current user: public

If you have questions about the server, please let us know.

Query: 3t6g_B mol:protein length:229 Breast cancer anti-estrogen resistance protein 1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAALELast
1 -80.2003t6g_B mol:protein length:229 Breast cancer anti-estrogen resistance protein 1  ali model  100  1MSQDSPDGQYENSEGGWMEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLANWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPSAAQDMVERVKELGHSTQQFRRVLGQLAAALE 229
2 -53.4005w93_A mol:protein length:137 Breast cancer anti-estrogen resistance protein 1  ali model follow..  97  1..........................................................................................GGLGPSDRQLLLFYLEQAEANLTTLTDAVDAFFTAVATNQPPKIFVAHSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLSDLLRGIVATTKAAALQYPSPSAAQDMVDRVKELGHSTQQFRRVLGQLAAA.. 137
3 -15.9003s9o_A mol:protein length:164 Focal adhesion kinase 1  ali model follow..  19  33........................................................................................................NDKVYENVTGLVKAVIEMSSKIQ-PAPPEEYVPMVKEVGLALRTLLATVDETIPLLPA-STHREIEMAQKLLNSDLGELINKMKLAQQYVMTSEYKKQMLTAAHALAVDAKNLLDVIDQA..... 153
4 -15.4002lqg_A mol:protein length:138 Talin-1  ali model follow..  18  9..................................................................................................QRLEHAAKQAAASATQTIAAAQHAASAPKASA--PLLVQSCKAVAEQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEA.. 138
5 -15.4003gm1_A mol:protein length:153 Protein tyrosine kinase 2 beta  ali model follow..  18  7..........................................................................................GAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELA-QLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPS-SSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSECKRQMLTASHTLAVDAKNLLDAVDQA..... 141
6 -15.4002l6h_A mol:protein length:180 Focal adhesion kinase 1, linker, Paxillin  ali model follow..  18  8........................................................................................................NDKVYENVTGLVKAVIEMSSKIQPAPPEE-YVPMVKEVGLALRTLLATVDESLPVLPA-STHREIEMAQKLLNSDLAELINKMKLAQQYVMTSEYKKQMLTAAHALAVDAKNLLDVIDQA..... 128
7 -15.3005f28_E mol:protein length:149 Focal adhesion kinase 1  ali model follow..  19  18........................................................................................................NDKVYENVTGLVKAVIEMSSKIQ-PAPPEEYVPMVKEVGLALRTLLATVDETIPALPA-STHREIEMAQKLLNSDLGELISKMKLAQQYVMTSEYKKQMLTAAHALAVDAKNLLDVIDQA..... 138
8 -15.3002b0h_A mol:protein length:137 Talin-1  ali model follow..  10  8..............................................................................................GDPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTS--PEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGN.... 136
9 -15.3002l10_A mol:protein length:158 Talin-1  ali model follow..  15  39.......................................................................................................AQSRLNEAAAGLNQAATELVQASRGTP--QDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPASPNLKSQLAAAARAVTDSINQLITMCTQQA.... 158
10 -15.2001pv3_A mol:protein length:146 Focal adhesion kinase 1  ali model follow..  19  15........................................................................................................NDKVYENVTGLVKAVIEMSSKIQ-PAPPEEYVPMVKEVGLALRTLLATVDESLPVLPA-STHREIEMAQKLLNSDLAELINKMKLAQQYVMTSEYKKQMLTAAHALAVDAKNLLDVIDQA..... 135
11 -15.1004xev_A mol:protein length:167 Fusion protein of Protein-tyrosine kinase 2-beta FAT domain and Leupaxin LD1 motif  ali model follow..  19  11........................................................................................................DDLVYLNVMELVRAVLELKNELS-QLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPS-SSRTEIEGTQKLLNKDLAELINKMRLAQQNAVTSEAKRQMLTASHTLAVDAKNLLDAVDQA..... 131
12 -14.9002kvp_A mol:protein length:165 Talin-1  ali model follow..  10  45.......................................................................................................YQTTMVRTAKAIAVTVQEMVTKSNTS--PEELGPLANQLTSDYGRLASQAKPAAVAAENEEIGAHIKHRVQELGHGCSALVTKAGALQCSPSDVYTKKELIECARRVSEKVSHVLAALQAGN.... 164
13 -14.6001sj8_A mol:protein length:308 Talin 1  ali model follow..  11  180.............................................................................................DPHFQDVLMQLANAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATE---DGQLLRGVGAAATAVTQALNELLQHVKAHA.... 308
14 -14.5002l7n_A mol:protein length:168 Talin-1  ali model follow..  12  34.........................................................................................DGKLKPLPGETMEKCTQDLGNSTKAVSSAIAKLLGEIAQGNE-NYAGIAARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKASGHPGDPESQQRLAQVAKAVTQALNRCVSCL........ 164
15 -14.4002l7a_A mol:protein length:131 Talin-1  ali model follow..  12  21.................................................................................................................ATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIK...... 130
16 -13.6002kbb_A mol:protein length:174 Talin-1  ali model follow..  34.......................................................................................AVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLASAARAEA--SQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGN--AAHTQEALEEAVQMMTEAVEDLTTTLNEAAS... 171
17 -12.3001u89_A mol:protein length:139 Talin 1  ali model follow..  13  14........................................................................................................LRGVGAAATAVTQALNELLQHVKAHAT----AGPAGRYDQATDTILTVTENI---FSSMGDAGEMVRQARILAQATSDLVNAIKADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPD 132
18 -12.0003fyq_A mol:protein length:199 CG6831-PA (Talin)  ali model follow..  10  31.........................................................................................AGTLHSDGDGSFADHREHILQTAKALVEDTKVLVTGAAGT--QDQLANAAQNAVSTITQLAEAVKRGACSLGSTQSQVMVINAVKDVASALGDLINCTKLASGKSINDPSMQDLKESARVMVLNVSSLLKTVKAVED... 167
19 -11.8005l0f_A mol:protein length:176 Vinculin  ali model follow..  26........................................................................................................GNDIIAAAKRMALLMAEMSRLVRGGSGKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVQEAE 152
20 -11.8001r0d_A mol:protein length:206 Huntingtin Interacting Protein 12  ali model follow..  15  65..................................................................................................................LMKAIRLLVTTSTSLQKEEGLISASKAVGWGATQLVEAADKV---VLHTGKYEELIVCSHEIAASTAQLVAASKVKA---KHSPHLSRLQECSRTVNERAANVVASTKSGQEQIE 196
21 -11.5003jbi_V mol:protein length:254 Vinculin  ali model follow..  109........................................................................................................GNDIIAAAKRMALLMAEMSRLVRGGSGNK-LIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAE 235
22 -11.5002l6f_A mol:protein length:215 Focal adhesion kinase 1, linker1, Paxillin, linker2, Paxillin  ali model follow..  19  8........................................................................................................NDKVYENVTGLVKAVIEMSSKIQ-PAPPEEYVPMVKEVGLALRTLLATVDESLPVLPA-STHREIEMAQKLLNSDLAELINKMKLAQQYVMTSLQ-KQMLTAAHALAVDAKNLLDVIDQA..... 128
23 -11.4002jsw_A mol:protein length:189 Talin-1  ali model follow..  10  48.......................................................................................................FEEQILEAAKSIAAATSALVKAASAAQREQGLISAARMVAAATNNLCEAANAA---VQGHASQEKLISSAKQVAASTAQLLVACKVKA---QDSEAMKRLQAAGNAVKRASDNLVKAAQKAAAFED 189
24 -11.3002jx0_A mol:protein length:135 ARF GTPase-activating protein GIT1  ali model follow..  11  15.......................................................................................................STEDVILKTEQVTKNIQELLRAAQEFKHDS-FVPCSEKIHLAVTEMASLFPKRPALEPVRSSLRLLNASAYRLQSECRKTVPPEPGAPVD--FQLLTQQVIQCAYDIAKAAKQLVTITTR...... 131
25 -11.3005ic0_A mol:protein length:469 Talin-1  ali model follow..  346........................................................................................................HTQMLTAVQEISHLIEPLASAARAEA--SQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGN-QAAHTQEALEEAVQMMTEAVEDLTTTLNEAAS... 466
26 -11.2002x0c_A mol:protein length:309 TALIN-1  ali model follow..  172........................................................................................................KRQFVQSAKEVANSTANLVKTIKALDGDAQCRAATAPLLEAVDNLSFSSVPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRDKAP... 306
27 -11.2004igg_A mol:protein length:832 Catenin alpha-1  ali model follow..  628........................................................................................................GNDIIVLAKQMCMIMMEMTDFTRGKKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASY 756
28 -11.1005l0g_A mol:protein length:176 Vinculin  ali model follow..  26........................................................................................................GNDIIAAAKRMALLMAEMSRLVRGGSGKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAE 152
29 -10.9005l0j_A mol:protein length:176 Vinculin  ali model follow..  26........................................................................................................GNDIIAAAKRMALLMAEMSRLVRGGSGTK-LIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAE 152
30 -10.8006bfi_A mol:protein length:846 VIN1  ali model follow..  3....................................................................................................VKFHTKTLESVIDPVAQQVGQLVEQAESGLLKEDLTPLVQGVGIAVTNLVQVAASMVETSNDEDFKAELPPSMQEVQQAAVFLSDAARLLKADQGSPEGKRKLLDGARGVINGMSDLLMCADRS..... 129
31 -10.5004f7g_B mol:protein length:216 Talin-1  ali model follow..  62........................................................................................................HTQMLTAVQEISHLIEPLASAARAE--ASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTEALEEAVQMMTEAVEDLTTTLNEAASAAG 185
32 -10.4004k1n_A mol:protein length:912 Catenin alpha-1  ali model follow..  715........................................................................................................GNDIIVLAKQMCMIMMEMTDFTRGKKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASY 843
33 -10.4004k1o_A mol:protein length:264 Catenin alpha-2  ali model follow..  77...............................................................................................................MCMIMMEMTDFTRGKGPLKNTSDVINAAKKIAEAGSRMDKLARAVADQCPDSACKQDLLAYLQRIALYCHQLICSKVKAEVQNLGGELIVSGLDSATSLIQAAKNLMNAVVLTVKASY 195
34 -10.0003vf0_A mol:protein length:283 Vinculin  ali model follow..  133........................................................................................................GNDIIAAAKRMALLMAEMSRLVRGGSGTK-LIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAE 259
35 -9.7801tr2_A mol:protein length:1066 VINCULIN ISOFORM 1  ali model follow..  916........................................................................................................GNDIIAAAKRMALLMAEMSRLVRGGSGTK-LIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAE 1042
36 -9.6901st6_A mol:protein length:1069 Vinculin  ali model follow..  2.................................................................................................PRMPVFHTRTIESILEPVAQQISHLVIMHEEGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEA..... 132
37 -9.4001u6h_A mol:protein length:280 Vinculin  ali model follow..  13................................................................................................SHMMPVFHTRTIESILEPVAQQISHLVIMHEDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEA..... 144
38 -9.3002gww_A mol:protein length:266 vinculin  ali model follow..  8........................................................................................................TRTIESILEPVAQQISHLVIMHEDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEA..... 131
39 -9.1804e17_A mol:protein length:263 Vinculin  ali model follow..  10........................................................................................................TRTIESILEPVAQQISHLVIMHEDGKAIPDLTAPVSAVQAAVSNLVRVGKETVQTTEDQILKRDMPPAFIKVENACTKLVRAAQMLQADPYSVPARDYLIDGSRGILSGTSDLLLTFDEA..... 133

FFAS is supported by the NIH grant R01-GM087218-01
1 3 8 7 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24