current user: public

If you have questions about the server, please let us know.

Query: 3qqq_A mol:protein length:168 Non-symbiotic hemoglobin, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAWGEAYDQLVAAIKSEMKPSSTLast
1 -75.1003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model  100  1MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAWGEAYDQLVAAIKSEMKPSST 162
2 -72.7003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  93  1MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSPVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKVTVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAWGVAYDQLVAAIKFEMKPSST 162
3 -71.4003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  79  2..ESEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPIPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSPEMKVAWGQAYDHLVAAIKAEMNLSN. 160
4 -69.7002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  72  1MSAAEGAVVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEIAPSARQMFPFLRDSDVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHFEVTRFALLETIKEALADMWGPEMRNAWGEAYDQLVAAIKQEMKPAE. 162
5 -69.2001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  67  6.DNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE. 166
6 -68.8002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  71  5.EADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKEALADMWSLEMKKAWAEAYSQLVAAIKREMKPDA. 165
7 -67.6001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  43  1.......GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLEVTGVV-VTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELAIVIKKEMDDAA. 153
8 -63.1002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  22  1......GSHMERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGRSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSS---LEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAMSRGWDGE.. 154
9 -62.9002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  15  1.........MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDVPLEELSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTA--ASSLDESQAATWAKLVDHVYAIIFKAIDDDGN 151
10 -62.8001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  21  1.........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNGRSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSS---LEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE.. 151
11 -62.7004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  21  1.........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSS---LEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE.. 151
12 -62.0001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  17  5.QSFQSVGDLTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHNDPTAQRKFPQMAGLSAELRTSRQMHAHAIRVSALMTTYIDEMDT----EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTKQVHDAWAKTFAIVQGVLITKHAS... 159
13 -61.7001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  42  1.......VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLAN--GVDPTNPKLTGHAEKLFALVRDSAGQLKASGTV----VADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAIKKA...... 143
14 -61.4004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  20  2VDAAVAKVCGSEAIKANLRRSWGVLSADIEATGLMLMSNLFTLRPDTKTYFTRLGDV-QKGKANSKLRGHAITLTYALNNFVDSLDDPS---RLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDVAGAWAALVGVVQAAL......... 150
15 -61.3004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  23  2..ATLEAMQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMEENPETFQIFPWADATAKEMRSHPRFKSHAKSIGKVISDCLVDLNGVK---KHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSEAWSEEKKEAWLKAYGIITVMVTE....... 154
16 -61.1004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  20  4VAELANAVVSNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKTSPSAKGKFARLGDVS-AGKDNSKLRGHSITLMYALQNFVDALDDVER---LKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDTVAAWASLVAVVQAAL......... 152
17 -61.0001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  20  5.LAIQAQGDLTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSSQLRSSRQMQAHAIRVSSIMSEYVEELDS----DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKTRDAWAKAFSVVQAVLLVKHG.... 158
18 -59.4002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  17  1.........MNSEEVNDIKRTWEVVAAKMTEAGVEMLKRYFKKYPHNLNHFPWFKEIPDDLPENARFKTHGTRILRQVDEGVKALSVDFGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCVK--LNEKQVHAYHKFFDRAYDIAFAEMAKMG. 151
19 -58.3001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  16  1........MLDQQTINIIKATVPVLKEHGVTITTTFYKNLFAKHPEVRPLFD---------MGRQESLEQPKALAMTVLAAAQNIENLPA---ILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATDDILDAWGKAYGVIADVFIQVEADLYA 142
20 -58.0001x46_A mol:protein length:150 hemoglobin component VII  ali model follow..  20  2....PTWVDMEAGDIALVKSSWAQIHDK----EVDILYNFFKSYPASQAKFSAFAGKDESLKDTAPFALHATRIVSVINEAIALMGVAENRPALKNVLKQQGINHKGRGVTAAHFEEFETALEAFLES-HASGYNAGTKKAWDSAFNNMYSVVFPEL..... 150
21 -57.8002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  17  1......XTTLTNPQKAAIRSSWSKFMDNGVSNGQGFYMDLFKAHPETLTPFKSLGLTLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDND---MLVVLIQKMAKLHNNRGIRASDLRTAYDILIHYMED--HNHMVGGAKDAWEVFVGFICKTLGDYMKELS. 152
22 -57.7001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  19  1........GLSAAQRQVIAATWKDIADNGAGVGKKCLIKFLSAHPQMAAVFGFSG------ASDPGVAALGAKVLAQIGVAVSHLGDEG---KMVAQMKAVGVRHKGYGIKAQYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGALISGLQS... 147
23 -57.6001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  19  1........GLSAAQRQVVASTWKDIADNGAGVGKECFTKFLSAHHDMAAVFGFSG------ASDPGVADLGAKVLAQIGVAVSHLGDEG---KMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGALISGLQS... 147
24 -57.6003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  18  1......SSGLTGPQKAALKSSWSRFMNNAVTNGTNFYMDLFKAYPDTLTPFKSLNVSFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEV---LVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHCH--VEGSTKNAWEDFIAYICRVQGDFMKER.. 151
25 -57.6001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  19  1........GLSAAQRQVVASTWKDIADNGAGVGKECLSKFISAHPEMAAVFGFSGA------SDPGVAELGAKVLAQIGVAVSHLGDEG---KMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGALISGLQS... 147
26 -57.5001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  24  1........SLSAAEADLAGKSWAPVFANKNANGDAFLVALFEKFPDSANFFADFKGKSADIKASPKLRDHSSTIFTRLNEFVNNAANAGK---MSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAA--PPAGADAAWTKLFGLIIDALKAAGK.... 146
27 -57.4001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  24  10IERRERSEELSEAERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMELEMERSPQLRKHASRVMGALNTVVENLHDPDK---VSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHVTAAYKEVGW 171
28 -57.0001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  23  1.......XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKSADIKASPKLRDVSSRIFTRLNEFVNNAANAGK---MSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAA--PPAGADAAWTKLFGLIIDALKAAGA.... 147
29 -56.5005oj9_A mol:protein length:163 Myoglobin  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELG. 151
30 -56.5005oja_A mol:protein length:163 Myoglobin  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPEILEKFDDLKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELG. 151
31 -56.4001h1x_A mol:protein length:154 MYOGLOBIN  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVRVLTALGAILKKKGH------HEAELKPLAQDHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
32 -56.4003uh6_A mol:protein length:146 Globin-1  ali model follow..  15  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSIALMYALQNFIDQLDNPDD---LVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
33 -56.4002r4x_A mol:protein length:146 Globin-1  ali model follow..  15  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGVSITLMYALQNFIDQLDNPDD---LVCVVEKFAVNHITRKISAAEFGKMNGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
34 -56.3003uhd_A mol:protein length:146 Globin-1  ali model follow..  16  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDD---LVCVVEKFAVAHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
35 -56.3003uhb_A mol:protein length:146 Globin-1  ali model follow..  16  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDD---LVCVVEKFAVNHITKKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
36 -56.2001myh_A mol:protein length:153 MYOGLOBIN  ali model follow..  16  1........GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDRFKHLKDEMKASEDLKKHGNTVLTALGGILKKKGH------HEAELTPLAQSHATHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELG. 150
37 -56.2003ugz_A mol:protein length:146 Globin-1  ali model follow..  16  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDD---LVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
38 -56.2003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  22  2.........IDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEEPTVSVLF------------QNPISSQSRKLMQVLGILVQGIDNLEG---LIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAWTKVYGIAAQVMTA....... 132
39 -56.2003ugy_A mol:protein length:146 Globin-1  ali model follow..  16  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNYIDQLDNPDD---LVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
40 -56.2002w6x_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKQGVRVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELG. 151
41 -56.2003uhi_A mol:protein length:146 Globin-1  ali model follow..  17  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDD---LVCVVERFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
42 -56.2003uhc_A mol:protein length:146 Globin-1  ali model follow..  16  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQAFIDQLDNPDD---LVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
43 -56.2001co8_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYAEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
44 -56.1002auo_A mol:protein length:146 Globin I  ali model follow..  16  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDD---LVCVVEKYAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
45 -56.1001ch5_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKVKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
46 -56.1001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  15  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGNVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDD---LVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
47 -56.1002grf_A mol:protein length:146 Globin-1  ali model follow..  16  2.SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALVTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDD---LVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
48 -56.1002oha_A mol:protein length:154 Myoglobin  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELWRKDIAAKYKELG. 151
49 -56.0003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  22  1.........MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDVEPKVRPLF------------KIDIEKQGRKLMDVLNWIVLNLQDID---AALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVMIEE...... 132
50 -56.0002r4z_A mol:protein length:146 Globin-1  ali model follow..  16  2.SVYDAAAQLTADVKKDLRDSWKVWGSDKKGNGVALMTTLFADNQETIGYFKRLGDVS-QGMANDKLRGHSITLMYALQNFIDQLDNPDD---LVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL......... 146
51 -56.0002ohb_A mol:protein length:154 Myoglobin  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFWSEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
52 -55.9001mnh_A mol:protein length:153 MYOGLOBIN  ali model follow..  15  1........GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKDEMKASEDLKKVGNRVLTALGGILKKKGH------HEAELTPLAQSHAKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELG. 150
53 -55.9001obm_A mol:protein length:154 MYOGLOBIN  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKQGVTFLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
54 -55.9001cik_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHATHKAPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
55 -55.900101m_A mol:protein length:154 MYOGLOBIN  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
56 -55.9004pqb_A mol:protein length:154 Myoglobin  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIEIRLFKSHPETLEKHDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELG. 151
57 -55.9006bmg_A mol:protein length:154 Myoglobin  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADIAGHGQDILIRLFKHHPETLEKFDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPADFGADAQGAMSKALELFRKDIAAKYKELG. 151
58 -55.9005ojc_A mol:protein length:163 Myoglobin  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDTLIRLFKSHPEILEKFDGLKHLKAEMKASEDLKEHGVTLLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKHLEFFSEAIIHVLHSRHPGDFGADAQGAMNKALELFRTDIAAKYKELG. 151
59 -55.9005ycg_A mol:protein length:157 Ancestral myoglobin aMbWp of Pakicetus relative  ali model follow..  17  2.....SHMGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLKDEMKASEDLKKHGNTVLTALGGILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISDAIIHVLQSKHPGDFGADAQGAMNKALELFRNDIAAKYKELG. 154
60 -55.9001emy_A mol:protein length:153 MYOGLOBIN  ali model follow..  16  1........GLSDGEWELVLKTWGKVEADIPGHGETVFVRLFTGHPETLEKFDKFKHLKGEMKASEDLKKQGVTVLTALGGILKKKGH------HEAEIQPLAQSHATHKIPIKYLEFISDAIIHVLQSKHPAEFGADAQGAMKKALELFRNDIAAKYKELG. 150
61 -55.9001dxc_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKQGVRVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
62 -55.9001lhs_A mol:protein length:153 MYOGLOBIN  ali model follow..  18  1........GLSDDEWNHVLGIWAKVEPDLSAHGQEVIIRLFQLHPETQERFAKFKNLTDALKSSEEVKKHGTTVLTALGRILKQKNNHE------QELKPLAESHAKHKIPVKYLEFICEIIVKVIAEKHPSDFGADSQAAMKKALELFRNDMASKYKEFG. 150
63 -55.9001do1_A mol:protein length:154 MYOGLOBIN  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
64 -55.8002e2y_A mol:protein length:154 Myoglobin  ali model follow..  17  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKWDRFKHLKAEMKASEDLKKDGVTILTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
65 -55.8005utb_A mol:protein length:154 Myoglobin  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTALTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFYSEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
66 -55.7003rgk_A mol:protein length:153 Myoglobin  ali model follow..  16  1........GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDRFKHLKDEMKASEDLKKHGATVLTALGGILKKKGH------HEAEIKPLAQSHAKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELG. 150
67 -55.7004lpi_A mol:protein length:154 Myoglobin  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIHIRLFKSHPETLEKYDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELG. 151
68 -55.7004fwx_A mol:protein length:153 Myoglobin  ali model follow..  18  2.........LSEGEWQLVLHVWAKVEADVAGHGQDIHIRLYKSHPETLEKHDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELG. 150
69 -55.7001mcy_A mol:protein length:154 MYOGLOBIN (CARBONMONOXY)  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKQGVTVLTALGAILKKKGH------HEAELKPLAQSHATHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELG. 151
70 -55.6001mbs_A mol:protein length:153 MYOGLOBIN  ali model follow..  17  1........GLSDGEWHLVLNVWGKVETDLAGHGQEVLIRLFKSHPETLEKFDKFKHLKDDMRRSEDLRKHGNTVLTALGGILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSKHPAEFGADAQAAMKKALELFRNDIAAKYKELG. 150
71 -55.6001m6c_A mol:protein length:153 PROTEIN (MYOGLOBIN)  ali model follow..  16  1........GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLKDEMKASEDLKKHGNTNLTALGGILKKKGH------HEAELTPLAQSHAKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDMAAKYKELG. 150
72 -55.6005ych_A mol:protein length:154 Ancestral myoglobin aMbWb of Basilosaurus relative (monophyly)  ali model follow..  19  1.......MVLSDGEWQLVLNIWAKVEADVAGHGQDVLIRLFKGHPETLEKFDKFKHLKAEMKASEDLKKHGNTVLTALGGILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISDAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELG. 151
73 -55.6002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  17  2.........LSAADKTNVKAAWSKVGGHAGEYGAEALERMFLGFPTTKTYFPHFD----LSHGSAQVKAHGKKVADGLTLAVGHLDD------LPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVSTVLTSKYR.... 141
74 -55.6001ch1_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKHGVTVLTALGAILKKKGH------HEAELKPGAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151
75 -55.6001fcs_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKAEMKASEDLKKVGVRVLTALGAILKKKGH------HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDIAAKYKELG. 151

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 0 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Godzik A. Discovering new genes with advanced homology detection. Trends Biotechnol. 2002 Aug;20(8):315-6.