERCLIHKPEGAIFLWLWFKDLPITTELLYQRLKARGVLMVPGHYFFTHQCMRMNYVPEPDKIEAGVKILAEEIERAWREG 417
49 -62.9001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  20  20........FLGWQEYEKNPYHEVHNTNGIIQMGLAENKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRGVEIVPIHCTSSNGFQITETALEEAYNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKS-GISCLNGNAGLFCWVDMRTFEAEMELWKKIVYEVHLNISPGSSCHEPGWFRVCFANLPERLDLAMQRLKAFVGEYYNVP 436
50 -59.6001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  18  18........FDGWKAYDSDPFHPLKNPNGVIQMGLAEN-NPKGSICSEGIKSFKA-IANFQDYHGLPEFRKAIAKFMEKFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRGVQLIPIHCESSNNFKITSKAVKEAYNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEDLVHIVYSLSKDMGLPGFRVGIIYSNDDVVNCARKMSSFGLVSTQTQYFLAAMLSEKFVDNFLRESAMRLGKRHKHFTNGLEVV-GIKCLKNNAGLFCWMDLRTFDSEMSLWRVIINDVKLNVSPGSSFEEPGWFRVCFANMDDGVDIALARIRRFVGVEK... 428
51 -56.9003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  13  9.............KPEKISNKNIPMSDFVVNLDHGDPAYEEYWRKMGDRCTVTCDLMSYFSDMTEPELEDAIKDLHGATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG-----------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYT---PITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKVAKKMVEYIIVNSIGVSKESQVRTAKILNESENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGAWLGTKEETDLVSELRRHKVMSRAGERCGSKKHVRVSMLSREDVFNVFLERLANMKLIKSID. 390
52 -55.5001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  15  30GIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDGFLEEYWKQHKEASAVLVSRMSYFFNPVSFELEKTIKELHEVAKDRYIVFGVGVTQLIHGLVISL-SPNMTATPDAPESKVVAHAPFYPVFRQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYTPIKY---KADEDILLFTMSKFTGHSGSRFGWLIKDESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEMRDLNTFGFKKLRERWVNITALLDQSDRFSYQELPQSEYCYAWVKCEWEEDKDCYQTFQNGRINTQNGVGFEASRYVRLSLIKTQDDFDQLMYYLKDMVKAKRKT. 428
53 -53.2002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  11  11NEQLQQSNATAFAMLSDLGQNMAEAKSTTYNATIGMATNFASSLDAMFNDLTPDEIFPYAPPQGIEELRDLWQQKMLRDNPERPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDLTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFIQTLKERYEVTKEVVYADQYH-SHWQAYDFNSGYFMAIKVH-DVDPEALRKHLIDKYSIGVIALNATD----IRIAFSCEKDDIPHVFDSIAKAIDDLR... 430
54 -50.0005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  13  6..HVEMGPPDPILGVTEAFKR--DTNSKKMNLGVGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELAGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCKPEQVERLIKEFSIYMTKDGRISVAG-------VTSSNVGYLAHAIHQVTK...... 401
55 -49.9004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  14  6..HIDAYPGDPILTLNENFQK--DPRDQKVNLSIGIYFDMGAVREAETALQRDSGPKPYLPMVGLAAYRDAVQSLVFGRAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLASNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKQRGMFTTESQVDALREVHGVYILRSG--------RMCVAGNDSNVGIVADAIGKVLKSGA... 402
56 -49.6003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  17  4..KVDAYAGDPILTLMERFKEDPRSDKVNLSIGLGIIQLQAVAEAEARLNAQPHGASLYLPMEGLNCYRHAIAPLLFGLKQQRVIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSSAAQVDRLREEFGVYLIASG--------RMCVAGNTANVQRVAKAFAAVM....... 397
57 -49.5004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  15  9KRATWNNGPDLAFDINNKANAAIEKREAVINAALGTLLDALPSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFG-GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDNIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGFEKFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGSKEIIEEFEASLAHSARCNWSNGTHAAQNILKIYEQELVDLRNMLKSRADVFVTAAKEN-KLTMIPYFGGFFTFIPT----DKAFDIVKDLEKENIFTIPSAKGI-----RVAICGGEEKIPKLVQRLAFYTNK..... 412
58 -49.2004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  11  1...MAMGKPDPILGLGQDFRM---PAKRKVNLSIGVYDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCGRIASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLASNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMMATREQVELLRSEYHIYMTLNG--------RAAVGLNSTNVEYVSQAIHNVTK...... 390
59 -49.0003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  15  13................RNTMKWTRYGQGVLPLWVAESFSTCPAVLQAITDAVQREAFGYQPDG--SLLSQATAEFYADARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREG----IFIDATGGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGAGVSDTAASVCITITAPSKAWNIAGLKCAQIFSNPSDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKIPGAKITPMQATYLMWIDFRDTTIEGSPSEFFIEKAKVAMNDGAWFGGTGFCRLNFATSREVLEEAIDRMAKAVSHHT... 377
60 -48.8001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  14  4..NITATTADPILGLADLFRADERPGKIDLGIGVYKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALITPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGGLRAFAAMHKELIVASSYSKNFALYNERVGACTLVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSTKEQVLRLREEFGVYAVASG--------RVNVGMTPDNMAPLCEAIVAVL....... 396
61 -48.7003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  13  6..HVEMGPPDPILGVTEAFKR--DTNSKKMNLGVGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELAGRFVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK............. 401
62 -48.7001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  13  4..NLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQETTKTYAGLSGEPEFQKAMGELILGDGATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMASFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSTPEQVKRIKEEFGIYMVGDS--------RINIAGNDNTIPILARAIIEVG....... 393
63 -48.4001vp4_A mol:protein length:425 aminotransferase, putative  ali model follow..  19  19GQNMKSSIIREILKFAADKDAISFGGGVPDPETF--PRKELAEIAKEIIEKEYHYTLQYSTTEGDPVLKQQILKLLERLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFVVVPLEDDG---MDLNVLERKLSKQVKFIVVSNFHNPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETFKIGGPERVVLLNTFSKVLA-PGLRIGMVAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLERYLEQLKPTIELYRRKRTVMLNALEEYPGVKWVKSEGGLFIWLTLPEGFDTWEMFEYAKRK-KVFYVPGRVFEPSPSMRLSFCPPDEKIVEGIKRLREVVLEYGKEK 416
64 -48.3003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  15  24............TAGQAQADAKENGRENVVNGTLGAIHDFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKECFG-GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL--DEHNNFNHEAFQNRVNQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGENKFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVTWSNICRPAMRTMANIVADPAAERNCYYQLIRDRADIFKQEAAQV-GLPMLPYRGGFFITIPTD---SANAICEELKKEHIYVIALANGIAACGIPKCQMTGLAEKIYNAMKSLGKL........ 418
65 -48.2002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  22  8AGRANWIKGSALADVMKKASELQKKGVKLISLAAGDPDPIPRAVLGEIAKEVEPKSVMYTPANGIPELREELAAFLKKVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDG---MRVDLLEEKIKQKVKLITIPTGQNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDKALDNEGRVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALEYLKREKYHLEGALLGYKEKRDIMLKALENHPNAEFTKPIAGMFVMFFLPEGADGISFANELMEREGVVVVPGKPFSGKNAIRLNFSPSKEEIPIGIKKLAKLYKEKFGE. 407
66 -48.2004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  12  13..PGSMGKPDPILGLGQDFRM---PAKRKVNLSIGVYDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCGRIASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQPRHLVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLANNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMMATREQVELLRSEYHIYMTLNGRAAVSG-------LNSTNVEYVSQAIHNVTK...... 403
67 -48.0003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  13  4..NITAAPADPILGLADLFRA--DERPGKINLGQGVYTPVLTSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALITPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSG---TKEQVLRLREEFGVYAVASG--------RVNVGMTPDNMAPLCEAIVAVL....... 396
68 -48.0001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  20  23AMLMKASEVRELLKLVETSDVISLAGGLPAPETF--PVETIKKIAVEVLEEHADKALQYGTTKGFTPLRLALARWMEKMSKVEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDKG---MRVDLLEEKLEKRVKIVTVSTFQNPAGVTMSVDRRKKLLELANEYDFLIVEDGPYSELRYSGEPKHFDDYGRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKMEIAKQSIDLCTNTFGQAIAWKYVENGDEHIPKIIEFYKPRRDAMLEALEEYEGVEWTKPEGGMFVRVTLPEGIDTKLMMERAVAK-GVAYVPGEAFDKKNTMRLNFTVPEETIREGVRRLAETIKEEMKRV 415
69 -47.8004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  14  21..AVELAPRDPILGLNEAFNA---TRPTKVNLGVGKIPLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIALGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIIARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGMFSTSAQVDRLREEFGIYAVSTG--------RICVALNTRNLDVVANAIAAVLK...... 414
70 -47.7002egy_A mol:protein length:397 Alpha-aminodipate aminotransferase  ali model follow..  21  14AGRIQASTIRELLKLTQRPGILSFAGGLPAPELF--PKEEAAEAAARILREKGEVALQYSPTEGYAPLRAFVAEWIG-VRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEEG---PDLDALEEVLKRERPRFLYLIPSNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYRELYFGEARLPSAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEGSERLERVRRVYREKAQAMLHALDREKEVRYTRPKGGMFVWMELPKGLSAEGLFRRALEE-NVAFVPGGPFGGENTLRLSYALDREGIAEGVRRLGRALKGL.... 393
71 -47.7002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  14  4..NITTAPADPILGLADLLRA--DERPGKIDLGMGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFTKEQVLRLREEFGVYAVASGRLNVAG-------MTPDNLAPLCEAIVAVL....... 396
72 -47.7003aov_A mol:protein length:448 Putative uncharacterized protein PH0207  ali model follow..  19  67.......................VETSDIISLAGG-PKEIIRDILVEIMEKYADKALQYGTTKGFTPLRETLMKWLGKSQDNDIMITSGSQQALDLIGRVFLNPGDIVVVEAPTYLAALQAFNFYEPQYIQIPLDDEG---MKVEILEEKLKELKSVYTVPTFQNPAGVTMNEDRRKYLLELASEYDFIVVEDDPYGELRYSGNPKALDNEGRVIYLGTFSKILA-PGFRIGWMVGDPGIIRKMEIAKQSTDLCTNVFGQVVAWRYVDGGEKHIPEIRKFYKPRRDAMLEALEEFEGVKWTKPEGGMFIWVTLPDGIDSKKMLERAIKK-GVAYVPGEAFDVKNTMRLNFTVDEDKIMEGIKRLAETIKEELKA. 442
73 -47.5002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  14  4..NITTAPADPILGLADLLRA--DERPGKIDLGMGVYNDLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALITPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSG---TKEQVLRLREEFGVYAVASG--------RVNVGMTPDNMAPLCEAIVAVL....... 396
74 -47.4004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  14  8..NITAAPADPILGLADLFRA--DERPGKINLGIGVYETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSG---TKEQVLRLREEFGVYAVASG--------RVNVGMTPDNMAPLCEAIVAVL....... 400
75 -47.1003ue8_A mol:protein length:439 Kynurenine/alpha-aminoadipate aminotransferase, mitochondrial  ali model follow..  18  11SAARNPSPIRTMTDILSRGPK------SMISLAGGLPITVENGKTIQFGEEMMKRALQYSPSAGIPELLSWLKQLQISQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESG---IVPDSLRDILSNTPKFLTVPNGNNPTGNSLTSERKKEIYELARKYDFLIIEDDPYYFLQFNKFRVSMDVDGRVIRADSFSKIIS-SGLRIGFLTGPKPLIERVILHIQVSTLHPSTFNQLMISQLLHE-MAHVDRVIDFYSNQKDAILAAADKWGLAEWHVPAAGMFLWIKVKGINDVKELIEEKAVKMGVLMLPGNAFAPSPYLRASFSASPEQMDVAFQVLAQLIKESLLVP 428

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.