current user: public

If you have questions about the server, please let us know.

Query: 3rq1_A mol:protein length:418 Aminotransferase class I and II, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst SNAMTSVAAKHAKGKKLKDVIFVTAGQAQADAKENGRENVVNGTLGAIHDEEGNLVFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKECFGNFRPEGHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLFDEHNNFNHEAFQNRVNELAAKQTNVVVIFNTPGNNPTGYSIEDKDWDSILNFLKDLVAIGRNNVIIGIDVAYLDYSGEKDEVRAFFNKFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNKSTSRATWSNICRPAMRTMANIVADPAKFKEYEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTDSANAICEELKKEHIYVIALANGIRIAACGIPKCQMTGLAEKIYNAMKSLGKLLast
1 -112.0003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model  100  1SNAMTSVAAKHAKGKKLKDVIFVTAGQAQADAKENGRENVVNGTLGAIHDEEGNLVFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKECFGNFRPEGHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLFDEHNNFNHEAFQNRVNELAAKQTNVVVIFNTPGNNPTGYSIEDKDWDSILNFLKDLVAIGRNNVIIGIDVAYLDYSGEKDEVRAFFNKFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNKSTSRATWSNICRPAMRTMANIVADPAKFKEYEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTDSANAICEELKKEHIYVIALANGIRIAACGIPKCQMTGLAEKIYNAMKSLGKL 418
2 -101.0004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  36  1SNAM-PMTIKRATWNNGPDLAFDINNKANAAIEKYGREAVINAALGTLLDDKGKIIALPSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKPEGYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDFAFNIDVYKEAIDEGIRDSDRIASLINSPGNNPTGYSLSDEEWDEVITFLKEKAEDKDKKITLIVDVAYLEFAGDGDQQRKFFEKFSNLPRNLFVVVAFSMSKSHTAYGLRSGAAVGISSSKEIIEEFEASLAHSARCNWSNGTH-AAQNILIELERAENKKIYEQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPTDKAFDIVKDLEKENIFTIPSAKGIRVAICGVGEEKIPKLVQRLAFYTNK.... 412
3 -81.4002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  20  1.GAMNPLALNEQLQQSNATAFAMLSDLGQNSQSAEAKSTTYNATIGMATNKDGKM-FASSLDAMFNDLTPDEIFPYAPPQGIEELRDLWQQKMLRDNSIDNMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRGANLQTYPIFDKDGHYTTDSLVEALQSY--NKDKVIMILNYP-NNPTGYTPTHKEVTTIVEAIKALANK-GTKVIAVVDDAYYGLFYEDVYTQSLFTALTNLHSNILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKFDKEIEQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHDPEALRKHLIDKYSIGVIALNDIRIAFSCVEKDDIPHVFDSIAKAIDDLR.. 430
4 -81.2004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  21  2.....AVGTFENITAAPADPILGLADLFR----ADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETKNYLGIDGIPEFGRCTQELLFGKGSALINDKRAPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENH----DFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKE--LIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQ--VLRLREE--FGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL...... 400
5 -81.0004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  21  10TQGPGSMSLFSAVELAPRDPILGLNEAFN----ADTRPTKVNLGVGVYTNEDGKIPLLRAVRDAEKARVAGLPRGYLPIDGIAAYDASVQKLLLGDDSPAGRVVTAQALGGTGALKIGADFLLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTN----NFDGMLAALNGYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKA------RRLVPFLDIAYQGFGESIEADAAAVRLFAAANLN--VFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGFSFINAQRGMFSYSGLTSAQ--VDRLREE--FGIYAVSTGRICVAALNTRNLDVVANAIAAVLK..... 414
6 -80.8001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  22  1........MFENITAAPADPILGLADLFR----ADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETKNYLGIDGIPEFGRCTQELLFGKGSALKRARTAQTPGGTGAVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENH----DFDALINSLNEAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVE------KGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKE--LIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQ--VLRLREE--FGVYAVASGLVNVAGMTPDNMAPLCEAIVAVL...... 396
7 -80.6003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  21  1........MFENITAAPADPILGLADLFR----ADERPGKINLGQGVYKDETGKTPVLTSVKKAEQYLLENETKNYLGIDGIPEFGRCTQELLFGKGSALINTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENH--TLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLFDFAQQGFARGLEEDAEGLRAFAAMHKE--LIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIYANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQ--VLRLREE--FGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL...... 396
8 -80.4004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  21  1......MAMFEHIDAYPGDPILTLNENFQ----KDPRDQKVNLSIGIYFDAEGRIPVMGAVREAETALQDSGPKPYLPMVGLAAYRDAVQSLVFGADHPAGRIATLQTLGGSGAVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATG----KFDAMLAAIDALPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEA------RELLPFVDMAYQGFGAGLDADAFAVRELARRGVP--TLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVLTRYVKQRGMFTYTGLTESQ--VDALREV--HGVYILRSGRMCVAGLNDSNVGIVADAIGKVLKSGA.. 402
9 -80.3002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  20  1........MFENITTAPADPILGLADLLR----ADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETKNYLGIDGIPEFGRCTQELLFGKGSALINTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENH----DFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKE--LIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQ--VLRLREE--FGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL...... 396
10 -80.2001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  20  1........MFENITTAPADPILGLADLLR----ADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETKNYLGIDGIPEFGRCTQELLFGKGSALINDKRAPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENH----DFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKE--LIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFTIKQNGMFFFGGLTKEQ--VLRLREE--FGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL...... 396
11 -79.7002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  20  1........MFENITTAPADPILGLADLLR----ADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETKNYLGIDGIPEFGRCTQELLFGKGSALINDKRAPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENH----DFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKE--LIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFTIKQNGMFFFGGLTKEQ--VLRLREE--FGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL...... 396
12 -79.3003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  21  1........MFQKVDAYAGDPILTLMERFK----EDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLQPHGASLYLPMEGLNCYRHAIAPLLFGADHPQQRVATIQTLGGSGALKVGADFLYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATN----RFNDLLATLKTLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKA------RELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLP--ALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVKVLSTEMFDYLLNQRGMFSYTGLSAAQ--VDRLREE--FGVYLIASGRMCVAGLNTANVQRVAKAFAAVM...... 397
13 -79.3004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  22  2.....AVGTFENITAAPADPILGLADLFR----ADERPGKVDLGIGVYKDETGKTPVMTSVKKAEQYLLENETKTYLGLDGLPEFGRCTQELLFGKGSADKRARTAQTPGGSGALRVAADFLNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENH----DFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVE------KGWLPLIDFAYQGFGRGLEEDAEGLRAFAAMHKE--LIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQ--VLRLREE--FGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL...... 400
14 -79.0004h51_A mol:protein length:420 Aspartate aminotransferase  ali model follow..  21  6QAAMTTAERWQKIQAQAPDVIFDLAKRAAAA-----KGPKANLVIGAYRDEQGRPYPLRVVRKAEQLLLDMNDYEYLPISGYQPFIDEAVKIIYGNTVELENLVAVQTLSGTGAVSLGAKLLTRETTPIYLSDPTWPNHYGVVKAAGWNICTYAYYDPKTV--SLNFEGMKKDILAAPDGSVFILHQCAHNPTGVDPSQEQWNEIASLMLA------KHHQVFFDSAYQGYASG-SLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRRTVYDELLRLQWEHVINQIGMFSFLGLSKAQ--CEYCQNHNIFIT---VSGRANMAGLTHETALMLAQTINDAVRNVNR. 413
15 -78.9001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  20  1........MFENITATTADPILGLADLFR----ADERPGKIDLGIGVYKDETGKTPVLTSVKKAEQYLLENETKNYLGIDGIPEFGRCTQELLFGKGSALINTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENH----DFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKE--LIVASSYSKNFALYNERVGACTLVAADSETVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQ--VLRLREE--FGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL...... 396
16 -78.8001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  22  1........MFENITAAPADPILGLADLFR----ADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLNETTKLYLGIDGIPEFGRCTQELLFGKGSALKRARTAQTPGGSGALRVAADFLNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENH----DFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKE--LIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQ--VLRLREE--FGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL...... 396
17 -78.2004f5k_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  22  2.....AVGTFENITAAPADPILGLADLFRA----DERPGKVDLGVGVYKDETGKTPVMTSVKKAEQYLLENETKTYLGLDGLPEFGRCTQELLFGKGSADKRARTAQTPGGSGALRVAADFLNTSVKRVWVSNPTWPNHKAIFNSAGLEVREYAYYDAENH--TLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVE------KGWLPLIDIAYQGFGRGLEEDAEGLRAFAA--MHKELIVASSCSKNFSLYNERVGACTLVAADSETVDRAFGQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQV----LRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL...... 400
18 -78.1004wb0_A mol:protein length:414 Broad specificity aminotransferase  ali model follow..  20  6QAAMTTTERWQKIQGRAPDPIFELAKRAAAA-----KGPKANLVIGAYRDEQGLPYPLRVVRKAEQLLLDMNNYEYLPISGYQPFIDEAVKMTYGDTVELENLVAVQTLSGTGALSLGAKLLTAEKTPIYLADPTWPNHYSIVKAAGWKDIRTYAYYDHKTLGL-DFEGMKKDILAAPDGSVFLLHQCAHNPTGVDPSQEQWNEIASLMLA------KHHQVFFDSAYQGYASG-SLDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIRAEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRRTVYDELLRLQWEHVINQIGMFSFLGLSKEQ--CEYCQNHNIFIT---LSGRANIAGLTHETALMLAQTINDAVRNVNR. 413
19 -78.0001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  19  1........MLGNLKPQAPDKILALMGEFR----ADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELAANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETR----DFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEK------TGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPE--VLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSFGFVAEHRGMFSRLGATPEQ--VKRIKEE--FGIYMVGDSRINIAGLNDNTIPILARAIIEVG...... 393
20 -78.0004f5f_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  22  2.....AVGTFENITAAPADPILGLADLFR----ADERPGKVDLGVGVYKDETGKTPVLTSVKKAEQYLLENETKTYLGLDGLPEFGRCTQELLFGKGSADKRARTAQTPGGSGALRVGADFLNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENH--TLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLIDFAYQGFGRGLEEDAEGLRAFAA--MHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANFIIKQNGMFSFSGLTKEQV----LRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL...... 400
21 -77.8001yaa_A mol:protein length:412 ASPARTATE AMINOTRANSFERASE  ali model follow..  17  1.....SATLFNNIELLPPDALFGIKQRYGQ----DQRATKVDLGIGAYRDDNGKPWVLPSVKAAEKLIHNDSNHEYLGITGLPSLTSNAAKIIFGTQSDEDRVISVQSLSGTGALHISAKFFSKPDKLVYLSKPTWANHMAIFENQGLKTATYPYWANETK----DLNGFLNAIQKAPEGSIFVLHSCAHNPTGLDPTSEQWVQIVDAIAS------KNHIALFDTAYQGFATDLDKDAYAVRLGVEKSTVSPVFVCQSFAKNAGMYGERVGCFHLALTKQAQNKTVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWHKDMVTMSSRITKMRHALRDHLVKLGTPHIVNQCGMFSFTGLTPQMV----KRLEETHAVYLVASGRASIAGLNQGNVEYVAKAIDEVVRFYA.. 412
22 -77.7004rkc_A mol:protein length:398 Aromatic amino acid aminotransferase  ali model follow..  19  1........MFERIDYYAGDPILGLVEKFA----ADNNPDKVNLGIGIYYDESGVMPVLDCVKIAEQRIADPIPRPYLPMAGLPGHRKGCQELLFGKDAPDGLVATIATIGGSGALKVGAEFIWFPQSKCYVSDPTWGNHIAIFEGCDIEVGKYPYYDTATG--GIKFDEMIAFFETLNKDDVLLLHPCCHNPTGVDLTREQWDTVLNVIQE------RELIPFMDIAYQGFGEDMDSDAYAIRKAVD--MGLPLFVSNSFSKNLSLYGERVGGLSVVCPTVDETERVFGQLNSTVRRIYSSPPSHGGRVVDIVMNDAALHEQWVGEVYAMRDRIKSMRTKLKSVLEAKIFDYLTAQNGMFSFTGLTPEQV----ERLQSEFGIYMISNSRMCVAGLNSSNIDYVANAMVDVLKD.... 398
23 -77.5002d5y_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  21  1........MFENITTAPADPILGLADLFRA----DERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETKNYLGIDGIPEFGRCTQELLFGKGSADKRARTAQTPGGTGALRVAADFLNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENH--TLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLFDFAYQGFARGLEEDAEGLRAFAA--MHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFTIKQNGMFFFGGLTKEQV----LRLREEFGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL...... 396
24 -77.5004f5i_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  22  2.....AVGTFENITAAPADPILGLADLFR----ADERPGKVDLGVGVYKDETGKTPVMTSVKKAEQYLLENETKTYLGIDGIPEFGRCTQELLFGKGSADKRARTAQTPGGSGALRVAADFLNTSVKRVWVSNPTWPNHKAIFNSAGLEVREYAYYDAENH--TLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLIDIAYQGFGRGLEEDAEGLRAFAA--MHKELIVASSCSKNFSLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQ--VLRLREE--FGVYAVASGRINVAGMTPDNMAPLCEAIVAVL...... 400
25 -77.3004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  19  1............MAMGKPDPILGLGQDFR----MDPAKRKVNLSIGVYRDDADQPFVLECVKQAT----LGTNMDYAPVTGIASFVEEAQKLCFGPTCAAASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATK----NLAGMLECLDKAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKR------RNHIPFVDMAYQGFATGQDYDAFVPRHLVDMVPN--LIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLALLIRPMYSNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGWSHIERQVGMMAYTGLTREQ--VELLRSE--YHIYMTLNGRAAVSGLNSTNVEYVSQAIHNVTK..... 390
26 -77.3003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  20  2.......SWWTHVEMGPPDPILGVTEAFK----RDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAKNLDKEYLPIGGLAEFCKASAELALGENNEVVTVQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTC----DFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKK------KNLFAFFDMAYQGFASG-DGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGWQHITDQIGMFCFTGLKPEQ--VERLTKE--FSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK..... 401
27 -76.7003uak_A mol:protein length:406 De Novo designed cysteine esterase ECH14  ali model follow..  21  1........MFENITAAPADPIYGLADLFRA----DERPGKINLGLALYYDETGKIPVLTSVKKAEQYLLENETKLYLGIDGIPEFGRCTQELLFGKGSADKRARTAQTPGGHGALRVAADFLNTSVKRVWVYNPSSNCSKSVFNSAGLEVREYAYYDAENH--TLDFDALINSLNEAQAGDVVLFTGCCHNPTGIDPTLEQWQTLAQLSVE------KGWLPLFTFFYQGFARGLEEDAEGLRAFAA--MHKELIVASSYSKNFGLYNESVGACTLVAADSETVDRAFSQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFIIKQNGMFSFSGLTKEQ--VLRLREE--FGVYAVASGRVNVAGMTPDNMAPLCEAIVAVLGSLE.. 400
28 -76.6004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  19  2AMGTLEAQTQGPGSMGKPDPILGLGQDFR----MDPAKRKVNLSIGVYRDDADQPFVLECVKQAT----LGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATK----NLAGMLECLDKAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKR------RNHIPFVDMAYQGFATGQDYDAFVPRHLVDMVPN--LIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLALLIRPMYNNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGWSHIERQVGMMAYTGLTREQ--VELLRSE--YHIYMTLNGRAAVSGLNSTNVEYVSQAIHNVTK..... 403
29 -76.6004f5g_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  22  2.....AVGTFENITAAPADPILGLADLFR----ADERPGKVDLGVGVYKDETGKTPVLTSVKKAEQYLLENETKTYLGLDGLPEFGRCTQELLFGKGSADKRARTAQTPGGSGALRVAADFLNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENH--TLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVE------KGWLPLIDIAYQGFGRGLEEDAEGLRAFAA--MHKELIVASSCSKNFGLYNERVGACTLVAADSETVDRAFGQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGFSFVIKQNGMFSFSGLTKEQ--VLRLREE--FGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL...... 400
30 -76.5003wzf_A mol:protein length:412 Aspartate aminotransferase, cytoplasmic  ali model follow..  18  1....APPSVFAEVPQAQPVLVFKLTADFRE----DPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNNHEYLPILGLAEFRSCASRLALGDDSPEKRVGGVQSLGGTGALRIGADFLNNKNTPVYVSSPTWENHNAVFSAAGFKIRSYRYWDAEKR--GLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKH------RFLFPFFDSAYQGFASG-NLERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKWNHITDQIGMFSFTGLNPKQ--VEYLVNE--KHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ.. 412
31 -75.9005ton_A mol:protein length:414 Aspartate aminotransferase, cytoplasmic  ali model follow..  17  2...MAPPSVFAEVPQAQPVLVFKLIADFRE----DPDPRKVNLGVGAYRTDDCQPWVLPVVRKVEQRIANNSNHEYLPILGLAEFRTCASRLALGDDSPEKRVGGVQSLGGTGALRIGAEFLNNKDTPVYVSSPTWENLNGVFTTAGFDIRSYRYWDTEKR--GLDLQGFLSDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKR------RFLFPFFDSAYQGFASG-NLEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELRARLEALKWNHITDQIGMFSFTGLNPKQ--VEYLINQ--KHIYLLPSGRINMCGLTTKNLDYVATSIHEAVTKIQ.. 414
32 -75.5001aat_A mol:protein length:411 CYTOSOLIC ASPARTATE AMINOTRANSFERASE  ali model follow..  18  1.....AASIFAAVPRAPPVAVFKLTADFR----EDGDSRKVNLGVGAYRTDEGQPWVLPVVRKVEQLIAGNGSHEYLPILGLPEFRANASRIALGDDSPQKRVGSVQGLGGTGALRIGAEFLNNTATPVYVSSPTWENHNSVFMDAGFKDIRTYRY--DAAKRGLDLQGLLSDMEKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKR------RCLFPFFDSAYQGFA-SGNLEKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELRSRLESLGWNHITDQIGMFSFTGLNPKQ--VEYMIKE--KHIYLMASGRINMCGLTTKNLDYVAKSIHEAVTKIQ.. 411
33 -75.3003meb_A mol:protein length:448 Aspartate aminotransferase  ali model follow..  21  10TQGPGSMSVFSGFPASPPDAILNLTVLYNA----DTNPKKVNLGVGAYRDESGKPWILPAVKEAEAIISSDLNKEYPPVAGFPLFLEAAQFLMFGKDSKEGRIASCQSLSGTGSLHIGFEFLWMPKAEFYMPSTTWPNHYGIYDKVFNKLKVPYTYLRKDGELEIDFSNTKKDIQSAPEKSIFLFHACAHNPSGIDFTEAQWKELLPIMKE------KKHIAFFDSAYQGFAGSFEADAFAVRMFVD--AGVEVLVAQSFSKNFGLYGERIGCLHVVHAGVEGSVEKVSGMTLQIRKTWSMSAIHGAYIVQVIVHDKRLLQMFYDNVKEMSARIHRMRSLLHASLAKRKWDHILTAIGMFTFTGLTPEH-VDYLKEKWSIYLVK--AGGRMSMCGLTESNCDYVAEAIHDAVTKLPF. 440
34 -74.6005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  21  2.......SWWTHVEMGPPDPILGVTEAFK----RDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAKNLDKEYLPIGGLAEFCKASAELALGENSESGRFVTVQTISGTGALRIGASFLFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTC----DFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKK------RNLFAFFDMAYQGFASGDDKDAWAVRHFIEQGIN--VCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGWQHITDQIGMFCFTGLKPEQ--VERLIKE--FSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK..... 401
35 -74.3003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  19  1...............MQPVLVFKLTADFR----EDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANSLNHEYLPILGLAEFRSCASRLALGDDSPEKRVGGVQSLGGTGALRIGADFLNNKNTPVYVSSPTWENHNAVFSAAGFKIRSYRYWDAEKR--GLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKH------RFLFPFFDSAYQGFASGNERDAWAIRYFVSEGFE--FFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKWNHITDQIGMFSFTGLNPKQ--VEYLVNE--KHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIAE. 402
36 -74.2003k7y_A mol:protein length:405 Aspartate aminotransferase  ali model follow..  21  1...MDKL--LSSLENIEVDNILKTAREFKE----DTCEEKINLSIGVCCNDDGDLHIFDSVLNADKLVTENYEKPYLLGNGTEDFSTLTQNLIFGNNSKDKKICTIQCIGGTGAIFVLLEFLKMLNVELYVTNPPYINHVNMIESRGFNLKYINFFDYNLI--DINYDLFLNDLRNIPNGSSVILQISCYNPCSVNIEEKYFDEIIEIVLH------KKHVIIFDIAYQGFGHT-NLEEDVLLIRKFEEKNIAFSVCQSFSKNMSLYGERAGALHIVCKNQEEKKIVFNNLCFIVRKFYSSPVIHTNRILCQLLNNQNLKLNWIKELSQLSQRITNNRILFFNKLETYQWNVYKKQRGLFSFVPLLAKI--AEHLKTHHIYII---NNGRINVSGITKNNVDYIADKICLSLSQI... 405
37 -74.1001aka_A mol:protein length:401 ASPARTATE AMINOTRANSFERASE  ali model follow..  20  2.......SWWSHVEMGPPDPILGVTEAFKR----DTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKDKEYLPIAGLADFTRASAELALGENSESGRYVTVQGISGTGSLRVGANFLFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTC--SLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKK------RNLLAYFDMAYQGFASG-DINRDAWALRHFIEQGIDVVLSQSYAHNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGWQHITDQIGMFCFTGLKPEQ--VERLTKE--FSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK..... 401
38 -65.6004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  16  3......MDLSKRFNKNLNK--IEVSMIRQFDQSISDIPDVLKLTLG-----EPDFATPKHIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKEKYHLNPDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTRSNDFVLTPEMLEEAILK--EGEALKAVILNYP-TNPTGVTYSRQQIKNLAEVLKK------YPIFVISDEVYAELTYTGESHVSIAEYLPD-----QTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQY-------LVTAATTSVQFAAIEALTNG------KDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPDSFKFLQDFAKEKAVAFIPGVAFGKYGEGYLRISYAASMETIKEAMKRLKEF 387
39 -64.3001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  17  1......MALSDRLELVSASEIRKLFDIAAG------MKDVISLGIG-----EPDFDTPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKKQNGIDPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPT-EDEFRLNVDELKKYV-----TDKTRALIINSP-CNPTGAVLTKKDLEEIADFVVE------HDLIVISDEVYEHFIYDDARHYSIASL---DGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMY-------NATCPVTFIQYAAAKALKDER-----WKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAYEKLEEAMDRMERV 382
40 -62.4003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  15  36.....DVQRNENFGKLRAGYLFPIARRRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLATREGYSGYGAEQGQGALREAVASTFYGHAGRAAD-EIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTFDGIEYMVCNPDNHFFPDLSKAKRTDIIFFCSP-NNPTGAAATRAQLTELVNFARK------NGSILVYDAAYALYISNPDCPKTIYEI---PGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYANGEVHADWNRVMTTCFNGASNIVQAGGLACLQPEG-----LKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPPSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFGSRENILEAVRRFKEA 436
41 -62.0003ele_A mol:protein length:398 Amino Transferase  ali model follow..  17  1.....GMVVNESMYQLVRSAIRELFEYGKKRAAIVGKENVYDFSIG-----NPSIPAPQIVNDTIKELVTDALHGYTSAQGDVETRAAIAEFLNNTHGTHNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADTEHFQIDFDALEERI-----NAHTRGVIINSP-NNPSGTVYSEETIKKLSDLLEKKSKEIGRPIFIIADEPYREIVYDGIKVPFVTKYYDN------TLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGAGRALGYVCAPSLFQKMIVKCQGATG-----------DINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVKALDSNAFCEKAKEEDVLIVA---ADGFGCPGWVRISYCVDREMIKHSMPAFEKI 392
42 -61.9002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  16  9.VPRGSHMISNKLANIPDSYFGKTM----GRKIEHGPLPLINMAVG-----IPDGPTPQGIIDHFQKALTIPENKYGAFHGKEAFKQAIVDFYQRQYNVDKEDEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEPPHYLPDWSKVDSQI-----IDKTKLIYLTYP-NNPTGSTATKEVFDEAIAKFKG------TDTKIVHDFAYGAFGFDAKN----PSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTN-------AGMFGALQDAAIYALNHY------DDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPDSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLALDDQKLDEAAIRLTEL 393
43 -61.8003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  10  5.....EAKFKKLGTDNAPGQEVRQSAAGLEALIRPIEGRPVDFSHG---DVDAHEPTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGADARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQL-ETRAGLDLTGLEEAF-----KAGARVFLFSNP-NNPAGVVYSAEEIGQIAALAAR------YGATVIADQLYSRLRYAGASYTHLRAEAAVDAEN--VVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAI-------VSLRAAGYSQAVLRGWFDEA------PGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFPRLPAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTL 401
44 -61.6001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  18  4........LSRRVQAMKPSATVAVNAKALE--LRRQGVDLVALTAG-----EPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVET-EEGFVPDPERVRRAI-----TPRTKALVVNSP-NNPTGAVYPKEVLEALARLAVE------HDFYLVSDEIYEHLLYE-GEHFSPGRVAPE-----HTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQ-------STTSPDTIAQWATLEALTNQE---ASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSDEVRAAERLLEAGVAVVP---GTDFAAFGHVRLSYATSEENLRKALERFARV 381
45 -60.9001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  15  2..TNNPLIPQSKLPQLGTTIFTQMSALAQ-------QHQAINLSQG-----FPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYDADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQEFAALL-----SERTRLVILNTP-HNPSATVWQQADFAALWQAIAG------HEIFVISDEVYEHINFSQQGHASVLAH---PQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQY-------LTFSVNTPAQLALADMLRAE------PEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSDDVEFCQWLTQEHGVAAIPLSVFCAD-HKLIRLCFAKKESTLLAAAERLRQL 386
46 -60.1001xi9_A mol:protein length:406 putative transaminase  ali model follow..  17  2....GSIRASKRALSV-EYAIRDVVLPARE--LEKKGIKVIRLNIGDPVK---DFQPPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKRKNGVDTPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRT-EEDWQPDIDDIRKKI-----TDRTKAIAVINP-NNPTGALYDKKTLEEILNIAGE------YEIPVISDEIYDLMTYEGEHIS-----PGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPENKL--SEVREAIDRLARIRLCPNTPAQFAAIAGLTGP------MDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIFPKIENDKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPPIEILEEAMDRFEKF 393
47 -60.0002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  14  18IEYKTKVSRNSNMSKLQAGYLFPIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDD-DVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGYMRCTPENGFFPDLSTVGRTDIIFFCSP-NNPTGAAATREQLTQLVEFAKK------NGSIIVYDSAYAMYMSDDNP----RSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLYSDGPVAKDFNRIICTCFNGASNISQAGALACLTPEG-----LEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHRENILEACRRFKQL 424
48 -59.9002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  16  1.......MLSKRLLNFESFEVMDILALAQK--LESEGKKVIHLEIG-----EPDFNTPKPIVDEGIKSLKEGKTHYTDSRGILELREKISELYKDKYKADIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF-------TVESLEEAL-----SDKTKAIIINSP-SNPLGEVIDRE----IYEFAYE------NIPYIISDEIYNGLVYEGKC----YSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQN-------LFISAPTISQYAALKAFEKET-----EREINSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNIGDGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYANSYENIKEGLERIKEF 367
49 -59.8001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  17  2..GSDKIMVSRRISEIPISKTMELDAKAKA--LIKKGEDVINLTAG-----EPDFPTPEPVVEEAVRFLQKGEVKYTDPRGIYELREGIAKRIGERYKKDSPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVET-SKNFQPSLEEVEGLL-----VGKTKAVLINSP-NNPTGVVYRREFLEGLVRLAKK------RNFYIISDEVYDSLVYTDEF----TSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSH-------TTSCINTVAQYAALKALEVDN---------SYMVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRDDVKFCERLLEEKKVALVPGSAF--LKPGFVRLSFATSIERLTEALDRIEDF 379
50 -59.3001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  14  7ETMHNKFDLPKRYQGSTKSVWVEYIQLAA-------QYKPLNLGQG-----FPDYHAPKYALNALAAAANSPDNQYTRGFGHPRLVQALSKLYSQLVDRNPMTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNDWVLDNNELEALF-----NEKTKMIIINTP-HNPLGKVMDRAELEVVANLCKK------WNVLCVSDEVYEHMVFEPFEHIRICTL---PGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQN-------CVYTCATPIQEAIAVGFETEKRLKSPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSKDYRFTKWMTKSVGLQGIPPSAFKHLGEDFVRYCFFKKDENLQKAAEILRKW 425
51 -58.8005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  14  1.......ANAKRIEGLDSNVWVEFTKLAA-------DPSVVNLGQG-----FPDISPPSYVKEELSKAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKDWTFDPRELESKF-----SSKTKAIILNTP-HNPLGKVYTRQELQVIADLCVK------HDTLCISDEVYEWLVYTGHTHVKIATL---PGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQN-------SFYTCATPLQAALAEAFWIDKRMDDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSYDYKFVKWMTKHKKLTAIPVSAFKPHFEKLVRFCFIKKDSTLDAAEEIFRAW 410
52 -58.6004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  12  18EGAMSPIEKSSKLENVCYDIRGPVLKEAKR--LEEEGNKVLKLNIGNPAP---GFDAPDEILVDVIRNLPTA-QGYCDSKGLYSARKAIMQHYQARGMRDTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLC-SSDWFPDLDDIRAKIT-----PRTRGIVIINP-NNPTGAVYSKELLMEIVEIARQ------HNLIIFADEIYDKILYDDAEHHS----IAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIE--GLEMLASMRLCANVPAQHAIQTALGGYQSI----SEFITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFPKIDDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARF 418
53 -58.3004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  13  1...MAKQLQARRLDGIDYNPWVEFVKLAS-------EHDVVNLGQG-----FPDFPPPDFAVEAFQHAVSGDFNQYTKTFGYPPLTKILASFFGELLGQDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSL-SSNWQLDPMELAGKF-----TSRTKALVLNTP-NNPLGKVFSREELELVASLCQQ------HDVVCITDEVYQWMVYDGHQHISIASL---PGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQN-------SVFHCPTQSQAAVAESFERELLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISYDRRFVKWMIKNKGLVAIPVSIFQKHFDHYIRFCFVKDEATLQAMDEKLRKW 418
54 -58.1002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  14  2GSDKIMDVFSDRVLLTEESPIRKLVPFAEM--AKKRGVRIHHLNIG-----QPDLKTPEVFFERIYEN-KPEVVYYSHSAGIWELREAFASYYKRRQRVDKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIPQNLESFI-----NERTKGIVLSNP-CNPTGVVYGKDEMRYLVEIAER------HGLFLIVDEVYSEIVFRGEFASAL--------ESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQ-------GRLAPPLLEQIGSVGLLNLD------DSFFDFVRETYRERVETVLKKLEEHLKRFTKPSGAFYITAELPDAEEFARWMLTDETTMVAPLRGFYLT-KKEIRIACVLEKDLLSRAIDVLMEG 392
55 -58.1003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  14  3.......LKNSSRSAVDPFIVMDVMEAARR--AEEAGRRIIHMEVG-----QPGTGAPRGAVEALAKSLETDALGYTVALGLPALRQRIARLYGEWYGVDDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPEN------RLQPVPADFA-GLDLAGLMVASP-ANPTGTMLDHAAMGALIEAAQA------QGASFISDEIYHGIEYEAKA-------VTALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQN-------MFICAPHASQVAALAALDCD-------AELQANLDVYKANRKLMLERLPKAGTRIAPPDGAFYVYADVSDSRAFAAEILEKAGVAVTPGLDFDPE-AGTLRFSYARATADIEEGLDRLEAF 378
56 -57.9003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  17  22KVVANKYFTSNTAKDVWSLTNEAAAKAANN--SKNQGRELINLGQG-----FFSYSPPQFAIKEAQKALDPMVNQYSPTRGRPSLINSLIKLYSPIYNTEKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPI-GEEWTIDFEQFEKAI-----TSKTKAVIINTP-HNPIGKVFTREELTTLGNICVK------HNVVIISDEVYEHLYFTDSFTRIATLS---PEIGQLTLTVGSAGKSFAATGWRIGWVLSLNA------ELLSYAAKAHTRICFASPSPLQEACANSINDALKIGYFEK----MRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSKDFRISHWLINELGVVAIPPTEFYIK-ENLLRFAVCKDDAYLENAVERLKLL 443
57 -57.8001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  18  1......MKLAARVESVSPSMTLIIDAKAKA--MKAEGIDVCSFSAG-----EPDFNTPKHIVEAAKAALEQGKTRYGPAAGEPRLREAIAQKLQRDNGLCGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPT-ETQFKVSPEQIRQAI-----TPKTKLLVFNTP-SNPTGMVYTPDEVRAIAQVAVE------AGLWVLSDEIYEKILYDDAQHLSIGAASPEAYER--SVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGH-------STSNVCTFAQYGAIAAYENS------QDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFPSIASSLDFCSELLDQHQVATVPGAAF--GADDCIRLSYATDLDTIKRGMERLEKF 383
58 -57.6001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  15  1...MSSWVSMSNHAGLVFNPIRTVSDNAK---PSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQECNGYFPTVGSPEAREAVATWWRNSFVHKVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNC-ENDWEADLDEIRRLKD-----DKTKLLIVTNP-SNPCGSNFSRKHVEDIVRLAEE------LRLPLFSDEIYAGMVFKGKDPNATFTSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYV-DPHGNGPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTP------QEHLDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMSRIDTDVEFFEKLLEEENVQVLPGTIF--HAPGFTRLTTTRPVEVYREAVERIKAF 409
59 -57.3002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  16  1......MATVSRLRPYATTVFAEMSALAT-------RIGAVNLGQG-----FPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPL-GRGFALDADALRRAV-----TPRTRALIINSP-HNPTGAVLSATELAAIAEIAVA------ANLVVITDEVYEHLVFDHARHLPLAGF---DGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQY-------LSYVGGAPFQPAVALALDTE------DAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRDSTEFCAALPEKVGVAAIPMSAFCDPAAGLVRFTFCKRDDTLDEAIRRLSVL 392
60 -57.2001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  18  1......MRLHPRTEAAKESIFPRMSGLAQ-------RLGAVNLGQG-----FPSNPPPPFLLEAVRRAL-GRQDQYAPPAGLPALREALAEEFAVE-----PESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRL-PEGFRLDLSALEKAL-----TPRTRALLLNTP-MNPTGLVFGERELEAIARLARA------HDLFLISDEVYDELYYGERPRRLR------EFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQW-------TSFSAPTPLQAGVAEALKLAR-----EGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPG--WDAFRLVEEARVALIPASAFYLE-KDLFRFAFCKTEEELHLALERLGRV 367
61 -56.9006DK6 Entity 1(prereleased)  ali follow..  11  2.ALINENFLKLKAGYLFPEIARRVKAFTEG--NPEAAQRLIRCGIG-----DVTEALPEAVRYAMHEAVDETFKGYGPEQGYDFLRNAIADNDYKARGLPEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADEN-YAGLVYLKCTPENGFVPDIPQEKADLIYLCYP-NNPTGAVATRPQLEAWVKYARE------NGSVLLYDAAYEAFIQDPTIPHSIFEI---EGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQALHPLWSRRHSTKFNGASYIVQKGAEALYTDEGKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFNSRANVEEVCRRIAAL 410
62 -56.8005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  16  4........RVALRAGVPPFYVMDVWL--AAAERQRTHGDLVNLSAG-----QPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPC-QTRFQPTAQMLAEI------DPPLRGVVVASP-ANPTGTVIPPEELAAIASWCDA------SDVRLISDEVYHGLVYQGAPQTSCAWQTSR-----NAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGN-------FTICPPVLSQIAAVSAFTPEA-----TAEADGNLASYAINRSLLLDGLRRIGDRLAPTDGAFYVYADVSDSLAFCSKLLADTGVAIAPGIDFDTA-GSFVRISFAGPSGDIEEALRRIGSW 384
63 -56.7002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  13  3.AESRPARRFARIDRLPPYVFNITAELKMA--ARRRGEDIIDLSMG-----NPDGPTPPHIVEKLCTVAQREDTGYSTSRGIPRLRRAISHWYRDRYDVDPESEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPL-GIDFFNELERAIRES-----IPKPRMMILGFP-SNPTAQCVELDFFERVVALAKQ------YDVMVVHDLAYADIVYDGWKAPSIMQV---PGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHD-------YGTFTPLQVAAIAALEGD------QQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVWAKIPGSLEFAKKLLQDAKVSVSPGIGFGDYGDDHVRFALIENRDRLRQAVRGIKAM 394
64 -56.6004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  13  32LGGSTKLVRNVNLEKLKNNYLFPINRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAHGLSTVEGYRGYGLEQGNKTLRKAIAETFYRDLHVKSN-EVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQYMPCGPNNSFFPDLAMTPRTDVIFFCSP-NNPTGYVASRKQLHQLVDFAKT------NGSIIIFDSAYAAFIEDGSP----RSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELYSNGFPIINDFHRIVTTSFNGASNIAQAGGLACLSSGG-----LKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKKSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFGRRDHIVEASKRLQNF 438
65 -56.1005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  13  64LSSSVDMSLSPRVQSLKPSKTMVITDLAAT--LVQSGVPVIRLAAG-----EPDFDTPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKEENGLSAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPT-SNNFLLDPKDLESKL-----TEKSRLLILCSP-SNPTGSVYPKSLLEEIARIIAK-----HPRLLVLSDEIYEHIIYAPATHTSFASL---PDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQ-------VSSGASSIAQKAGVAALGLGK-----GETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFIDFSDSSSLALYFLDKFQVAMVPGDAF--GDDSCIRISYATSLDVLQAAVEKIRKA 465
66 -56.0002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  17  16............................AKRKARERGVGLIDLSIG-----STDLPPPEAPLKALAEALNDPTTGYCLKSCTLPFLEEAARWYEGRYGVDPRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL-REDGLADLKAVPEGV-----WREAKVLLLNYP-NNPTGAVADWGYFEEALGLARK------HGLWLIHDNPYVDQVYEGEA----PSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVID-------FNQYAGVLRMGVEALKTP------KEVVRGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPDDLEFGLRLVERGV-ALAPGRGFGPGGKGFVRIALVRPLEELLEAAKRIREA 374
67 -55.8003jtx_A mol:protein length:396 aminotransferase  ali model follow..  12  1.......GMNTLLKQLKPYPFARLHEAMQG-ISAPEGMEAVPLHIG-----EPKHPTPKVITDALTASLHEL-EKYPLTAGLPELRQACANWLKRRYDVDADNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSISEEV-----WKRTKLVFVCSP-NNPSGSVLDLDGWKEVFDLQDK------YGFIIASDECYSEIYFDGNKPLGCLQAAAQLGSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHG-------SAMSIPVQRASIAAWDDE-------QHVIDNRRLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVPDDLAFARNLWQKAAIQVLPGRFLARD-EGYVRIALVADVATCVKAAEDIVSL 394
68 -55.4003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  15  1......MKRNPHFVSLTKNYLFALQKRVAQFRLENPQHTVINLSIG-----DTTQPLNASVAEAFASSIARTCRGYGPDFGLPALRQKLSEDFYRGFVDAK--EIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQENAF--------FPEFPEDTHIDILCLCSP-NNPTGTVLNKDQLRAIVHYAIE------HEILILFDAAYSTFISDPSLPKSIFEI---PDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYADGHVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQLE--------AIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTSDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMA 389
69 -54.6003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  15  8EKLIREKQNELHIKDLGMASIRDLVALVT-NLEKATGTKFCRMEMG-----VPGLPAPQIGIETEIQKLREGVASYPNLDGLPELKQEASRFAKLFVNIDPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRG----EKLREKLESYLQTGQFCSIIYSNP-NNPTWQCMTDEELRIIGELATK------HDVIVIEDLAYFGMDFRKDYSHEPLYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLEESSSALYALSSGATHSAQWGMAAMLKACN---DGEYNFRDSVIEYGRKARIMKKMFLDNGFNIVYPLADGFYFTVGYDSSKLIEKFVRYGMCAITLKTTGSKRNEAMRICTSLLPESQFPDLEKRLQML 433
70 -54.3003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  13  7.....................YPFERLRALLKEITPKKRGLDLGIG-----EPQFETPKFIQDALKNHT-HSLNIYPKSAFEESLRAAQRGFFKRRFKIEKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKEN------DFTPSLNEKE-LQEVDLVILNSP-NNPTGRTLSLEELISWVKLALK------HDFILINDECYSEIYENTPPPSLLACMLAGNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLG-------YTSANAIQKASEAAWLDD-------RHAEFFRNIYANNLKLARKIFKNT----LIYPYSFYVYLPVQNGENFAKTLYQNEGIITLPALYLGRNRIGYVRLALVYDTPLLEKPLEIIETY 371
71 -54.3003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  16  20.......VRPSDMAKKTFNPIRAIVDNMKV--KPNPNKTMISLSIG---TVFGNLPTDPEVTQAMKDALDSGKNGYAPSIGFLSSREEIASYYHCPEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNL-EKSWEIDLKQLEYLID-----EKTACLIVNNP-SNPCGSVFSKRHLQKILAVAAR------QCVPILADEIYGDMVFSDCKYEP----LATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQ-RILGPCTIVQGALKSILCRTP-----GEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMVGIENDVEFTERLVAEQSVHCLPATCF--EYPNFIRVVITVPEVMMLEACSRIQEF 414
72 -53.7003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  16  3.......VRPSDMSNKTFNPIRAIVDNMKV--KPNPNKTVISLSIGD--TVFGNLPTDPEVTQAMKDALDSGYNGYAPSIGYLSSREEVASYYHCPEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNL-EKSWEIDLKQLESLID-----EKTACLVVNNP-SNPCGSVFSKRHLQKILAVAER------QCVPILADEIYGDMVFSDCKYEP----MATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQ-RILGPCTIVQGALKSILQRTP-----QEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMVGIENDVEFTERLIAEQSVHCLPATCF--EYPNFFRVVITVPEVMMLEACSRIQEF 397
73 -53.3003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  14  49..QRGIKKPFTEVIRANIGDAQAMGQ--QPITFLRQVMALCTYPNLL--SPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEENCALNVNELRRAVQEAKDHCDPKVLCIINP-GNPTGQVQSRKCIEDVIHFAWE------EKLFLLADEVYQDNVYSPDCRFHSFKKVPEYSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLL------SVRLCPPVSGQAAMDIVVNPESFEQFSREKESVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFPRIFPDMFYCMKLLEETGICVVPGSGFG-EGTYHFRMTILPPVEKLKTVLQKVKDF 483
74 -53.0004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  13  24DKDRWTSFRRIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIG---TVDGNLKTPDIVTEAMVDVVRSGKNGYPPTVGADNLRQVVSTYWRRFCQTKKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYL-SKSWECDLRAAAGMVD-----SHTKAFVIINP-SNPCGSNFSRAHVSDIIDFCQQ------HQIPLISDEIYAEMVLNNGIFTS----VADFDTNVPRLILGGTAKYQVCPGWRVGWSILIDPMNVAGDWAVGMER--LTQLIAGVNSICQEAIARTLLKCP-----TECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMLKLNSDMEFYEKLLDEENVQVLPGEIF--GMSGFLRATVSRPSAVLNEAVDRIIEF 432
75 -52.9001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  15  3.......MLSRNATFNSHGQDSSYFLGWQEYEKNHNTNGIIQMGLAELLESWLAKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMRGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWTGVEIVPIHC-SNGFQITETALEEAYQEAEKRNLRKGVLVTNP-SNPLGTTMTRNELYLLLSFVED------KGIHLISDEIYSGTAFSSPSFISVMEVLENSEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSS--------FGLVSSQTQHLLSAMLSDKKLTKNY---IAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERLDLAMQRLKAF 428

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.