current user: public

If you have questions about the server, please let us know.

Query: 3pmd_A mol:protein length:153 Conserved domain protein, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst GSHMEATKRYLCLYLKESQEKFISNWKKRILVHEHDPYKNEIIKNGTHLLHVFTMYMREEINLQDIEDISKKIAQERMDAKVNIADFIYNTNEGKKEILNTLFLLNPTGQECKVVIEQINLFFDHLIYSTIYSYYKLKKEYIHSYYELKKKYNLast
1 -62.4003pmd_A mol:protein length:153 Conserved domain protein  ali model  100  1GSHMEATKRYLCLYLKESQEKFISNWKKRILVHEHDPYKNEIIKNGTHLLHVFTMYMREEINLQDIEDISKKIAQERMDAKVNIADFIYNTNEGKKEILNTLFLLNPTGQECKVVIEQINLFFDHLIYSTIYSYYKLKKEYIHSYYELKKKYN 153
2 -52.2003pmc_A mol:protein length:139 Uncharacterized protein pXO2-61/BXB0075/GBAA_pXO2_0075  ali model follow..  63  1GSHMEEIKCLLCRYLKERQEKFISDWKKKVIIRERDPYKEEIIKNGEHLLSAFIMYLKEEISLQEIEITSKKIARERIDAKVNIAEFIHNTNVAKIEIMNILTLLNPDLQQYQALVKKINQFFDHLIYYTVHSYYEQKA.............. 139
3 -26.0002bnl_A mol:protein length:136 MODULATOR PROTEIN RSBR  ali model follow..  11  4.......NQTVYQFIAENQNELLQLWTDTLKELSEQESYQLTDQVYENISKEYIDILLLSKDENAAESQISELALRAVQIGLSMKFLATALAEFWKRLYTKMNDKRLPDQESTELIWQIDRFFSPINTEIFNQYSISWE.............. 136
4 -19.4004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  10  59GQFPAPVVAQIRELATTHQSELPGYFYEQMLQDEQEQVKSRLHGTLRQWIVSVFSMSDDDAALQALIAQQKQIGEIHARIKIPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISETVDLAMEIMSRAFSDAYDRNSRSEE....... 211
5 -18.6004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  17.....PIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIIN-DDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFTFSDSSASKEDENY..... 164
6 -16.5002w31_A mol:protein length:162 GLOBIN  ali model follow..  14TDEDAELLGSLFPLAETNKERLADQFYDYLLGIPETLKEDLVLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKILDINLDIMSASYREEEMRKFFVSH....... 162
7 -16.0004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  22.....HEWVAARNVVTANKAALADYFYESMLADPDQLVKTKLHASMQDWLESVYAAAPTEEYERTVAF-QRKVGEVHARIDIPVHLVTRGASALIRRICELLRDASLSAAQAAATCRYVADVTMTAVEMMSHAYSVSHDRNARAEE....... 169
8 -15.6004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  22.....PIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIIN-DDVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFLE................. 157
9 -10.9005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  11  19GDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAERFHGDPPELERVRNALGKVLDLELAVMLHTYRE................. 159
10 -9.9802veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  11  35TAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSSPDGTPNEKYLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNVESVPNITATMKPFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPYVKYGD.............. 194

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.