current user: public

If you have questions about the server, please let us know.

Query: 3tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .
# Score Template Links and tools%idFirst SNAMQEILSQLNKEIEGLKKAGLYKSERIITSPQNAEIKVGEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKGARFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYCGVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGAILast
1 -112.0003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model  100  1SNAMQEILSQLNKEIEGLKKAGLYKSERIITSPQNAEIKVGEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKGARFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYCGVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGAI 399
2 -108.0001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  66  2SHMRGEFYQQLTNDLETARAEGLFKEERIITSAQQADITVDGSHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEAREAGARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAG-SELRDRLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVI 400
3 -106.0003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  38  1SKGKLGEKISQFKIVEELKAKGLYAYFRPIQSKQDTEVKIDGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPED--SAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLNDDVDLIMGTFSKSL-ASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNE-PEHIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAEVE 395
4 -105.0005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  30  1....MNLLDTLQRGLADLDAQGLRRVRRTADSACDAHMTVNGREIVGFASNDYLGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHADTATLGALLEACTS---QTKLIVTDTVFSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALAAAALRSPHLVYVGTLGXAA-GVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDGDARRAHLAALIERTRALLRRTRWQPVDSHTAVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA... 393
5 -105.0005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  32  3....MHLLDTLAEGLKEIDARGLRRRRRTADTPCAAHMTVDGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDTDALSAMLEASD---ADVKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIAQAALRSPNLISIGTLDKAA-GVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEGDARRAHLQQLIGRTRAMLKATPWLPVDSHTAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA.. 396
6 -104.0001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  29  1....MSWQEKINAALDARRAADALRRRYPVAQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCP---GQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKV--KPELLVVTFGKGF-GVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG...... 384
7 -104.0002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  31  1.ADLLSKFDPLIAEREALLATGVRDPYAIVKVLSPTEAMINGRKTILLGTYNYMGMTFDPDVIAAGKQALDEFGSGTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPAE--AGKLVVLEGVYSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEEAGVEADVDFVVGTFSKSV-GTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHA-GDKRAHLWKNSRRLHQGLRDMGYKLGTAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATGVI 398
8 -102.0002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  31  20ERDLLSKFDGLIAERQKLLDSGVTDPFAIVQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKE--PAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSKSV-GTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRLGTCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVI 418
9 -100.0003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  27  18TRAGLSPLAWLADIEQRRRAEGLRRELR---------VRPPVAAELDLASNDYLGLSQHPDVLDGGVEALRTWGGGAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDACRLSRARVVVSPHRDVDAVDAALAARTE---ERAVVVTESVFSADGDLAPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHEVGLAGAPDVMTTTLSKAL-GSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALRVLDAE-PQRARAVLDRAAELAT----IAGVTEAPVSAVVSVILGDPEIAVGAAAACLDRGVRVGCFRPPTVPAGTSRLRLAARASLTDDEMALARQVLTDVLATAR.. 397
10 -99.9004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  30  36ERDLLSKFDGLIAERQKLLDSGVTDPFAIVQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKE--PAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSASV-GTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRLGTCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVI 434
11 -98.9002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  31  1....MDYNLALDKAIQKLHDEGRYRTFIDIEREKGARPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPA--APKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAY-GVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDMLLDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA.. 401
12 -97.9004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  27  16....SNAMLNLQDKYTQYQRDNLLRELT---------PFIKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYD-------GKSFITTEGVFSTSGSITQLDKLAKITPEK---LIVDEAHSFGVLGKNGRGAINSFRISKNCLICVFPLGKAF-GGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENV-NDNRARLQQNITFFNELCDAKDLELVSKDSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEYIR 391
13 -96.8005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  31  10QESGFDYEGLIDSELQKKRLDKSYRYFNNINRLAKAHRQREADKVTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPKS--VPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEDRVDMITGTLGKSF-GSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCH-IDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIVPVLIGNADLAKQASDILIKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQLP 433
14 -94.6002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  22  12...............NKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQR-----HGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTF-AYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTI-RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF. 386
15 -92.7003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  22  26...............NKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQR-----HGPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTF-AYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTI-RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF. 400
16 -28.8002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  16  1............................................MFKRETKDFINIQTGGKLTEEARQALLEWGDGYSVCDFCT-TPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTTPENFAQTIEETKKRG-EVVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEI--------GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLRRSEKYLLGCTARGATIITLMASFPHVRERIKRWDEEV-EKARRFAAEMEKLGIKQLGDNPHLYEISKKAKGGRFFLYRELKSRKIHG------IKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIEKYS.. 371
17 -24.4004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  13  1............................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLEN--THNGKVLPLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALK----NNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRV-GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR.... 333
18 -24.3003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  13  1............................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENVLPRE----YLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALK----NNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRV-GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSREQLAEVAAHWRAFLAR.... 333
19 -24.0002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  16  3........................................SDKIMIDLRSDTVTK---TEEMRKAMAQA--------EVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVAVLSGVMPHPVPGKNPDDVRKAIRPRNIHFPRTSLIAIENTHNRSGPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKE---YAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALT----KMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILNLKVNAHGFIEALRNSGVLA-------NAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS.. 349
20 -22.9005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  14  52....................................................LNPIQRGGILPKEAKKAVYEYWDGYSVCRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYENLEGYKEVIDNLEDKGKNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEV--------KADFIVASGHKSMAASAPGILAFSEEFSDKITKTSEKFMLGCTSRGLPIVTLMASFPHVVERVKKWDEEL-KKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFDELKKRGIAGVTKEIKMSVYGL-EWEQVEYVVNAIKEIVESCK.. 411
21 -22.1003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  13  2........................................SHMRYIDLRSDTVTQ---TDAMRQCMLHA--------EVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHSAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLEN--THNGKVLPLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRE---LVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQ----QHVVRLADDHRRARQLAEGLAALPLDLAQVQTNMVFLQL-TSGESAPLLAFMKARGILF---------SGYGELRLVTHLQIHDDDIEEVIDAFTEYLGA.... 341
22 -20.7001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  18  2....................KYLPQQDPQVFAAIEQERKRQHAKIELIASENFVS----RAVMEAQGSVLNKYAEGYPGRRYYGGCEIVEELARERAKQLFGAEHANV--SGAQANMAVYFTVLEHGDTVLGMNLSHLTHGSPVNFSGVQYNFVAYGDYDDVREKARLH-----RPKLIVAAA--SAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAG-----LHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNEGFTLVSGGTDLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESTSGIRIGTAAV-GLEEMDEIAAIIGLVLKN.... 386
23 -20.7003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  15  1...MAMGTLEAQTQGPGSMSAPLAEVDPDIAELLAKELGRQRDTLEMIASENFVP----RAVLQAQGSVLNKYAEGLPGRRYYGGCEVVENLARDRAKALFGAEFANV--SGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYE--DMDAVRATALEF-----RPKVIIAGW--SAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAG-----LHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAPDVAKGGTDVHLVLVDLRDSPDGQAAEDLLHEVGITVNRNAVPNDPRPTSGLRIGTPAL-GDTEFTEVADIIATA....... 404
24 -20.4004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  18  1...MASMFDRAQSTIANVDPE--------IFAAIEQENRRQEDHIELIASENYTS----PAVMAAQGSQLNKYAEGYPGKRYYGGCEVVEQLAIDRVKQLFGAEAANV--SGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNV-DYDAAEKLANEH-----KPKLIVAGA--SAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAG-----VYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTEMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKTSGIRLGSPAGFGPAEAEQVGNLIADVLEN.... 393
25 -20.4001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  12  2...............................STPRTTATAAKPKPYSFVNDYSVG---HPKILDLMARD-------NMTQHAGYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHEAIEATGHKVVTAPCPDVADIESALHENRSEHMVIPKLVYISNTTEVGTQYTLEDISASCKEHGLYLFLDGARLASALSSPVNDLTLA-DIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMK--DNLFFELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPILENTMIAELNNDFDMYTVEP-------LKDGTCIMRLCTSWATEEKECHRFVEVLKRLVAS.... 357
26 -20.2003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  16  1............SNAMLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTS----PRVMQAQGSQLNKYAEGYPGKRYYGGCEVVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNI-DYDEMAKLAKE-----HKPKMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAG-----VYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRIGSPAGFKEAEVKELAGWMCDVLDN.... 395
27 -20.1003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  17  5....................SYITKQDKVIAEAIEREFQRQNSNIELIASENFVS----EAVMEAQGSVLNKYAEGYPGRRYYGGCEVTESIAIDRAKALFGAEHVNV--SGPQANMAVYLVALEMGDTVLGMNLSHGGHLTHGAPVNFSGKFYN--NYDEVRKLALE-----HKPKLIVAGA--SAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAG-----LHPNPVEYADFVTTTTHKTLRGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNFKTYQQQVVKNAKVLAEALINEGFRIVSGGTDAVDVKGSIGLTGKEAEETLDSVGITCNKNTIPFDQEKTSGIRLGTPAGFDEKAFEEVAKIISLALKN.... 390
28 -19.7003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  12  14.....................................................GQISGHGKRNVGVLKTAFAAVADEMASDQY-GTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQDGLKELHPIETILVGAADRLMTLDEIKALPDIACLLLELPQREIGGVAPALETISRYCRERGIRLHLDGARLFEMLPYYEKTAAE---IAGLFDSIYISFYKGLGGIAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYE----LRKDRMGQYYEQAKQLAEQFNALPTTPEVPVSNMFHLHFDGQAADISLEQVQEETGLGFVG------YLVDKDGYCSTEISVGDAYGELDQQTRDAGFARL... 352
29 -19.6003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  16  1..SMSNANPFFSQSLAERDAS--------VRGAILKELERQQSQVELIASENIVS----RAVLDAQGSVLNKYAEGYPGKRYYGGCEEVEALAIERVKRLFNAGHANV--SGAQANGAVMLALAKPGDTVLGDAGGHLTHGAKPALSGKWFNALQYGDYDQVEALAQQ-----HKPSLIIAGF--SAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAG-----RHANPVEHAHVVTSTTHKTLRGPRGGFVTNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKTSGIRLGTPAG-GAAEFREVGRLILEVFEA.... 396
30 -19.5001v72_A mol:protein length:356 Aldolase  ali model follow..  13  5........................................SRPPALGFSSDNIAG---SPEVAQALVKH-------SSGQAGPYGTDELTAQVKRKFCEIFERDVEVFLPTGTAANALCLSAMTPPWGNIYCHPASHPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKVGDVHTTQPACVSITQATEVTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAE-MTWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLT--DDLWLRNARKANAAAQRLAQGLEGLG--LGGTEANILFCRLDSA-----MIDALLKAGFGFY-----HDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQ.. 354
31 -19.5001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  18  5...................EMNIADYDAELWQAMEQEKVRQEEHIELIASENYTS----PRVMQAQGSQLNKYAEGYPGKRYYGGCEIVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNI-DYADLEKQAKEH-----KPKMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAG-----VYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRVGTPAGFKEAEAKELAGWMCDVLDS.... 392
32 -19.5003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  16  3...................AMSLEMFDKEIFDLTNKELERQCEGLEMIASENFTL----PEVMEVMGSILNKYAEGYPGKRYYGGCEEIETLAIERCKKLFNCKFANV--SGSQANQGVYAALINPGDKILGMDLSHGGHLTHGAKVSSSGKMYES-DYEKVREIAKK-----EKPKLIVCGA--SAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAG------HPSPFPYAHVVSSTTHKTLRGPRGGIITNDEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEWKVYAKQVRTNAQVLANVLMDRKFKLVSDGHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSTSGLRLGTPAGFKEKEMEIVSNYIADILDD.... 388
33 -19.4004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  17  5...................NNNLHETDKEINEIIKHEKLRQSSVIELIASENFVS----PAVLEAQGALLNKYAEGYPSKRFYNGCEKAENLAIERVKKLFNCKYANV--SGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNLIDYDEIERLADL-----HKPKLLIAGF--SAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATG-----EHQSPIPYAHAVTSTTHKTLRGPRGGLISNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDILTGGTDVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSTSGIRLGTPAGFKEKDFVLVGHMVADILDG.... 391
34 -19.3004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  15  2.....................EYSDVPKFIRDVSIKQHEWMRESIKLIASENITS----LAVREACATDFHRYAEGLPGKRLYQGCKEVETLCIELSKELFKAEHANV--SGVVANLAVFFAETKPGDKLMALSVPDGGHISHWKVSAAGIRGLK--DADAMVKKILE-----EKPKLILFGG--SLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLI----AGKQFQDPLREGAEYLMGSTHKTFFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAE-MLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHKD-IESSPDIEFSASELAKMYEEANIILNKNLLPNNSDNPSGIRLGTQEC-KEKEMEEIAEFMKRIAID.... 392
35 -19.3005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  17  4...................AYFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTF----PSVMEAMGSILNKYAEGYPNKRYYGGCEKIESLAIERAKKLFNCQFANV--SGSQANNAVYHALLKPYDKILGSCGGHLTHGAKVSLTGKHYQSFSYGDYEEALKIAQS-----VKPEIIVCGF--SAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTN-----EHAHPFPHCHVVSSTTHKTLRGPRGGIITNDEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEFKAYAKLVKSNMQVLAKALKEKNHKLVSGGTSLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSTSGIRIGSAAGMGAKEFEIIGNKISDILND.... 389
36 -19.3002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  17  22.................................................QREGLELIASENFVSKQVREANKYAEGYPGARYYGGCERVESLAIERAKALFGAAWANV--SGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYK--DLEEVRRLALE-----HRPKVIVAGA--SAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAG-----LHPNPLPYAHVVTSTTHKTLRGPRGGLISNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPTSGIRIGTPAGFTPEEMPLVAELIDRALLE.... 387
37 -19.2005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  11  4...........................................KSQQFASDNYSG---CPEAWAAMEKA-------NHGHDRAYGDDQWTERASEYFRNLFETDCEVFFFNGTAANSLALASLCQSYHSVICSETAHPEFFSNGSKLLTAASVNGKLTPQSIREVALKRQDIHYPKPRVVTITQATEVGTVYRLKAISATCKELGLNLHMDGARFTNACAFLGCSPAE-LTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLE--DGAWLRHGNHANHCAQLLALLVSDLP--MFPVEANGVFLQMPEH-----AIEALRAKGWRFYT-------IGSGGARFMCSWDTEEERVRELAADIRSIIT..... 345
38 -19.1005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  17  1..............MAMFANISISEFDPELAQAIASEDERQEAHIELIASENYCS----PAVMEAQGSKLNKYAEGYPGKRYYGGCEVIEQMAIDRAKELFGADYANV--AGSQANSAVYLALLNPGDTVLGAHGGHLTHGAKVSFSGKTYNAVQYGDYEEVERLALEH-----KPRMIVAGF--SAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAG-----VYPNPVQIADVTTTTTHKTLRGPRSGLILAKANIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDFKAYQQQVVKNAQAMAEVFIARGYDVVSGGHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSTSGIRIGTPAGFGEAEVRELAGWIADVIDS.... 393
39 -19.0004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  17  3...........GSGSMIFDKEDYKAFDPELWNAIDAEAERQQNNIELIASENVVS----KAVMAAQGTLLNKYAEGYPGKRYYGGTAVVETLAIERAKKLFGAKFANV--SGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYN--DYDAILAQAKE-----VRPKLIVAGA--SAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASG-----HHPSPVPYAHVTTTTTHKTLRGPRGGLITDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVISNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSTSGIRVGSPAGMGEAESRQIAEWMVEALEN.... 398
40 -18.9001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  11  25..........................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAY-YHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAE--NIAYICLAVTVNLAGSMANMRAVRELTAAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREQYEYIEHRVKQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDI 434
41 -18.9003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  10  22...........................................................PRNVGVLTEALQNIDDNLESD--IYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADENRRVAYHPLSHLEIHEQDGLKELQQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEE---ICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFE----KRIGKMAEYFEAAKGLAERFNSCSTVPEVPVSNMFHVYFENSADEIGLTKIQDETGVGISGYLQEKS-ADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL... 359
42 -18.8003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  13  29AQRAGTIDVQRNENFGKLRAGYLFPEIARRRKAH--QEKNPDAKIISLGIGD--TEPLPKYIADAMAKAAAGLATREGYSGYEQGQGALREAVASTFYGHAGRADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNSKAKRTDIIFFCSPNNPTGAAATLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKGFTGVRLGWTVVPKALKY--WNRVMTTCFNGASNIVQAGGLACLQPEGLKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGKPSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFG--SRENILEAVRRFKEAYGKRN.. 441
43 -18.6006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  14  48........................................SGAYLTDPDGRRWIDFDGDEEVAEAIARAARG------RSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVDARDRSIVLSSGYHGYHCDEPFTPNQHGIVEFLFDLDVLAEWLSRPEQVAA----VVISPDHMHLGE---YTEFTRLTKEADVPVIADEV--VGLRYRAG-------LSTPLLDPAVWIVAKCLANGS-AAVGGDAHLLAALEDVSFTSYFE----PTAMAAATTTLRRMATGEP--QQAIRAAGDRFIAHTRAAGVPILAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFE-------------NQTPSAAFTDEVVEDACGRIDRVSAAL... 388
44 -18.5001eji_A mol:protein length:478 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  16  1...MADRDATLWASHEKMLSQPLKDSDAEVYSIIKKESNRQRVGLELIASENFAS----RAVLEALGSSLNKYSEGYPGQRYYGGTEELEMLCQKRALQAYHLDPQCWGVSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSINYDQLEENASLF-----HPKLIIAGT--SCYSRNLDYARLRKIADDNGAYLMADMAHISGLVAAG-----VVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKELESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEFKIYQLQVLANCRALSDALTELGYKIVTGGSDILMDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSRPSGLRLGTPAGLLEEDFQKVAHFIHRG....... 422
45 -18.4004oyt_A mol:protein length:442 Serine hydroxymethyltransferase, putative  ali model follow..  14  4...................NEPLEQIDKELHDILADEEKRQRETINLIASENLTN----GAVRECLGNRVNKYSEGYPKKRYYGGNDKIEELCQKRALEAFNVSDEEWGVSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDDLDAVREMALSF-----KPKVIICGY--TSYPRDIDYQQFRQICDEVNAYLFADISHISSFVACN-----ILNNPFLHADVVTTTTHKILRGPRSALIFFNKKIEQKINSAVFPSFQGGPHNNKIAAVACQLKEVHSPAFKEYTQQVLLNSKALAKALISKQIDLVTNGTDIVVDLRKFSITGSKLQETCNAINVSLNKNTIPSDVDSPSGVRIGTPAM-KEKDMEFIADVLARA....... 397
46 -18.4006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  13  29........................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPERVAA----VVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMANGH-SAVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVATGEPQ--RAVREAGDRFLRHARKALDDASAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL... 371
47 -18.3004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  15  32...............GMFNNDPLQKYDKELFDLLEKEKNRQIETINLIASENLTN----TAVRECLGDRINKYSEGYPHKRYYGGNDKIEELCYKRALEAFNVSEEEWGVSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDDMESVRNLALS-----FQPKVIICGYTSYP-----DYKGFREICDEVNAYLFADISHISSFVACN-----LLNNPFTYADVVTTTTHKILRGPRSALIFFNKGIDQKINSSVFPSFQGGPHNNKIAAVACQLKEVNTPEFKEYTKQVLLNSKALAECLLKRNLDLVTNGTDIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDVDSPSGIRIGTPAL-KEKDMEFIADMLLKAIL..... 431
48 -18.3003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  14  1.................MSLIPLRQNIASMKGYIPGYQPPDIASWIKLNTNE---YPPSPEVVKAILEELGP-----DGAALRIYPSASSQKLREVAGELYGFDSWIIMANGSDEVLNNLRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTG--DFRIAGFPERYEG---KVFFLTTPNAPLGPSFPLEYIDELARRCAGMLVLDETYAEFAESNALELVRRHENV-----VVTRTLSKSLAGMRIGLAIARPEVIAALDKIRDHYNLDR-LAQAACVAALRDQAYLSEC----CRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPDRD-GKRVYDGLYARKVLVRHFSDPLLAH----MRISIG---TREEMEQTLAALKEIGE..... 353
49 -18.3006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  16  51.................................................QCRGLELIASENFCSRAALEANKYSEGYPGKRYYGGAEEIELLCQRRALEAFDLDPAQWGVSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIDYNQLALTARLF-----RPRLIIAGT--SAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAK-----VIPSPFKHADIVTTTTHKTLRGTRSGLIFYRKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSTPGGLRLGAPAL-REDDFRRVVDFIDEG....... 435
50 -18.3003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  14  16..........................................DNPIRINFNE---LGMSPKAQAAARDAVVKANRYAKNEI---------LMLGNKLAAHHQVEPSILLTAGSSEGIRAAEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDNWAFDEGLKAAVAAYSGPSIVYLVNPNNPTGTITPADVIEPWIAS-NTMFIVDEAYAEFVNDPRFRSISPMITQGAENIILLKTFSKAMAGMRVGYAVAHPTVIALMGRYVAGE----KINFSGVDAALASMN--SAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNF--VFHQLVVPLKDYQTHMADAGVLIGRAFPPA----DNWCRISLG---TPQEMQWVADTMREFRKKSWI. 354
51 -18.3001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  15  9..........................................HQFPGLANKTYFNFGGQGILPTVALEAITAMENGPFSIAANQHIQQLIAQLRQALAETFNVDPTITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIFGITYRFFPVAATLNQAAAVLANHLGP------KTRLVILSHLLWNTGQVLPLAEIMAVCRRHQGRVLVDGAQSAGSLPLDFSRL--------EVDYYAFTGHKWFAGPAGGGLYIHGDCLGEINPTYVGW-FEVATSAPQYAGLLAALQLHQRQGTARYQAICQRSEFLWRGLNQLPLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDC------IRACCHYITDEEEINHLLARLADFG...... 389
52 -18.2002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  14  26..........RNSNMSKLQAGYLFPEIARRRSAH--LLKYPDAQVISLGIGD--TEPIPEVITSAMAKKAHELSTIEGYSGYEQGAKPLRAAIAKTFYGGLGIGDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFRTDIIFFCSPNNPTGAAATLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVA-METASFSKGFTGVRLGWTVIPKKLLY--FNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFG--HRENILEACRRFKQLYK..... 426
53 -18.1006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  13  45........................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPERVAA----VVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMANGH-SAVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVATGEPQ--RAVREAGDRFLRHARKALDDASAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL... 387
54 -18.1006DK6 Entity 1(prereleased)  ali follow..  12  1.......MALINENFLKLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGD--TEALPEAVRYAMHEAVDELGNRSTFKGYEQGYDFLRNAIADNDYKARGLPDEIFISDGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYLKCTPENGQEKADLIYLCYPNNPTGAVATLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIEGARDCAIEFRSFSKGFTGVRCAYVVIPKSLMG-LWSRRHSTKFNGASYIVQKGAEALYTDEGKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPY-VGCPAGLTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFN--SRANVEEVCRRIAAL....... 410
55 -18.1005z0y_A mol:protein length:470 Serine hydroxymethyltransferase  ali model follow..  16  6..........LSPEHKQMVEGHLAETDPEVNQIIKDEVDRQKHSIVLIASENFTS----TSVFDALGTPMNKYSEGYPGARYYGGNERMEILCQQRALKAFHLDGSRWGVSGSPANLQVYQAIMKPHDRLMGGHLSHGYQTDTRKISAVETMPYRVDDYDMLEKTAVLY-----RPKVLVAGT--SAYCRLIDYKRMREIADKVGAYLVVDMAHISGLIAAG-----VIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKQYQEQVLKNAKALENEFKRLGYKLVSDGTDSHMVLVDKDIDGARIETVCENINIALNKNSIPG-ALVPGGVRIGAPAM-SEEDFVKIANYIDKSVQY.... 423
56 -17.9002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  11  6SGLVPRGSHMISNKLANIPDS-------YFGKTMGRKIEHGPLPLINMAVGI--DGPTPQGIIDHFQKALTIPENQKYGA--FHGKEAFKQAIVDFYQRQYNVTEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASENGKDVA-IEIYSLSKNMSGFRVGFAVGNKDMIQALKKYQTHT--NAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLTPPGYDSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLAL--DDQKLDEAAIRLTELAYLYE.. 398
57 -17.9006ccz_A mol:protein length:455 Serine hydroxymethyltransferase  ali model follow..  17  2...............NAFLDYGLSEADPDVHAIINKEKDRQFRSLELIASENFTS----KAVMEAVGSCLNKYSEGLPGKRYYGGNEELEILCQQRALAAFHLDGDKWGVSGSPANFAVYTAILKPHDRIMGLDLPHGGHLSHGFMTAKRRVSGTSIDYDMLEKTAAL-----FRPKLIIAGA--SAYPRDIDYARFRKIADSVGAFLMMDMAHVSGLIAAS-----VLADPFEFVDIVTTTTHKSLRGPRGGMIFFKKDLESAINNAVFPGLQGGPHNHTIGGLAVCLKYAQSPDFKNYQNQVVANCRALANRLVEHEYKLVSGGSDVLVDLRPSGIDGARVEKILDMASITLNKNSVPGDKSVPGGIRIGSPAGLGEKEFELIADLIHEGVRI.... 405
58 -17.9006MME Entity 1(prereleased)  ali follow..  11  25..........................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAE--NIAYICLAVTVNLAGSMANMRAVRELTEAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREQYEYIEHRVKQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDI 434
59 -17.9005x3v_A mol:protein length:496 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  16  46.................................................QCRGLELIASENFCSRAALEANRYSEGYPGKRYYGGAEEIELLCQRRALEAFDLDPAVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIDYNQLALTARL-----FRPRLIIAGT--SAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAK-----VIPSPFKHADIVTTTTHKTLRGARSGLIFYRKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSTPGGLRLGAPAL-REDDFRRVVDFIDEG....... 430
60 -17.9002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  13  18...................................RKARERGVGLIDLSIGS--DLPPPEAPLKALAEALND---TTYGYCLKSCTLPFLEEAARWYEGRYGVGEALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLRDLKAVPEGVWR------EAKVLLLNYPNNPTGAVADFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGAKERV-VELFSLSKNLAGFRLGFALGSEEALARLERVKGVI--DFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGVDDLEFGLRLVERGVALAP------PGGKGFVRIALVR--PLEELLEAAKRIREALD..... 376
61 -17.8004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  12  40..........RNVNLEKLKNNYLFPEINRRELEH--IEKHPNVQLISLGTGD--TEPIPEQITSHMSNFAHGLSTVEGYRGYEQGNKTLRKAIAETFYRDLHVKNEVFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPCGPNNSFRTDVIFFCSPNNPTGYVASLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIPGAREVA-IEVSSFSKGFTGVRLGWSIIPDELLY--FHRIVTTSFNGASNIAQAGGLACLSSGGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGSKSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFG--RRDHIVEASKRLQNFFNTR... 442
62 -17.8003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  12  3..........RNPHFVSLTKNYLFADLQKRVAQF--RLENPQHTVINLSIGD--TQPLNASVAEAFASSIARLSSPTTCRGYDFGLPALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCL----ENAFFPEFPEDTHIDILCLCSPNNPTGTVLNLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKGFAGIRLGWTVIPQELTYADGHFVIQDWTFNGASIPAQEAGVAGLS--ILPQLEAIHYYRENSDLLRKALLATGFEVFGGEHALWVKPTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLG--KREDILAACERLQMAPALQS.. 394
63 -17.8004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  13  36..........................................KIAARIGANE---FGPAPSVLLAIRQAAGDTWKYADPEN---------HDLKQALARHLGTSANIAIGEGIDGLLGQIRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADREDLEGLLAAVGRE--NAPLVYLANPDNPMGSWWPAERVVAFAQALTTLLVLDEAY-CETAPRDALPPIESLIDKPNV-IRARTFSKALAGARIGYTLSTPGTAQAFDKIRNHF----GMSRIGVAAAIAALA--QDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDASRAIVDRLMSDHGIFIRMPGVAPLNR----IRISTA---PDAEMDLLAAALPEVIRSLA.. 374
64 -17.8001m32_A mol:protein length:366 2-aminoethylphosphonate-pyruvate aminotransferase  ali model follow..  16  3.................................................RNYLLLTPGPLTTSRTVKEAMLFDSCTWDDDYNIGVVEQIRQQLTALATASEGYTSVLLQGSGSYAVEAVLGSALGPQDKVLGARMVEMAGLMGIAHHAYDCGEVARPDVQAIDAILNADPT-----SHIAMVHSETTTGMLNPIDEVGALAHRYGKTYIVDAMSSFGGI-------------ALHIDYLISSANKCIQGVPGAFVIAREQKLAACKGHSRSLSLDLTSPTHTVLAFAQALKELAKEGAARHQRYQQNQRSLVAGMRALGFNTLLDDELHSPIITDPQYRFSEFYRRLKEQGFVI----YPGKVSQSDCFRIGNIGEVYAADITALLTAIRTAMYWTK.. 366
65 -17.7005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  13  51...................................................NHGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLDESRAAVANLLKVPETVVFVANATMGVNTVLR-ADGKDEILYFDTIYGACGKTIDYVIEDKRG-DDDVVAAFRDAIKKSREEGKRPRLAVIDVVSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDLKITET--------DPDFLISNCHKWLFTPRGAVFYVPVRNQHLIRAFVSNFEFVGTVDNSPFFCVKDAIKWREE--ERIMEYMTKLAREGGQKVAEIGTRVLENSTG-LPFVVGEDPKAPWMYNVLQDEFNTFVPMTF----RRRFWARLSAQVYLEMSDFEWAGKTLKELCERVA.. 472
66 -17.7004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  14  23..........................................PGAIKLASNE---FGPLPSVRAAIDRATDTVNRYPDNGC---------VQLKAALARHLGPDEHVAVGCGSVSLCQQLQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTDLYAMLATVTD---RTRLIFVCNPNNPTSTVVGPDALARFVEAVHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNV-VVLRTFSKALAGLRIGYAIGHPDVITALDKVYVPF----TVSSIGQAAAIASLD--ADELLARTDTVVAERARVSAELRAAGFTLPPSQANF--VWLPLGSRTQDFVEQAADARIVVRPYG-------TDGVRVTVA---APEENDAFLRFARRWRSD.... 353
67 -17.5004p3m_A mol:protein length:429 Serine hydroxymethyltransferase  ali model follow..  18  5...................DMNIADYDPELWQSITDEVQRQEDHIELIASENYTS----PRVMEAQGSQLNKYAEGYPGKRYYGGCEVAESLAIERAKSLFGADYANV--SGSQANAAVYQALCAPGDTILGMSLAHGGHLTHGSHVSFSGKMYN--DYAEIERLAVEH-----KPTMIIAGF--SAYSGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAG-----LYPNPVPFADVVTTTTHKTLGGPRGGLILAKANIEKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEFAVYQQQVLDNAKAMVKSFLARGYKIVSGGTEFLVDLIAQDITGKEADAALGNAHITVNKNSVPNDPRSTSGLRIGTPAL-NAQQSAELALWMCDVLDA.... 392
68 -17.4003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  12  27..........................................NVDIRLNTNE---YPPSEALVADLVATVDKIATELN--------ERDAVELRDELAAYITKQDNLWAANGSNEILQQLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYA-----SPSPSATTLLEKYPTKLVVSRTMSKAFAGGRLGYFVANPAFIDAVMLVRLPYHLSA-LSQAAAIVALRHSADTLGT----VEKLSVERVRVAARLEELGYAVVPSESNF--VFFGDFSDQHAAWQAFLDRGVLIRDVGIAGH------LRTTIG---VPEENDAFLDAAAEIIKL.... 364
69 -17.4001ls3_A mol:protein length:483 Serine Hydroxymethyltransferase  ali model follow..  15  3AVNGAPRDAALWSSHEQMLAQPLKDSDAEVYDIIKKESNRQRVGLELIASENFAS----RAVLEALGSCLNKYSEGYPGQRYYGGTEELETLCQKRALQAYGLDPQCWGVSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIDYDRLEENARL-----FHPKLIIAGT--SCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAG-----VVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDILVDLRSKGTDGGRAEKVLEACSIACNKNTCPG-ALRPSGLRLGTPAL-LEKDFQKVAHFIHRG....... 427
70 -17.4003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  15  30..........................................KEVIKLASNE---FGTPPKAIECLRQNANKAHLYPDDSM---------IELKSTLAQKYKVQENIIIGAGSDQVIEFAHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITLDEFKKLYETHKD---EIKLIFLCLPNNPLGECLDASEATEFIKGVDCLVVIDAAYNEFASFKDSKKHLEPCELIKEFDLYLGTFSKLLGGLRIGYGIANANIISAFYKLRAPF----NVSNLALKAAVAAMD--DEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDEKN-STDLSEKLLKKGIIIRNLK----SYGLNAIRITIG---TSYENEKFFTEFDKILR..... 365
71 -17.3003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  56..........................................HELAIMDSNNFLGNCGVGEREGRVASALVAHGIGRSGD--AAGSSLLNKLDIIKLAGVHTVANCFVVPMATGMSLTTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVDLKAVEAKVQELGPDCILCIHSTTSCFAPRVPD--RLEELAVICANYDIPHIVNNAY--GVQSSKCMHLIQQGARVGRIDAFVQSLDKNFMVPVGGAIIAGSKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYNERLLHTPHNPISLAMTLKTLDEHRDKAVTQLGSMLFTRQVSGARVVPLGSMQPCAYLNAASAIGMKMQDVDLFIKRLDRCLKAV... 461
72 -17.3002aeu_A mol:protein length:374 Hypothetical protein MJ0158  ali model follow..  16  32...................................................DLSGLSGGFLIDEKDKALLNTY---------IGSSYFAEKVNEYGLKHLGGNDKCVGFNRTSSAILATILALKPKKVIHLPELPGHPSIERSCKIVNAKYF--ESDKVGEILNKIDKDT-----LVIITGSTMDLKVIELENFKKVINTAKNKEAIVFVDDASGARVRLLFNQPPALKLG----ADLVVTSTDKLMEGPRGGLLAGKKELVDKIY--IEGTKFGLEAQPPLLAGIYRALKNFNLERIRKAFE................................................................................................ 264
73 -17.3005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  15  77.......................................TQGQEFIDCLGG--VG--RNPVVVSAVQNQLAKQPLHSQE------LDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLA-GKFTFIATSGAFHGKSLGALSATAKSTFRVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILPLTAVRKLCDEFGALMILDEVQT---MGRTGK-ACEHENVQPDI-----CLAKALGGGV-GATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQN--LPAQAEQKGDMLLDGFRQL-VQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVA-----GTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAM... 450
74 -17.2003f0h_A mol:protein length:376 Aminotransferase  ali model follow..  13  1.......................................MGSDKIENLYFQGMLNFTVGPMSSEEVRAIGAEQVPYFRTTEFSSTMLENEKFMLEYAKAPEGSKAVFMTCSSTGSMEAVVMNCFTKKDKVFGHRFVQLCEIHEIPYVALKLEHGKKLTKEKLYEYDNQ------NFTGLLVNVDETSTAVLYDTMMIGEFCKKNNMFFVCDCVSAFL---------ADPFNMNEGADVMITGSQKVLACPPGSVIVLAPRGVERVEKSKVRTMYPFTPAVGILLQINERLKEIKKHGDAEVARIASQAADFRAKIKDLPFELVSESPAVTSVHPTTANAYDIFLKLKDEYGIWICP------EMKDTIFRVGHIGALTHEDNTTLVNAFKDLQKRNLL. 370
75 -17.2006fl5_A mol:protein length:471 Serine hydroxymethyltransferase, cytosolic  ali model follow..  15  2........ADLWSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFAS----RAVLEALGSCLNKYSEGYPGQRYYGGTEELETLCQKRALQAYKLDPQCWGVSGSPANFAVYTALVEPNGAIMGLDLPDGGHLTHGFMTDKKKISAT--NYDQLEENARLF-----HPKLIIAGT--SCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAG-----VVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDRSRPSGLRLGTPAGLLEKDFQKVAHFIHRG....... 418

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.