current user: public

If you have questions about the server, please let us know.

Query: 3pj0_A mol:protein length:359 Lmo0305 protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .
# Score Template Links and tools%idFirst GMTNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNIDDNLESDIYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADRKENRRVAYHPLSHLEIHEQDGLKELQQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGGQLPAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVSNMFHVYFENSADEIGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFAEIPAKNLELVFRCLEKELLast
1 -107.0003pj0_A mol:protein length:359 Lmo0305 protein  ali model  100  1GMTNTLKTSYQKTPYKLGGNGPRNVGVLTEALQNIDDNLESDIYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADRKENRRVAYHPLSHLEIHEQDGLKELQQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGGQLPAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVSNMFHVYFENSADEIGAILTKIQDETGVGISGYLQEKSADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL 359
2 -94.4003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  52  1GMNRL--RTSFQQTTGQISGHGKRNVGVLKTAFAAADEMASDQYGTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDETDNRTVAYHPLCHLEIHEQDGLKELHPIETILVGAADRLMTLDEIKAL-PDIACLLLELPQREIGGVAPAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAAEIAGLFDSIYISFYKGLGGIAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDGQAADISPKLEQVQEETGLGFVGYVDKDGYCSTEISVGDAYGELDQ--QTRDAGFARLRQAF 356
3 -88.0002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  21  2.......GSDKIMIDLRSDTVTKPTEEMRKAMAQ--AEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHT--QRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYS-VNPEDVKTNMVILRTDNLKVNAHG-FIEALRNSGVLANAVSDTEIRLVTHKDVSRNDIEEALNI--FEKLFRKFS... 349
4 -84.5003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  20  2........SHMRYIDLRSDTVTQPTDAMRQCMLH--AEVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHC--QRGEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALAIAPDDVHFTPTRLVCLENTHNGKVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMVFLQLTS---GESAPLLAFMKARGILFSG--YGELRLVTHLQIHDDDIEEVIDA--FTEYLGA..... 341
5 -83.0004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  20  1............MIDLRSDTVTRPSRAMLEAMMA--APVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHC--ERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDIKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQEDHDNTAWMAEQLREAG---ADVMRQDTNMLFVRVGE---ENAAALGEYMKARNVLINA--SPIVRLVTHLDVSRAQLAEVAAH--WRAFLAR..... 333
6 -82.7003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  21  1............MIDLRSDTVTRPSRAMLEAMMA--APVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHC--ERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDIKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQEDHDNAAWMAEQLREAG---ADVMRQDTNMLFVRVGE---ENAAALGEYMKARNVLINA--SPIVRLVTHLDVSREQL------AEVAAHWRAFLAR. 333
7 -75.5001v72_A mol:protein length:356 Aldolase  ali model follow..  16  1....NGETSRPPALGFSSDNIAGASPEVAQALVKHSSG-QAGPYGTDELTAQVKRKFCEIFERDVEVFVPTGTAANALCLSAMT--PPWGNIYCHPASHINNDECGAPEFFSNGKLMTVDGPAAKLDIVRLRERTHTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAEWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDDLRNARKANAAAQRLAQGLEGLGGVEV-LGGTEANILFCRLDSAMIDALLK-----AGFGFYHDRWGPNVVRFVTSFATTAEDVDHLLNQ--VRLAADRTQER. 356
8 -75.0005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  16  1........MTDKSQQFASDNYSGICPEAWAAMEKANHG-HDRAYGDDQWTERASEYFRNLFETDCEVFAFNGTAANSLALASLC--QSYHSVICSETAHVETDECGAPEFFSNGKLLTAASVNGKLTPQSIREVIHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSPAEWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANAQLLALLVSDLPGVEL-MFPVEANGVFLQMP------EHAIEALRAKGWRFYTFIGSGGARFMCSWDTEEERVRELAAD--IRSIITA..... 346
9 -72.8001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  18  5..RTTATAAKPKPYSFVNDYSVGMHPKILDLMAR--DNMTQHAYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLAL--RPWEAVIATQLGHISTHETGAIEATGH-KVVTAPCPDGKLRVADIESAEHMVIPKLVYISNTTEVGTQYTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTDIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNLFFELGAHSNAAILKAGLEACGIRLAWP--SASNQLFPILEN---TMIAELNNDFDMYTVEPLKDGTCIMRLCTSWATEEKEC------HRFVEVLKRLVAS. 357
10 -50.6002c44_A mol:protein length:471 TRYPTOPHANASE  ali model follow..  14  35GMNPFLLDSEDVFIDLLTDSGTGAVTQSMQAAMMR----GDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLI--KKREQEKGLDRSNYFFDTTQGHSQINGCTVRNVYIKEGNFDLEGLERGIENVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQRTRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG---VVCQQAGGHAAFVDIPADQFPAQALACELYKVAGIRAVEIGSELLRLTIPRATYTQT-----HMDFIIEAFKHVKEN. 445
11 -50.6001c7g_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  13  32GYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMI----GDEAYAGSENFYHLEKTVKELFGFKHIVPTHQGRGAENLLSQLAIK--PGQYVAGNMTTTRFHQEKNGATFVDIVRDEAHDASLNKLATLIKEKGAENIAYICLAVTVNLAGGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLRYIEHRVKQVRYLGDKLREAGVPIVEP--TGGHAVFLDARRDQFPAQSLAASIYMETGVRSMERGIETVRLTIPRRVYTYA-----HMDVVADGIIKLYQH. 430
12 -50.5001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  12  32GYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMM----GDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIK--PGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDKGDIDLKKLQKLIDNIAYICLAVTVNLAGGQPVSMANMRAVRELTAAHGIKVFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVKQVRYLGDKLKPIVEPVGGHAVFLDARR---FCEHLTQDEFPAQSLAASIYVETGVRSMERGIISAGRVYTYAHMDVVADGIIKLYQH. 430
13 -50.2006MME Entity 1(prereleased)  ali follow..  12  32GYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMM----GDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIK--PGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDKGDIDLKKLQKLIDNIAYICLAVTVNLAGGQPVSMANMRAVRELTEAHGIKVFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRVKQVRYLGDKLKPIVEPVGGHAVFLDARR---FCEHLTQDEFPAQSLAASIYVETGVRSMERGIISAGRNNVTGEHHRPKLETVRLT... 406
14 -44.3001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  13  35....NPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMIT--GDEAYAGSRNYYDLKDKAKELFNYDYIIPAHQGRGAENILFPVLL--KYKQKEGKAKNPVFISNFTAAHVELNGCKAINIVTEKGDFDIKKLKENIAQIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARIFDMYKYADALTMSAKKDPLLNIGGLVADNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYGQVKYLGDRLREAGIPIQYP--TGGHAVFVDCPGDQFPAQAVINALYLESGVRAVEIGSEFMRLTIARRVYTND-----HMDYIADALIGLKEK. 440
15 -24.0002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  12  48.........................................DEIKTPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLA--KKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETVVLALITYPDGNYGNL---PDVKKIAKVCSEYDVPLLVNGA---YAIGRMPVSLKEI--GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLRRSEKYKNKEVEL-ITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFYEISKKAKGGRFFLYRELKSRKIHGIKPGLTRYFKLSTYGLSDEEV------DYVLNAFKEIIEKY 370
16 -22.1003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  12  46.INDELMLDGNPRLNLASFVTTWMEPECDKLIMSSINKNYVD-MDEYPVTTELQNRCAHLFNAPLGVGTVGSSEAIMLAGLAFKRKWQNKNIVTGANVQVCWEKFARYFEV-ELKEVKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEDVKLLNDLLVKETGWDTPIHVDAA-SGGFIAPFLYPELEWLPLVKSINVSGHKYGLVYAGIVIWRNKEDLPEELIFHINYLGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTERFNIVSKDEGVPLVAFSLKDSSCHTEFEISDMLRRYGWIVPAYTMPPLRVVIREDFSRTLAERLV--IDIEKVMRELDEL. 447
17 -21.9005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  14  55.................IQRGGILPKEAKKAVYEYWDGYSVCDY-TCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAIC--KEGDYVVLDKNAHYTSYVAAERAKLNVAEVGKINLEGYKEVIDNLEDKGKNVGLILLTHVDGEYG----NLNDAKKVGKIAKEKGIPFLLNCAY---TVGRMPVNGKEV--KADFIVASGHKSMAASAPGILAFSEEFSDKITKTSEMLGCTSRGLPIVTLASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPKKDKRRGFFFYDELKKRGIGGIRAGVTKEIKMSVYGLEWEQV------EYVVNAIKEIVESC 410
18 -21.8005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  10  66...................CQTYMEPEAVELMKDTLEKNAID-KSEYPRTAEIENRCANLWHAPEGTSTIGSSEACMLAGLAMKFAWRKRNIVISAGYQVCWEKFCVYWDI-DMHVVPMDDDHMSLNVDHVLDYVDDYTIGIVGIMGITYTGQYDDLDAVVERYNRTTKFPVYIHVDAA-SGGFYTPFIEPELKWLNNVISINASGHKYGLVYPGVVIWRDQQYLPKELVFKVSYLGGELPIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSLTKLGGFSLINDGHELPLICYELTADSDREWTLLSDRLLMKGWQVPTYPLPKQRIVVRADFGMSMAHDFI--DDLTQAIHDLDQA. 451
19 -21.6003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  12  94.AAESPAWRDGYASGAVYHGDEHHIAFLNEVYALQSQSNPLH-PDLWPSTAKFEAEVAHMLGGDAGTVTSGGTESLLLAMKTYRDWARATKAVVPVSAHAAFDKA---AQYFGIKLVRTPDADYRADVAAMREAITPNTVVVAGSAPGYPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFLEGVTSVSADTHKYGYGATSVILYRRPDLLHYQYFIAADWPGGLLSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKIL-GDPLWVIAVASDELNIYQVMEEMAG--RGWRLNGLHRPPAFHVALTLRHTEPGVVDRFL--ADLQDAVAQVRAH. 476
20 -21.5004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  10  97.....................EKLTELLVKAYGDFAWSNPLH-PDIFPGLRKIEAEICSLFNGGPGCVTSGGTESILMACKAYRDLAFEKEIVAPQSAHAAFNKA---ASYFGMKIVRVPTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVI---DPVPEVAKLAVKYKIPLHVDGGFLIVFMEKAGYPLEH-VKGVTSISADTHKYGYAPSSLVLYSDKKYRNYQFFVDTDWQGGIISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKGIFVF-GNPQLSVIALGSRDFDI---YRLSNLMTAKGWNLNQLQFPPS-CITLLHARKRVAIQFL--KDIRESVTQIMKN. 457
21 -21.5004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  111.....................KELTELLKEVYGATALTNP--LHDKWPRINAMQAEVQNLFHGSKGLLTHGGTTSIIEAMAAYVIRARAKEIVVPETAHAAFKKAAELTGA-ILITVPVDKKTGAVNPNVMSSYITRNTAVMVGSAPSFMNGIH---DPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSSEPMVPGVTSISADLHKYGCCPTSVCLFSEDSPALSVYAALNWSGGLYRVAEVYATLSYYGKNKYQEIAKSIIRLRNAIQKELTALVEEGNGLTSEDIYVYILGFRSNTCNAHFIADELEKRGWKLNLLQNPDGFHLCLTHVHTLVGSFETQFIKDLREAVIDVKNY. 477
22 -21.4002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  14  122..............................................ASIMYALTNKIFKQLGLNVATPISTGMSISLCLSAA-RKKYGSNVVIYPYASHKSPIKA---VSFVGMNMRLVEGDRVYVPVEDIENAIKKNRPCVLSTLTFFPPRNS---DDIVEIAKICENYDIPHIINGAYAIQNNYYLEKLKKAFKYRVDAVVSSSDKNLLTPIGGVYSTDAEFIKEISLSYPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLSKKT-FLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHD--NAAIGVRTEDIVNSVSKLEKIL 449
23 -20.8005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  11  90.AAESPAWRDGYASGAVYHGDEHHIAFLNEVYALQSQSNPLH-PDLWPSTAKFEAEVAHMLGGDAGTVTSGGTESLLLAMKTYRDWARATKAVVPVSAHAAFDKA---AQYFGIKLVRTPDADYRADVAAMREAITPNTVVVAGSAPGFPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFLEGVTSVSADTHKYGYGATSVILYRRPDLLHYQYFIAADWPGGALSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAIPSLKIL-GDPLWVIAVASDELNIYQVMEEMAG--RGWRLNGLHRPPAFHVALTLRHTEPGVVDRFL--ADLQDAVAQVRAH. 472
24 -20.5005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  11  42.VREDRKWESGRCSGTMYCGDHEHYAFLNEAYGLFSHVNALQ-RDLCPSMNRMESEIVALLHGEAGALSLGGTESILNATLAYREKARAERMIWPASAHPAFRKAAHLFGF-DVTVAPIDPVTMQVDADFVRDAVDANTVMLVGSACNYPYGTI---DPIGALSAIAVEKDVWLHVDGC-LPWGEALGYPDIPAFLPGVTSISADTHKFGYGPKGGLAWRDASFRRHQYFLMTDWVGGVYGAATWAALRSLGREGYLARAKAIFETAFDMQAAVRAIPELRVLGKP----TFCFAFTSDAFDIYHVNDFMRQRGWRFNGLQHPDALHMVTGPQTQPGVAERFR--QDLGEAVEHARHR. 431
25 -20.4003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  14  1GMRNSEKEILEELKKYRSLDLKYEDGNIFGSMCSNVLPITRKIVDI-KGTKLLEEKAGSLLNNKDAHIVSGGTEANLMALRCILSKNEHPKIIVPITAHFSFEKG---REMMDLEYIYAPKEDYTIDEKFVKDAVEDYDVDGIIGIATTELGTI---DNIEELSKIAKENNIYIHVDAA-LDDKYKKKGVNYKDFSLGVDSITIDPHKMGHCPSGGILFKDIGYKRYLDVDAPYLTEGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVI--EPILNIVAIEDEDY-----KEVCKKLRDRGIYVSVCNVKALRIVVMPHIKREHIDNFI--EILNSIKRD..... 397
26 -20.4003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  11  76...................GGDDLIHLQTIAYEKYCVANQLH-PDVFPAVRKMESEVLRMFNAPSGTTTSGGTESLLLACLSAKMYALHHRIIAPVTAHAGFDKAAYYFGM-KLRHVELDPTTYQVDLGKVKKFINKNTVLLVGSAPNFPHGIA---DDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYK-VPGVTSISCDTHKYGFAPKGSIMYRNSDLRMHQYYVNPAWRPGAIVVGCWATMVNMGENGYIESCQEIVGAAMKFKKYIQENIPDLDIMGNPRYSVISFSSKTLNI---HELSDRLSKKGWHFNALQKPVALHMAFTRLSAHVVDEIC--DILRTTVQELKSE. 440
27 -20.2002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  13  63.....................PVVLAAMHEALEAVGAGSGGTISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVLFPGLIIYSDSLNHASMIEG---IKRNAGPKRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAELMHRIDIFNGTLAKAYGV-FGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAEGQKLRDAQQMHAKVLKMRLKALG---MPIIDHGSHIVPVVI-GDPVHTKAVSDMLLSDYGVYVQPINFPTVRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARC 400
28 -19.9002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  14  61.....................PDVIAAGKQALDEFGSGTTGSLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAG--KGDYIILDADSHASIYDG---CWLGDAEIVRFRHNSVEDLDKRLGRLPAEAGKLVVLEGVYSMMGDIAPLQEMVAV---SKKHGAMILVDEAHGMGFFGEHGRGVFEVEADVDFVVGTFSKSVGT-VGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRHAGDKRAHLWKNSRRLHQGLRDM-GYKLGTETAQSAIIAVILTDMAQAVA--LWQGLLEAGLYVNTARPPATAGMFLLRCSLCAEHSDEQVEQILGMFESAGRAT 395
29 -19.8002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  13  81.....................PDVIAAGKEALEKFGSGTNGSLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAG--KGEYVILDADSHASIYDG---CQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAP---LKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYELEGQIDFVVGTFSKSVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRTAHEKRERLWSNARALHGGLKAM-GFRLGTETCDSAIVAVMLEDQEQAAM--MWQALLDGGLYVNMARPPATAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAV 415
30 -19.7004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  11  96...................PMPATMAILGDLVAAAVNNNM-LSLEMSPSFSRLETLLAGLFGLGEGVLTSGGSLANLQALAVARNVAQRPVIFASEAAHTSLQKAAMLLGLGTAAVIPVRTADSRMDPEDLRARIDQARGCVVATAGTTTTGNI---DPLAEIGAIAREHGLWFHVDAA--YGGALVFSERHRWRLAGIDSITFNPQKWLYVACAMVLFRDAGVLERAFRIPAQGTRHADVVKLWLTLQHIGQQGYARLIDDGYRLAERVVEGVRQRPFLRLAGEIDTNIVCFRGEPERWDDWNAALQALLLREGKIFLSLPVYRGGRWLRAVLLNPYTTDA-VIDAMFKQIDRFAGRE 481
31 -19.6005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  11  73.....................PEVLDAMHKTIDKYGCGAGGTIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKMKDLVIFSDELNHASMIVG---IKHANVKKHIFKHNDLNELEQLLQSYPKSVPKLIAFESVYSMAGSVAD---IEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEVMDRVDMITGTLGKSFGS-VGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRCHIDLRTSQQKHTMYVKKAFHELG---IPVIPNPSHIVPVLI-GNADLAKQASDILINKHQIYVQAINFPTVRGTERLRITPTPGHTNDLSDILINAVDDVFNEL 430
32 -19.5004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  13  97.....................PDVIAAGKEALEKFGSGTNGSLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAG--KGEYVILDADSHASIYDG---CQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAP---LKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYELEGQIDFVVGTFSASVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRTAHEKRERLWSNARALHGGLKAM-GFRLGTETCDSAIVAVMLEDQEQAAM--MWQALLDGGLYVNMARPPATAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAV 431
33 -19.4004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain protein  ali model follow..  13  101...................GPASSVSWLGDIMTSAYNIHAG-GSKLAPMVNCIEQEVAKQVGFTEGVFVSGGSMANITALTAARDNKHLGTAYISDQTHSSVAKGLRIIGITDSRIRRIPNSHFQMDTTKLEEAIETDKKVVIGTAGTTNTGSI---DPLTEISALCKKHDMWFHIDGA--YGASVLLSPKYKSLLTGTDSISWDAHKWLFQTCAMVLVKDIRNLFHSFHVNPELTRPARGLKLWLTLQVLGSDLIGSAIEHGFQLAVWAEEALNPKKDWEIVSPAQMAMINFRYAPEEQDILNEKISHRILESGYAAIFTTVLNGKTVLRICAIHPEATQE-DMQHTIDLLDQYGREI 483
34 -19.4003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  13  60.....................TRIIKAAQDALEKYGTGCAGSLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMG--RNDYILLDERDHASIIDG---SRLSFSKVIKYGHNNMEDLRAKLSRLPEDSAKLICTDGIFSMEGDIVN---LPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASLNDDVDLIMGTFSKSLAS-LGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALENEPEHIEKLWKNTDYAKAQLLDHG---FDLGATESPILPIFIRSNEKTFW--VTKMLQDDGVFVNPVVSPAVAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQA 392
35 -19.3003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  17  68.....................PDVLDGGVEALRTWGGGAGGSVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSG--PGSLIVSDALSHASLVDA---CRLSRARVVVSPHRDVDAVDAALAARTEERAVVVTESVFSADG----DLAPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHLAGAPDIVMTTLSKALGS-QGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALR----VLDAEPQRARAVLDRAAELATIAGVTEAPVSAVVSVILGDPEIAVG--AAAACLDRGVRVGCFRPPTVAGTSRLRLAARASLTDDEMALARQVLTDVLATA 396
36 -19.3002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase  ali model follow..  14  109...................TPPLMPAVAAEAMIAALNQSM-DSWDQASSATYVEQKVCDKYDLSEGIFTSGGTQSNQMGLMLLPDYADKLRIVCSKKSHFTVQKSASWMGLGEKAVMTVDNADGTMDITKLDEVIAQAKAAIVGTAGTTDHGAI---DDLDFIADMAVKHDMWMHVDGAYGGALILSSHKSRLKGVERAHSISVDFHKLFYQTIGALLVNDKSNFKFLLHKSIATTKRFDALKVFMTMQNVGPKALGDMYDHLLAQTLEVADMIRTNDQFELLAEPSLSTVLFRATHETADELNKALRLEALTRGIAVLGETIVDGKTALKFTILNPCLTTS-DFESLLSKINMLAVEL 496
37 -19.0002fn6_A mol:protein length:375 AMINOTRANSFERASE  ali model follow..  13  14.............................EDKKAVLEVLNSKQLTQGKRSLLFEEALCEFLGVKHALVFNSATSALLTLYRNFEFSADRNEIITTPISFVATANM----LESGYTPVFAGKNDGNIDELALEKLINERTKAIVSV---DYAGKSVEVESVQKL---CKKHSLSFLSDSSHALGSEYQ-----KKVGGFALASVFSFHKPITT-GGAVVTNDSELHEKMKLFRKSIGHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDNPYFTPLHPLLKDHLYPILMHQKFFTCKKLILESLHKRGILA-DFYHAEISLPCHANLNLESVQNIA--HSVLKTFESFKIE. 375
38 -19.0005o5c_A mol:protein length:519 Putative decarboxylase involved in desferrioxamine biosynthesis  ali model follow..  14  112...................CPVVLPSLLAEQIMAAVNSSV-DTWDQSAGGTLIEQKVLSRIGLPAGIFTSGGTQSNLMAMLLLPHDAAKWRVFTSKLSHFSIQKSMAILGLGYDAVIPVDDERYRMDVDCLKQEVQRCLQAVVATSGTTDFGSI---DPLGAISELCKHHGMWMHVDAA--YGCGLLVSESHRPRLAGIDSVTVDYHKSFFQTVGAFFVRDKHHLSHVTHKSIQTTRRFDALKMWLTLRVSGPMALGNAFDDILALTQIAHQLLNAHPAIEVLHVPELTTQIFRYVPRPGDEINTNIRKAVFRSGNAVIAGTKVNGRQYLKFTLLNPNTTAA-DIEDVIALIVHYGREQ 508
39 -18.9001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  46.INDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWID-KEEYPQSAAIDLRCADLWHAPAGQAVGTNTIGSSEACMLGGMAMKWRPNLVCGPVQICWHKFARYWDV-ELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAA--FLAPFVAPDIVWDFLPRVKSISASGHKFGLAPLGCVIWRDEEALPQELVFNVDYLGGQSRPAGQVIAQYYEFEGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPDLSERLRLRGWQVPAFTLGGMRIMCRRGFEMDFAELLL--EDYKASLKYLSDH. 451
40 -18.9005k8b_A mol:protein length:403 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase  ali model follow..  12  9.....................PEEKQEVADVMEHTFRYNFDHMRNDRWKTRDMEQLLCEKMNVKHAHLLSSGTAALQTAMMA-AGIGAGDEVIVPPFTFVAS--VEAIFMAGAVPIFAEIDETLCLSPEGIEAVITPRTKAINLV---HMCGSMAKMDEIKAI---CKKHNLVLLEDACQAIGGS-YKGQALGTIGD-VGCYSFDSVKTITC-GGAVITNNTEIYDNAHMFSDHMGLNFRISEMNAALGLAQLRKLDTIIDIQRKNKKAIKDAMASIPEVSFREIPDPEGDSALSFMLPTEARTQEISKKLAANGV........................................... 313
41 -18.9001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  46.INDELYLDGNARQNLATFCQTWDDENVHKLMDLSINKNWID-KEEYPQSAAIDLRCADLWHAPAGQAVGTNTIGSSEACMLGGMAMKWRPNLVCGPVQICWHKFARYWDV-ELREIPMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAA--FLAPFVAPDIVWDFLPRVKSISASGHKFGLAPLGCVIWRDEEALPQELVFNVDYLGGQSRPAGQVIAQYYEFEGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCFKLKDGEDPDLSERLRLRGWQVPAFTLGGMRIMCRRGFEMDFAELLL--EDYKASLKYLSDH. 451
42 -18.9003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  10  60.....................PALIKTAQTVVEQYGFGMASVICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLG--PEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKGARFKLIATDGVFSMDG----IIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLEEGPQLRKQLQENSRYFRAGMEKLG---FQLVPGNHPIIPVMLGDAQLATN--MADHLLQEGIYVVGFSYPVVMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKL 396
43 -18.8001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  11  62.....................PDLIAAAKAGMDSHGFGMASVICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLG--AEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEAREAGARHVLIATDGVFSMDG----VIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEAGSELRDRLWANARQFREQMSAAG---FTLAGADHAIIPVMLGDAVVAQK--FARELQKEGIYVTGFFYPVVKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQL 397
44 -18.8004xau_A mol:protein length:389 Putative aminotransferase  ali model follow..  16  26.............................TALDRVAEVFASGYLGQGPRVAEFESALAARLGNPRVVSVHSGTSGLCLALRLLDAPEERDEVLSTPLTFEATNWA----LADGRRIT-VDPATLTMDLDDLERKISPATRAIIVV---HWTGYPVDLDRLAGILD-EREHGFRPAVDCAHAWGASYR-----VPLGSHGNMCVFSFQKHLTC-GGLLTLPGDELHERAMLRRAEWGLKWHMTDLNAAIGLANLETVDEQLRLHRENAAFYDKELTGVPGLELLQRSPDREGSF-YVYDVKVDDRPAFHRKMEAAGI........................................... 326
45 -18.7001b9h_A mol:protein length:388 PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)  ali model follow..  12  18.............................AERNGLVRALEQGQW-GGDEVNSFEREFAAHHGAAHALAVTNGTHALELALQV-MGVGPGTEVIVPAFTFISSSQA----QRLGAVTVPVDVDAATYNLDPEAVAAAVTPRTKVIMPVHMAGLMA----DMDALAKISADTGVPLLQDAAHAHGAR-WQGKRVGELDS-IATFSFQNGKLMTA-GGAVVFPDGETEKYETAFLKIAGSNMRLNEFSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPQGGDVRADMAMFRIPGLTEERRNALVDRLVEAGL........................................... 317
46 -18.6003wco_A mol:protein length:392 L-seryl-tRNA(Sec) selenium transferase  ali model follow..  13  8NIKRVINATGVVINTNLGRAP---SKDVINFISEIANGYSNEEGKRGSRIAHIEKYLNELTGAESSFVVNNNAGAVFLVLNTLAEGKE-RGELVEIGGSFRIPDI----KKSGAILREVGYYNKTKVSRYEGAINQNTALLMKVHKSNFPMEGFVEEVKLEDLVKLGHKYGIPTYYDAGKEFGISVDEPNFRDCISLGIDLVSGSGDKLLGGPQAGIIVGKKNLIEKIK--KNPIARALRIDKLTLSGLEMTLKLYFQDEKALRQKAKRLEKLLKDIPGLKISVIKDKAKPGGGSLPELELPSSQELSRRLRLAEPPIVCRIREDQLLFDMRTVFHEDLKTIK--KTLQELLS...... 391
47 -18.5002jis_A mol:protein length:515 CYSTEINE SULFINIC ACID DECARBOXYLASE  ali model follow..  15  111...................SGLDPHALAGRIITESLNTSQ-YTYEIAPVFVLMEEEVRALVGWSSGIFCPGGSISNMYAVNLARYQRYPDALFTSKECHYSIQKGAAFLGLGTDSVRVVKDERGKMVPEDLERQIGMAEALVSATSGTTVLGAF---DPLEAIADVCQRHGLWLHVDAA--WGGSVLLSQTHRHLLDGIDSVAWNPHKLLAAGLSALLLQDTSHGSQASYLFQQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPSLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLGQDL 509
48 -18.2002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  13  97...................TGLDMVGLAADWLTSTANTNM-FTYEIAPVFVLLEYVTREIIGWPGGIFSPGGAISNMYAMMIARFKMFPEIAFTSEHSHFSLKKGAAALGIGTDSVILIKDERGKMIPSDLERRILEAKQLVSATAGTTVYGAF---DPLLAVADICKKYKIWMHVDAA--WGGGLLMSRKHKWKLSGVNSVTWNPHKMMGVPLSALLVREEGLMQNCNQMHAQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMFDGKPQHTNVCFWYIPPSSKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQD. 497
49 -18.1006enz_A mol:protein length:530 Acidic amino acid decarboxylase GADL1  ali model follow..  12  126...................AGLDYYSLAARIITEALNPSI-YTYEVSPVFLLVEEAVIECVGWKEGIFNPGGSVSNMCAMNLARYRHCPDILFTSAECHYSMKKAASFLGIGTQNVYFVEDGRGKMIPEDLEKQIWQARQLVCATSGTTVLGAF---DPLDEIAEVCERHGLWLHVDAS--WGGSALVSRKHRRLLHGIDSVAWNPHKMLMAGISALLVKDKSYSAKATYLFQQCSRRPDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREGFKLLMEPEYTNVCFWYIPRKLSLVAPAIKEKMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDSLGRDM 524
50 -18.0003vp6_A mol:protein length:511 Glutamate decarboxylase 1  ali model follow..  14  104...................TGLDIIGLAGEWLTSTANTNM-FTYEIAPVFVLMEQITREIVGWSSGIFSPGGAISNMYSIMAARYKYFPEVLFTSEQSHYSIKKAGAALGFGTDNVILIKNERGKIIPADFEAKILEAKQYVNATAGTTVYGAF---DPIQEIADICEKYNLWLHVDAA--WGGGLLMSRKHRHKLNGINSVTWNPHKMMGVLLSAILVKEKGILQGCNQMHAQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMFNGEPEHTNVCFWYIPQSHKVAPKIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL 505
51 -17.8002gms_A mol:protein length:390 Putative pyridoxamine 5-phosphate-dependent dehydrase, Wbdk  ali model follow..  15  16.............................LEYKAIQSVLDSKMFTMGEYVKQYETQFAKTFGSKYAVMVSSGSTANLLMIAALFFTKKGDEIIVPAVSWSTTYYP----QQYGLRVKFVDIDINTLNIDIESLKEAVTDSTKAILTVNLLGNPN----NFDEINKIIGGRDIILLEDNCESMGAT-FNNKCAGTFGL-MGTFSSFYSHHIAT-GGCIVTDDEEIYHILLCIRALPGYNVRPLEMSGAIGIEQLKKLPRFISVRRKNAEYFLDKFKDHPYLDVQQETGESSGFSFIIKKDSGVIRKQLVENLNSAGI........................................... 330
52 -17.8001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  13  60.........................RAWQQGAEQFGIGSGGSVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMA--KEDRIAADRLSHASLLEA---ASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDG----DSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKVPELLVVTFGKGFGV-SGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLDEGDARREKLAALITRFRAGVQDLP---FTLADSCSAIQPLIVGDNSRALQ--LAEKLRQQGCWVTAIRPPTVAGTARLRLTLTAAHEMQDIDRLLEVLHGN.... 383
53 -17.8004zas_A mol:protein length:404 CalS13  ali model follow..  12  34.............................DVSTRVSAVLSSGRLEHGPTVAEYEAAVGSRIGNPRVVSVNCGTAGLHLALSLASEHDGPGEVLTTPLTFEGTNWP----LANGLRIR-VDPATLNMDLDDLAAKISPATRAIVVV---HWLGYPVDLNRLRAVVDAGYDRRPLVVEDCAQAWGATYR-----APLGTHGNVCVYSTGKILTGSGGFVVLPDDDLYDRLRLRRAEWGYRFILNEIGGAIGLSNLERVDELLRRHRENAAFYDKELAGIDGVEQTERADDREPAF-WMYPLKVRDRPAFMRRLLDAGI........................................... 341
54 -17.8006eeq_A mol:protein length:490 4-hydroxyphenylacetaldehyde synthase  ali model follow..  13  98...................ASSSNAGLLGELLCSGLSVIG--TWSSSPAATELENVVAKMLNLPSGVLQANTCEAVLCTLAAARDKALNRVLYCSDQTHFTIHKGAKLIGIRSKNIKSITTKKEKLCPNDLRDAIRSDLEYVCGTIGTTALGVV---DPIKELGKVAREFDLWLHVDGA--YGGSACICPEFQHYLDGVDSISMNAHKWLLSNCCFLWLQSPNALIESKDWQISLSRRFRAIKMWMVIRRYGVSNLIEHIRSDVSMAVRFEEMVAADDRFEIVFPRKFALVCFKLSSEKTPELTRELMERVNSSGKAYLSGVQMGRIFFIRCVIGSSLTEER-HVDNLWRLIQETAQSI 488
55 -17.8003ju7_A mol:protein length:377 Putative PLP-dependent aminotransferase  ali model follow..  12  17.............................EYLDELKEIDASHIYNYGPINQRFEQTIMSGFNRGAVTTVANATLGLMAAIQL-KKRKKGKYALMPSFTFPATPLA----IWCGLEPY-ISIDDWYMDKTVLWDKIEELKEEVAIVVPYATFGSWMNLEEYEELE----KKGVPVVVDAAPGFGLM-NGGMHYGQDFSGMIIYSFHATKPFGI-GGLIYSKNEEDIQRIKRMGNMMGFNCKMSEYAAAIGIATMKKWDDKLKERTRISEWYKQLLQSNGLMKKGWQLQKTEAVFMPILCPEEVRNKQVIEDLKKQKIEARLYFSPSCHQQVLFRIVSLPLWEGMTKEIVEQIVICLGQKV 372
56 -17.8003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  89...................................KAAGSSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSLTLCFLTLRHPKAKYIIWPRIDQKSCFKS----VTAGFEPVVIENV-DLKAVEAKIQELGPEHILCLHSTTACFAPRVP--DRLEELAVICANYDIPHVVNGLQSSKCMHLIQQGAR--VGRIDAFVQSLDKNFMVPVGGAIIFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLANERLLQTPHNPISLAMTLKTIDGHHDKAVTQLFRGFMSHADNYPCAYLNAAAAIGMKMQDVDLFI--KRLDKCLNIVRKE. 446
57 -17.8004lc3_A mol:protein length:391 Putative UDP-4-amino-4-deoxy-l-arabinose--oxoglutarate aminotransferase  ali model follow..  18  21.............................ETIQGVVEVLRSGWITTGPQCQKFEAALSEYCGGRPVRVFNSGTCTLEIGLRI-AGVGPGDEVITTPASWVSTSNV----IETGATPVFADIDPVTRNIDLDKLEQAITPRTKAIIPVFLSGLPV----DMDRLYAIARAHKLRVIEDAAQAFGSTWH-----KRIGAIGDLVSFSFHKNLTT-GGALVLNNEDEAVLAQKYRDVLGGKYNLTDVAARVGLGQLPHLERFTAQRRALARAYFAAFDGGAAAKLGVGLPVAHMFLVTLPLERLTITAEFMAQMKERGIGT-RYGASTVTLPLFTQMTEGDVRRVV--DAVNQICEQYGK.. 385
58 -17.8003dr4_A mol:protein length:391 Putative perosamine synthetase  ali model follow..  15  49..............................................GRFIVEFEKAFADYCGVKHAIACNNGTTALHLALVA-MGIGPGDEVIVPSLTYIASANS----TYCGATPVLVDNDPRTFNLDAAKLEALITPRTKAIMPVHLYGQIC----DMDPILEVARRHNLLVIEDAAEAVGAT-YRGKKSGSLGD-CATFSFFGNAIITGEGGMITTNDDDLAAKMRLLRGQVGFNYRMTNIQAAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGMYTVRLGEGLSTTRDQVIKDLDALGIESRPVFHPMHIMPPYAHLATDDLKIALTEADIDRVIAALDQVL 384
59 -17.7004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  12  87...................ALTSWPSLLGDMLADAINCLGF-TWASSPACTELEMNVAKMLGLPEGVLQSTVSESTLIALLAARKNKILEMAYASDQAHSSVEKA---GLISLVKMKFLPDDNFSLRGEALQKAIEEDKQFVCATLGTTGVCAF---DCLSELGPICAREGLWLHIDAA--YAGTAFLCPEFRGFLKGIDSFTFNPSKWMMVHCTGFWVKDKYKLQQTMHWQIPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEI-PAKRHLGLVVFRLKGPNSLTENVLKEIAKAGRLFLIPADKLIIRFVTSQFTTRDDILRDW--NLIRDAATLILSQ. 481
60 -17.6002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  12  60.........................ARLAKSLLEEQQSLFMSFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQ--PNTNVYIDFFAHMSLWEG---ARYANAQAHPFMHNN----CDHLRMLIQRHGPGIIVVD--STLGTIAPLAELVNI---SKEFGCALLVDESHSLGTHGPNGAGLLALTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLESADNRRQHLDRMARKLRIGLSQLG-------TIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYG 384
61 -17.6006eew_A mol:protein length:500 Aromatic-L-amino-acid decarboxylase  ali model follow..  13  103...................ATVSSAAFLGEMLSTALNSVGF-TWVSSPAATELEMIVAQILKLPKFSGTGGGVIQNTTSESILCTIIAARECYGSDQTHTMFPKTCKLAGIYPNNIRLIPTTVEGISPQVLRKMVEDDVAFLCATLGTTSTTAT---DPVDSLSEIANEFGIWIHVDAA--YAGSACICPEFRHYLDGIDSLSLSPHKWLLAYCTCLWVKQPHLLLRAKNWQIATGRKFRSLKLWLILRSYGVVNLQSHIRSDVAMAKMFEEWVRSDSRFEI-VVPRNFSLVCFRLSLHVEEVNKKLLDMLNSTGRVYMTHTIVGGIYMLRLAVGSSLTEEH-HVRRVWDLIQKLTDDL 496
62 -17.6003k40_A mol:protein length:475 Aromatic-L-amino-acid decarboxylase  ali model follow..  11  82...................TANSYPAIVADMLSGAIACIG--TWIASPACTELEVVMGKMLELPAGVIQGTASESTLVALLGAKAKKLKEVGYCSDQAHSSVERAGLLGGVKLRSVQSENHRMRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAA--YAGSAFICPEYRHLMKGIDSFNFNPHKWMLVNCSAMWLKDPSWVVNARHWQIPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFEL-AAEINMGLVCFRLKGSNERNEALLKRINGRGHIHLVPADVYFLRMICSRFTQSEDMEYSW--KEVSAAADEMEQE. 474
63 -17.5005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  12  62.........................AAIAEGAQRYGAGSGGSLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAG--RGTTLFSDALNHASLIDG---ARLSRADVQIYPHCDTDALSAMLEASDADVKVIVSDTVFSMDG----DIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIALRSPNLISIGTLDKAAGV-SGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLEEGDARRAHLQQLIGRTRAMLKATP---WLPVDSHTAVQPLIIGANDATLE--IAATLDRAGLWVPAIRPPTVTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKA 395
64 -17.5005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  12  60.........................AAFAEGAQRYGSGSGGSLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAG--KDATIFSDALNHASLIDG---TRLSRATVQVYPHADTATLGALLEACTSQTKLIVTDTVFSMDG----DIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALALRSPHLVYVGTLGXAAGV-AGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLDEGDARRAHLAALIERTRALLRRTR---WQPVDSHTAVQPLVIGSNEATLA--AMRALDAHGLWVPAIRPPTVAGTSRLRISLSAAHSFDDLARLETALLRASEEA 393
65 -17.5002po3_A mol:protein length:424 4-dehydrase  ali model follow..  12  33.............................RLYERLDRALDSQWLNGGPLVREFEERVAGLAGVRHAVATCNATAGLQLLAHAA-----TGEVIMPSMTFAATPHA----RWIGLTPVFADIDPDTGNLDPDQVAAAVTPRTSAVVGVHLWGRPC----AADQLRKVADEHGLRLYFDAAHALGCA-VDGRPAGSLGD-AEVFSFHATKAVNA-GGAVVTDDADLAARIRALHNAGGTNAKMSEAAAAMGLTSLDAFPEVIDRNRRNHAAYREHLADLPGVLVADHDRHGQYVIVEIDEATTGIHDLVMEVLKAEGV........................................... 324
66 -17.5003w1h_A mol:protein length:452 L-seryl-tRNA(Sec) selenium transferase  ali model follow..  15  115............................................KRGSRIAHIEKYLNELTGAESSFVVNNNAGAVFLVLNTLAEGKE-RGELVEIGGSFRIPD---IMKKSGAILREVGTTNKTKVSDYEGAINQNTALLMKVHKSNFYMEGFVEEVKLEDLVKLGHKYGIPTYYDAGKEFGISVDEPNFRDCISLGIDLVSGSGDKLLGGPQAGIIVGKKNLIEKIK--KNPIARALRIDKLTLSGLEMTLKLYF-DEKALRQKAKRLEKLLKDIPGLKISVIKDKAKPGGGSLPELELPSSQELSRRLRLAEPPIVCRIREDQLLFDMRTVFHEDLKTIK--KTLQELLS...... 451
67 -17.4003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  12  74.........................ARLAKSLLEEQQSLFMSFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQ--PNTNVYIDFFAHMSLWEG---ARYANAQAHPFMHNN----CDHLRMLIQRHGPGIIVVDS-STLGTIAPLAELVNI---SKEFGCALLVDESHSLGTHGPNGAGLLALTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLESADNRRQHLDRMARKLRIGLSQLG-------TIRSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYG 398
68 -17.4006eei_A mol:protein length:490 Tyrosine decarboxylase 1  ali model follow..  12  93...................SNSSVAGFLGEMLSAGLGIVGF-SWVTSPAATELEMIVAKLLNLPESKGNGGGVIQGSASEAVLVVLIAARDVYSSDQTHSALQKACQIAGIHPENCRVLTSTNYALRPESLQEAVSRDLEFLCANVGTTSSTAV---DPLAALGKIANSNGIWFHVDAA--YAGSACICPEYRQYIDGVDSFNMNAHKWFLTNCSLLWVKDQDSLTLAKDWQIPLGRRFRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDPNFEIVTPRIFALVCFRLVPKKCNNRNRELLDAVNSSGKLFMSHTALSGKIVLRCAIGAPLTEEK-HVKEAWKIIQEEASYL 487
69 -17.3001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  12  82...................TASSYPAMLADMLCGAIGCIG--SWAASPACTELETVMGKMLQLPEGVIQGSASEATLVALLAARTKVVRRVAYASDQAHSSVERA---GLIGGVKLKAIPDGKFAMRASALQEALERDKAFVVATLGTTSCCSF---DNLLEVGPICHEEDIWLHVDAA--YAGSAFICPEFRHLLNGVDSFNFNPHKWLLVNCSAMWVKRRTDLTGARHWQLPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEV-CAEVTLGLVCFRLKGSDGLNEALLERINSARKIHLVPCGQFVLRFICSRKVESGHVRLAW--EHIRGLAAELLAA. 477
70 -17.3004k2i_A mol:protein length:443 NTD biosynthesis operon protein NtdA  ali model follow..  15  85.............................DILNTLTEVLPTGKFTSGPYLEQFEKVLSTYLHKRYVIATSSGTDAIMIGLLA-LGLNPGDEVIMPANSFSATENA----LASGGVPIYVDINPQTFCIDPDKIEEAITPYTKFILPVHLYGKHS----DMQHIRQIANRYKLKVIEDACQGIGL--------TDLGKYADITTLSFNKNFGV-AGAIATDNEELAKKCIQFSYNFGFNSKMDNLQAAIGLERMKYLSLNNFKRLFLADRYITQLAELQNKGYIELPELSHLFPIKVRTEDRA--DIMTKLNEDFGV........................................... 375
71 -17.3003bb8_A mol:protein length:437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase  ali model follow..  15  44.............................KELQLMVEASLDGWLTTGRFNDAFEKKLGEYLGVPYVLTTTSGSSANLLALTALTSPKPGDEVITVAAGFPTTVNP----IQNGLIPVFVDVDIPTYNVNASLIEAAVSDKTKAIMIAHTLGNLF----DLAEVRRVADKYNLWLIEDCCDALGST-YDGKMAGTFGD-IGTVSFYPAKHITGEGGAVFTQSAELKSIIESFRDHLGYNLKITDMQAACGLAQLERIEEFVEKRKANFKYLKDALQSCADFIELPEATENSGFPITLKEDSGVSRIDLVKFLDEAKV........................................... 371
72 -17.2004piw_A mol:protein length:396 TDP-4-keto-6-deoxy-D-glucose transaminase family protein  ali model follow..  12  1.MGSSSSGLVPRGSHMIPFNAPPVVGTELDYMQSAMGS--GKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALL-LDIQPGDEVIMPSYTFVSTANA----VLRGAKIVFVDVRPDTMNIDETLIEAAITDKTRVIVPVHYAGVAC----EMDTIMALAKKHNLFVVEDAAQGVMST-YKGRALGTIGH-IGCFSFHETKNYTA-GGATLINDKALIERAEIIREKIGSSYLMSDLQAAYLWAQLEAADRINQQRLALWQNYYDALAPLAKLPSIPDGCVQNAHMFYIKLRDIDDRSALINFLKEAEI........................................... 329
73 -17.2003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  11  82...................TASSYPAMLADMLCGAIGCIG--SWAASPACTELETVMGKMLELPKGVIQGSASEATLVALLAARTKVEKLVAYSSDQAHSSVERA---GLIGGVKLKAIPDGNFAMRASALQEALERDKAFMVATLGTTTCCSF---DNLLEVGPICNKEDIWLHVDAA--YAGSAFICPEFRHLLNGVDSFNFNPHKWLLVNCSAMWVKKRTDLTGARHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEI-CVEVILGLVCFRLKGSNKVNEALLQRINSAKKIHLVPCDKFVLRFICSRTVESAHVQRAW--EHIKELAADVLRA. 477
74 -17.2006ewj_A mol:protein length:427 Putative capsular polysaccharide biosynthesis protein  ali model follow..  11  22.............................AEITEVVDTLRSGWITTGPKTKELERRLSLYTQTPKTVCLNSATAALELILRV-LEVGPGDEVIVPAMTYTASCSV----THVGATPV-IQADTFEMDYDLLEQAITEKTKVIIPV---ELAGIVCDYDRLFQVVEKKRDNRIVIVSDSAHALGSTYK-----QPSGSIADFTSFSFHKNFTTAEGGSATDDEEMYKEFQILSVTPAYKCNMTDIMASLGLVQLDRYPSLLQRRKDIVDRYDSGFAGSRIHPLAHKTETVHLYITRVEGASLEERNLIIQELAKAGIAS-AFFENEITLPLHTKLSDEEVDYII--ETFKTVSEKVLTL. 411
75 -17.1005w71_A mol:protein length:440 L-glutamine:2-deoxy-scyllo-inosose aminotransferase  ali model follow..  14  32.....................DRTRRKIEEVFQSNRWAISGYWTGEESMERKFAKAFADFNGVPYCVPTTSGSTALMLALEA-LGIGEGDEVIVPSLTWIATATANALPVFVD-----VEADTYCIDPQLIKSAITDKTKAIIPV---HLFGSMANMDEINEI---AQEHNLFVIEDCAQSHGSV-WNNQRAGTIGD-IGAFSCQQGKVLTA-GGIIVTKNPRLFELIQQLRAIQGSNYCLSEFQSAILLDQLQELDDKNAIREKNAMFLNDALSKIDGIKVMKRPPQVSGYVFRFDPVGLNADQFCEILREKLNM........................................... 349

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.