current user: public

If you have questions about the server, please let us know.

Query: 3u62_A mol:protein length:253 Shikimate dehydrogenase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MKFCIIGYPVRHSISPRLYNEYFKRAGMNHSYGMEEIPPESFDTEIRRILEEYDGFNATIPHKERVMRYVEPSEDAQRIKAVNCVFRGKGYNTDWVGVVKSLEGVEVKEPVVVVGAGGAARAVIYALLQMGVKDIWVVNRTIERAKALDFPVKIFSLDQLDEVVKKAKSLFNTTSVGMKGEELPVSDDSLKNLSLVYDVIYFDTPLVVKARKLGVKHIIKGNLMFYYQAMENLKIWGIYDEEVFKEVFGEVLKLast
1 -103.0003u62_A mol:protein length:253 Shikimate dehydrogenase  ali model  100  1MKFCIIGYPVRHSISPRLYNEYFKRAGMNHSYGMEEIPPESFDTEIRRILEEYDGFNATIPHKERVMRYVEPSEDAQRIKAVNCVFRGKGYNTDWVGVVKSLEGVEVKEPVVVVGAGGAARAVIYALLQMGVKDIWVVNRTIERAKALDFPVKIFSLDQLDEVVKKAKSLFNTTSVGMKGEELPVSDDSLKNLSLVYDVIYFDTPLVVKARKLGVKHIIKGNLMFYYQAMENLKIWGIYDEEVFKEVFGEVLK 253
2 -86.2003don_A mol:protein length:277 Shikimate dehydrogenase  ali model follow..  32  1MKFAVIGNPISHSLSPLMHHANFQSLNLENTYEAINVPVNQFQDIKKIISESIDGFNVTIPHKERIIPYLDDINEAKSVGAVNTVLKWIGYNTDGIGYVNGLKQGIEDAYILILGAGGASKGIANELYKIVRPTLTVANRTMSRFNNWSLNINKINLSHAESHLDEFDIIINTTPAGMNGNDSVISLNRLASHTLVSDIVYNPTPILIEAEQRGNP-IYNGLDMFVHQGAESFKIWTNLEPDIMKNIVIQKLK 266
3 -85.0003pwz_A mol:protein length:272 Shikimate dehydrogenase 3  ali model follow..  25  4.RYAVIGRPINHTKSPLIHGLFAQASNQQLEYGAIEGSLDDFEAQVLQFRSGGKGMNITAPFKLRAFELADRSERAQLARAANALKRIVAENFDGIGLLRDIEENLRNRRVLLLGAGGAVRGALLPFLQAGPSELVIANRDMAKALALRNELDHSRLRISALEGQSFDIVVNATSASLTADLPPLPADVLGEAALAYELAYGKTPFLRLAREQGQARLADGVGMLVEQAAEAFAWWRGVRPDTVINQLTIPLE 272
4 -83.9001nyt_A mol:protein length:271 Shikimate 5-dehydrogenase  ali model follow..  26  3.TYAVFGNPIAHSKSPFIHQQFAQQLNIEHPYGRVLAPINDFINTLNAFFSGGKGANVTVPFKEEAFARADETERAALAGAVNTLMRLLGDNTDGVGLLSDLERIRPGLRILLIGAGGASRGVLLPLLSLDC-AVTITNRTVSRAEELAKLFAIQALSMDELEGHEFDLIINATSSGISGDIPAIPSSLIHPGIYCYDMFYQKTPFLAWCEQRGSKRNADGLGMLVAQAAHAFLLWHGVLPDVVIKQLQEELS 271
5 -83.4004omu_A mol:protein length:283 Shikimate dehydrogenase  ali model follow..  26  3.QYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGGNVTVPFKEEAFRLCDSTPRARRAGAVNTLSTLQGDNTDGAGLVRDLTVNLAGKRILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDPVVASGFAWLQEPVDVIINATSASLAGEPPIADSLVEAGRTVCYDMMYGKTPFCQWATKLGAAKVLDGLGMLAEQAAEAFFIWRGVRPDTVLAELRRQLA 272
6 -83.3002hk9_A mol:protein length:275 Shikimate dehydrogenase  ali model follow..  36  9..YGVIGFPVKHSLSPVFQNALIRYAGLNAVYLAFEINPEELKKAFEGFKAKVKGINVTVPFKEEIIPLLDYVEDAKEIGAVNTVKKAYGYNTDWIGFLKSLKSEVKEKSILVLGAGGASRAVIYALVKEGA-KVFLWNRTKEKAIKLAQKFPLEVVNSPEEVIDKVQVIVNTTSVGLKDDPEIFNYDLIKKDHVVVDIIYKETKLLKKAKEKGAK-LLDGLPMLLWQGIEAFKIWNGCEVPY--SVAERSVR 265
7 -82.9003pgj_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  26  25.QYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQCVPVDGFTEAAKHFFAGGRGCNVTVPFKEEAYRFADRTERARLAGAVNTLKEILGDNTDGEGLVQDLLALLKGATILLIGAGGAARGVLKPLLDQQPASITVTNRTFAKAEQLAELVAAVKAQAFEQLKQSYDVIINSTSASLDGELPAIDPVIFSSRSVCYDMMYGKTVFNQWARQHGCAQAIDGLGMLVGQAAESFMLWRGLRPGTILRELRKNLE 293
8 -82.3001p74_A mol:protein length:272 Shikimate 5-dehydrogenase  ali model follow..  26  3.LYAVWGNPIAQSKSPLIQNKLAAQTHQTMEYIAKLGDLDAFEQQLLAFFEGAKGCNITSPFKERAYQLADESQRAKLAEACNTLKKLYADNTDGIGLVTDLQRLRPNQHVLILGAGGATKGVLLPLLQAQ-QNIVLANRTFSKTKELAERFQIQAVSMDSIPLQTYDLVINATSAGLSGGTASVDAEILKLGSAFYDMQYADTPFIALCKSLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDF--VSVYEQLK 268
9 -81.9001wxd_A mol:protein length:263 shikimate 5-dehydrogenase  ali model follow..  30  3.RFAVLGHPVAHSLSPAMHAFALESLGLEGSYEAWDTPLEALPGRLKEVRRAFRGVNLTLPLKEAALAHLDWVSPAQRIGAVNTVLRLFGFNTDAPGFLEALKAGPLKGPALVLGAGGAGRAVAFALREAGL-EVWVWNRTPQRALALAEEFGLRAVP---EKAREARLLVNATRVGLEDSASPLPAELFPEEGAAVDLVYRPTRFLREAKAKGLK-VQTGLPMLAWQGALAFRLWTGLLPDP--SGMEEAAR 258
10 -81.6002egg_A mol:protein length:297 Shikimate 5-dehydrogenase  ali model follow..  33  20..YGLIGFPVEHSLSPLMHNDAFARLGIPARYHLFSVEPGQVGAAIAGVRAGIAGVNVTIPHKLAVIPFLDEVDEARRIGAVNTIIRLVGYNTDGLGYVQALEETLDGKRILVIGAGGGARGIYFSLLSTAAERIDMANRTVEKAERLVREGDYFSLAEAETRLAEYDIIINTTSVGMHPEVQPLSLERLRPGVIVSDIIYNPTKWLKEAKARGAR-VQNGVGMLVYQGALAFEKWTGQWPDVMKQLVIEALR 290
11 -80.8003fbt_A mol:protein length:282 chorismate mutase and shikimate 5-dehydrogenase fusion protein  ali model follow..  31  8..YGLIGEKLGHSHSSYIHKLIFEKVGIKGIYNLFEVPKEKLKESVDTFKIKCGGLNVTIPYKVEVMKELYEISEARKIGAVNTLKGISGFNTDYIGFGKMLSKEIKNNICVVLGSGGAARAVLQYLKDNFAKDIYVVTRNPEKTSEIYGEFKVISYDELSNL--KGDVIINCTPKGMYPGESPVDKEVVAKFSSAVDLIYNPTLFLKYARESGVK-AVNGLYMLVSQAAASEEIWNDISIDE--IIVDEIFE 266
12 -80.3005dzs_A mol:protein length:276 Shikimate dehydrogenase (NADP(+))  ali model follow..  26  4..FGLVGEKLSHSVSPQIHKRVFEILNIESAYKNFEISKEDISKLDGAIKLGIQGVNVTVPYKERIMKYLDFISPAKRIGAVNTILMLYGYNTDYFGLDSMFKMDVQGKVAVILGTGGASKAALTYFIDSGIEKLYVSTRKKDDKKLLNSKAILIDYEELK--HIKGDIILNATPVGMYPGISPVSKSIIQNFDILIDLIYNPTEFLRIGNSMGKK-TCDGLYMLVGQAIKSQEIWQDTKIDN--SILDVIYN 262
13 -78.7001vi2_A mol:protein length:300 Shikimate 5-dehydrogenase 2  ali model follow..  29  12..IGLMAYPIRHSLSPEMQNKALEKAGLPFTYMAFEVDNDSFPGAIEGLKAKMRGTGVSMPNKQLACEYVDELTPAKLVGAINTIVYLRGYNTDGTGHIRAIKEDIKGKTMVLLGAGGASTAIGAQGAIEGLKEIKLFNRRDEKALAFAQRVNLADQQAFAEALASADILTNGTKVGMKPESLVNDISLLHPGLLVTECVYNPTKLLQQAQQAGCK-TIDGYGMLLWQGAEQFTLWTGKDFPLVKQVMGFGAE 291
14 -78.6001nvt_A mol:protein length:287 Shikimate 5`-dehydrogenase  ali model follow..  34  14..IGLIGHPVEHSFSPIMHNAAFKDKGLNYVYVAFDVLPENLKYVIDGAKAGIVGFNVTIPHKIEIMKYLDEIDKAQLIGAVNTIKKAIGYNTDGIGARMALEERVKDKNIVIYGAGGAARAVAFELA--KDNNIIIANRTVEKAEALAKEIAEVKFSGLDVDLDGVDIIINATPIGMYPNEPIVKAEKLREDMVVMDLIYNPTVLLKEAKKVNAK-TINGLGMLIYQGAVAFKIWTGVEPNIMKNAIIDKIT 286
15 -78.1003tnl_A mol:protein length:315 Shikimate dehydrogenase  ali model follow..  28  34..IGLIATPIRHSLSPTMHNEAFAKLGLDYVYLAFEVGDKELKDVVQGFRANLRGWNVSMPNKTNIHKYLDKLSPAELVGAVNTVVVLTGHITDGTGYMRALKEDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRKDDFYANAEKTVEIEDHEQLRKEIAESVIFTNATGVGMKPETLLPSADMLRPELIVSDVVYKPTRLLEIAEEQGCQ-TLNGLGMMLWQGAKAFEIWTHKEMPV--DYIKEIL. 308
16 -77.8002nlo_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  26  20..LGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDASGQDLKTLLDAALYGFNGLNITHPYKQAVLPLLDEVSEATQLGAVNTVVHTTGHNTDVSGFGRGMEENAKLDSVVQVGAGGVGNAVAYALVTHGVQKLQVADLDTSRAQALADVINGVDARGIEDVIAAADGVVNATPMGMPAHPTAFDVSCLTKDHWVGDVVYMPTELLKAARALGCE-TLDGTRMAIHQAVDAFRLFTGLEPDV--SRMRETFL 294
17 -77.7004p4g_A mol:protein length:277 Shikimate 5-dehydrogenase AroE (5-dehydroshikimate reductase)  ali model follow..  25  7.KAGVLGSPIAHSRSPQLHLAAYRALGLDWTYERIECGAAELPVVVGGFGPEWVGVSVTMPGKFAALRFADERTAADLVGSANTLVRWRADNTDIDGVAGALGA--AAGHALVLGSGGTAPAAVVGLAELGVTDITVVARNSDKAARLVDLGTAFDSGGLADAVAAAEVLVSTIPAEVAAG----YAGTLAAIPVLLDAIYDPTPLAAAVGSAGGR-VISGLQMLLHQAFAQVEQFTGLPAPR--EAMTCALA 266
18 -77.6003t4e_A mol:protein length:312 Quinate/shikimate dehydrogenase  ali model follow..  28  28..IGLMAYPIRHSLSPEMQNKALEKAGLPYTYMAFEVDNTTFASAIEGLKAKMRGTGVSMPNKQLACEYVDELTPAKLVGAINTIVYLRGYNTDGTGHIRAIKEDMRGKTMVLLGAGGAATAIGAQAAIEGIKEIKLFNRKFEKAVAFAKRVNLADQHAFTEALASADILTNGTKVGMKPESLIGDVSLLRPELLVTECVYNPTKLLQQAQQAGCK-TIDGYGMLLWQGAEQFELWTGKAFPL--DYVKQVMG 303
19 -76.9004xij_A mol:protein length:275 Shikimate 5-dehydrogenase  ali model follow..  25  9.KAAVLGSPITHSRSPQLHLAAYRALGLPSTYERIECTAEQLPGLVSALGPEWVGLSVTMPGKFAALEFADQRTDAQLVGSANTLVGWRADNTDVDGVTGALGT--AGDSALVIGSGGTAPAAVVALAELGVQRITIVARDEGKASRLVDLARDIGGAALADAVASADAAVSTIPADA----AAVYADALARVPRVLDAIYDPTPLAQAVEAAGGE-AINGLQMLLNQAFAQVEQFTGMPAPK--EAMRAAL. 268
20 -76.6001npy_A mol:protein length:271 Hypothetical shikimate 5-dehydrogenase-like protein HI0607  ali model follow..  24  8LCMSLSGRP--SNFGTTFHNYLYDKLGLNFIYKAFTT--QDIEHAIKGVRAGIRGCAVSMPFKETCMPFLDEIHPAQAIESVNTIVFLRAYNTDYIAIVKLIEKLNKNAKVIVHGSGGMAKAVVAAFKNSGFEKLKIYARNVKTGQYLAALYGYAYINSLE--NQQADILVNVTSIGMKGGDLAFPKAFIDNASVAFDVVAMPTPFIRYAQARGKQ-TISGAAVIVLQAVEQFELYTHQRPSLIAEAAAFART 269
21 -76.1004foo_A mol:protein length:271 Shikimate dehydrogenase  ali model follow..  24  5.SFGVFGNPIKHSKSPLIHNACFLTFQKELRFLGHYHPLPLESHIKSEFLHGLSGANVTLPFKERAFQVCDKIKGALECGAVNTLVELVGYNTDALGFYLSLKQK-NYQNALILGAGGSAKALACELKKQGL-QVSVLNRSSRGLDFFQ---RLGCDCFMEPPKSAFDLIINATSASLHNENKEVLKGYFKEGKLAYDLAYGFTPFLSLAKELKTP-FQDGKDMLIYKAALSFEKFSASQIPYAFEVMRSVFL 264
22 -75.4004fsh_A mol:protein length:271 Shikimate dehydrogenase  ali model follow..  25  5.SFGVFGNPIKHSKSPLIHNACFKKLGFLGHYRPILLPLES--HIKNEFLHGLSGANVTLPFKERAFQVCDKIKGALECASINTLVELVGYNTDALGFYLSLKHQ-NYQNALILGSGGSAKALACGLKKQGL-KVSVLNRSPRGLDFFQRLGCD---CFMEPPKSAFDLIINATSASLNNENKEVLKGYFKEAKLAYDLAYGFTPFLALAKELKIP-FQDGKDMLIYQASLSFEKFSASQIPYAFEVMRSVFL 264
23 -74.5004k28_A mol:protein length:269 Shikimate dehydrogenase family protein  ali model follow..  22  9..VAIVGSPIAQVKSPQNFNTWFNHNNCNLAMLPIDLHEAALDSFADTLRGNLRGCVVTVPYKQALANRVDGSERAAALGSINVIRRLLGDNVDGAGFLGAAHKEPAGKRALVIGCGGVGSAIAYALAEAGIASITLCDPSTARMGAVCELLGGLTVSTQFSGLEDFDLVANASPVGMGTRASAALLATLQPDTLVADVVTSPTPLLNRARQVGCR-IQTGPEMAFAQLG-HLGAFMGVTPL........... 267
24 -67.0002gpt_A mol:protein length:523 3-dehydroquinate dehydratase/ shikimate 5-dehydrogenase  ali model follow..  33  237..YGIIGKPVSHSKSPIVHNQAFKSVDFNGVYVHLLV--DNLVSFLQAYSSDFAGFSCTIPHKEAALQCCDEVDPAKSIGAVNTILKLLGYNTDCIGSISAIEDGLASKTVVVIGAGGAGKALAYGAKEKGA-KVVIANRTYERALELAEAIGGKALDLDNYHPEDGMVLANTTSMGMQPEETPISKDALKHYALVFDAVYTPTRLLREAEESGAI-TVSGSEMFVRQAYEQFEIFTGLPAPLYWQIMSKYGS 516
25 -63.8005swv_C mol:protein length:531 Pentafunctional AROM polypeptide  ali model follow..  24  252EKFFLFGKPIKHSRSPILHSTAYELLGLPHTYEAFET--DTVDEVQKVLNLDFGGANVTIPYKLSVMKFMDESDEARFFGAVNTIIVLRGDNTDWRGIYDTFANSLRDTNGLVIGAGGTSRAAIYSLHRLGVSRIYLLNRTLANSYRVQDVFPSDNIPSEELSSVTLSAVVSTIPADIELPEIKALLANKADGGVFLDMAYKPTPLMAVASDLEWK-CCNGLEALVRQGLASFHLWTGMTAPF--DAVYQKV. 529
26 -35.0004q39_A mol:protein length:260 PYLD, pyrrolysine synthase  ali model follow..  15  16.QLQKADSAVQEVTGLDIKGICKALYGTFSSSEKVGIVPGNFSASLHAI-TQYFGFDSFVTDMPDVSGYYEAVQNGAEI-AHNLKNGKMANNQPGIIYAEIASRKADSKDVLVVGLGKVGFPGAEHLVQKDF-RVYGYDADETLLERATSNLGIIP--FDPANPKKFSIIFEATPCAN-----TIPEAVLSENCVLSTPGIPCAISEELRDKYEVQLIAEGTASMLYSVL....................... 260
27 -16.9003oj0_A mol:protein length:144 Glutamyl-tRNA reductase  ali model follow..  17  14....................................................................................................DIVRKNGGNKILLVGNGMLASEIAPYFSYPQY-KVTVAGRNIDHVRAFAEKYEYVLINDIDSLIKNNDVIITATS----SKTPIVEERSLMPGKLFIDL...................................................... 109
28 -14.6003ic5_A mol:protein length:118 putative saccharopine dehydrogenase  ali model follow..  11  1.......................................................................................................SNAMRWNICVVGAGKIGQMIAALLKTSSNYSVTVADHDLAALAVLNRMVDAKDEAGLAKALGGFDAVISAAPFFLT---PIIAKAAKAAGAHYFDL...................................................... 99
29 -13.3005l76_A mol:protein length:497 Alpha-aminoadipic semialdehyde synthase, mitochondrial  ali model follow..  15  11..................................................................................ENLYFQSMALPDKYKYIQTLRESRERRKVLVLGSGYISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYNCKQEEKLGFLVAKQDLVISLLPYVLH---PLVAKACITNKVNMVTASYALKELEKSVEDAGITIIGEGLDMLAMESIDKAK................... 185
30 -12.9002axq_A mol:protein length:467 Saccharopine dehydrogenase  ali model follow..  19  5...................................................................................................GHIEGRHMGKNVLLLGSGFVAQPVIDTLAANDDINVTVACRTLANAQALAKPLDVTDDSALDKVLADNDVVISLIPYTFH---PNVVKSAIRTKTDVVTSSYALRELEPEIVKAGITVMNEGIHLYAVKTIDEVH................... 152
31 -12.2001gpj_A mol:protein length:404 GLUTAMYL-TRNA REDUCTASE  ali model follow..  17  79..........................................SEAVRHLFRVASGLESMMVGEQEILRQVKAYDRAARLGTLDEALKIVFRRAINLGLAERELGSLHDKTVLVVGAGEMGKTVAKSLVDRGVRAVLVANRTYERAVELARDLGAVRFDELVDHLARSDVVVSATAIHVDDVREALRKRDRRSPILIIDIVRTIDDLIARENLERRRKEIPKVEKLIEEELSTVEEE................. 321
32 -12.0003abi_A mol:protein length:365 Putative uncharacterized protein PH1688  ali model follow..  16  1..................................................................................................MNHKVIEGRHMKVLILGAGNIGRAIAWDLKDE--FDVYIGDVNNENLEKVKEFATPLKVDKLVEVMKEFELVIGALPGFLG---FKSIKAAIKSKVDMVDVSFNPLELRDEAEKAQVTIVFDGLNILMGRIFQELD................... 145
33 -11.6001e5l_A mol:protein length:450 SACCHAROPINE REDUCTASE  ali model follow..  19  4............................................................................................................KSVLMLGSGFVTRPTLDVLTDSG-IKVTVACRTLESAKKLSAGLDVNDDAALDAEVAKHDLVISLIPYTFH---ATVIKSAIRQKKHVVTTSYAMMELDQAAKDAGITVMNEGIHLYAIKTIEEVH................... 142
34 -11.6004n7r_A mol:protein length:472 Glutamyl-tRNA reductase 1, chloroplastic  ali model follow..  19  86...........HRGVKEVTEWMSKTSGIPVSEICQHRFLLYNKDATQHIFEVSAGLDSLVLGEGQILAQVQVVKVGQGVNGFGRNIKRVRTETNIASGAVSVSSSNVSARMCVIGAGKMGKLVIKHLMAKGCTKVVVVNRSEERVSAIREEMPYRPLDEMLACASEADVVFTSTAS----ENLPQASPEVGGLRHFVDIVYNVDDLVVAANKEDRMRKAMEAQTIITEESTQFEAW................. 365
35 -11.6003d4o_A mol:protein length:293 Dipicolinate synthase subunit A  ali model follow..  12  145.................................................................................................AIQHTDFTIHGANVAVLGLGRVGMSVARKFAALGAKVKVGARESDLLARIAEMGMEPFHISKAAQELRDVDVCINTIPALVVTANV---LAEMPSHTFVIDLASKPGGT-RYAEKRGIKALVPGLPGIVAPKTAGRILADVLVKLLAEPS...... 293
36 -11.0002rir_A mol:protein length:300 Dipicolinate synthase, A chain  ali model follow..  16  147.................................................................................................AIQHTDYTIHGSQVAVLGLGRTGMTIARTFAALGANVKVGARSSAHLARITEMGLVPFHTDELKEHVKDIDICINTIPSMILNQTV---LSSMTPKTLILDLASRP.................................................. 249
37 -10.4001lu9_A mol:protein length:287 Methylene Tetrahydromethanopterin Dehydrogenase  ali model follow..  15  4.........LLFQFDTDATPSVFDVVGADHITGYGNVTPDNVGAYVDGYTRGGKEKQST---GGDMAAGERVFEAVKKR-RVSCMLDSNGSNTTAAAGVALVVKSVKGKKAVVLAGGPVGMRSAALLAGEGA-EVVLCGRKLDKAQAAADSVNTADDASRAEAVKGAHFVFTAGAIGLE--LPQAAWQNESSIEIVADYNAQPPLGIGGIDATDKGKEYGGKRAFGALGIGGLKL.................. 256
38 -9.5904gmf_A mol:protein length:372 Yersiniabactin biosynthetic protein YbtU  ali model follow..  14  1.....................................................................................................MPSASPKQRVLIVGAKGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPLYTSPEQITGMPDIACIVVRSTVAGGATQLARHFLARGVHV--IQEHPSSLQTLAQEQGCCYWINTF............................... 127
39 -9.5203wyb_A mol:protein length:334 Meso-diaminopimelate D-dehydrogenase  ali model follow..  16  5.............................................................................................................RIGIVGYGNLGRGVEAAIQQNDMELVAVFTRRDPKTVAVKSNVKVLHVDDAQSYKDEIDVMILCGGLPEQGPYFAQYFNTIDSFDTHARIPDYFDAVNAAAEQSGKVAIIS................................. 120
40 -9.5005gz1_A mol:protein length:326 Meso-diaminopimelate D-dehydrogenase  ali model follow..  16  5.............................................................................................................RIGIVGYGNLGRGVEAAIQQNDMELVAVFTRRDPKTVAVKSNVKVLHVDDAQSYKDEIDVMILCGGLPEQGPYFAQYFNTIDSFDTHARIPDYFDAVNAAAEQSGKVAIIS................................. 120
41 -9.4605t57_A mol:protein length:296 Semialdehyde dehydrogenase NAD-binding protein  ali model follow..  15  11......................................................................................................RGSHMKEKIALFGAGGMGVRLAKNLLKSDY-RVSHVEVSEVGKKRLKDELG-LECVSTEAALDNVDVVILAVPDTIIGKIAAQIAPQLRPGTMVMTL...................................................... 106
42 -9.4404gmg_A mol:protein length:385 Yersiniabactin biosynthetic protein YbtU  ali model follow..  13  13...................................................................................................SHMPSASPKQRVLIVGAKGEMYLNAFMQPPEGLELVGLLAQGSARSRELAHAFGIPLYTSPEQITGMPDIACIVVRSTVAGGATQLARHFLARGVHV--IQEHPSSLQTLAQEQGCCYWINTF............................... 141
43 -9.4105ojl_A mol:protein length:298 Imine reductase  ali model follow..  15  1.....................................................................................................MATTTTTTKLTIFGLGAMGTAMATQFLKQG--TPTVWNRTAAKANPLVEQ-GAHLAATIPAAIAASPLLIFCLLDNAAVEQTLAAGPPSLAGKTILNL---TNGTPSQARRLATLASARGARYF............................ 119
44 -9.3704ina_A mol:protein length:405 saccharopine dehydrogenase  ali model follow..  16  2............................................................................................................AKVLQIGAGGVGGVVAHKMAMNRFSHITLASRTLSKCQEIAQSVDADSIEELVALINEVKPQIVLNIALPY--DLTIMEACLRTGVPYLDTYKEQWAFHDRYKEKGVMALLGGVNVFCAYAQKHYF................... 159
45 -9.3705g6r_A mol:protein length:295 IMINE REDUCTASE  ali model follow..  16  1..........................................................................................................MSKHIGIFGLGAMGTALAAKYLEHG--KTSVWNRTTAKAIPLVEQ-GAKLASTISEGVNANDLIIICLLNNQVVEDALRDALQTLPSKTIVNL---TNGTPNQARKLADFVTSHGARYI............................ 114
46 -9.2802ph5_A mol:protein length:480 Homospermidine synthase  ali model follow..  12  8......................................................................................................KKILFKNRFVILGFGCVGQALMPLIFEKKPSQVTIIAAEGTKVDVAQQYGVSFKLEVIGSTLEENDFLIDVSI-----SSLALIILCNQKGALYINAATEPWEVLRLKDKTQKTALITGLSHFIKEALLNIA................... 175
47 -9.2803d1l_A mol:protein length:266 Putative NADP oxidoreductase BF3122  ali model follow..  27  2...................................................................................................NAMKRSIEDTPIVLIGAGNLATNLAKALYRKGFRIVQVYSRTEESARELAQKVEAEYTTDLAEVNPYAKLYIVSLK.............................................................................. 77
48 -9.2403dtt_A mol:protein length:245 NADP oxidoreductase  ali model follow..  17  8......................................................................................................NLYFQGMKIAVLGTGTVGRTMAGALADLG-HEVTIGTRDPKATLARAEPDAMVHLAAFADVAAGAELVVNATEGASSIAALTAAGAENLAGKILVDIA..................................................... 118
49 -9.2304yte_A mol:protein length:194 H(2)-forming methylenetetrahydromethanopterin dehydrogenase-related protein MJ0715  ali model follow..  6...............................................................................................YGAGNQRLYLEQLKVPEKFGGEYGGAGMAIEFAKAG-HDVVLSEPNRDVMSDDLWDAGVKVVSDDIEAAKHGEIHVLFTPFGITLNIANTIIEHVPENAIICNTCTIPTPVLYRSLEGILRLKRRDVGIS............................ 141
50 -9.2103c24_A mol:protein length:286 Putative oxidoreductase  ali model follow..  16  1................................................................................................GMVKD-KNDVGPKTVAILGAGGKMGARITRKIHDSAHHLAAIEIAPEGRDRLQGM---IPLTDGDGWIDEADVVVLALPDNIIEKVAEDIVPRVRPGTIVLIL...................................................... 100
51 -9.1901edz_A mol:protein length:320 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE  ali model follow..  11  39LVGFLANNDPAAKMYATWTQKTSESMGFRYD-LRVIEDKDFLEEAIIQANGDVNGIMVYFPQDQYLQQVVCKEKDVEGLNHVYYQNLYHNVRCTPLAIVKILEFRLYGKKCIVINRS-VGRPLAALLANDGATVYSVDVNNIQKFTR-VEDLGEYSEDLLKKCSLDSDVVI----TGVPSENYKFPTEYIKEGAVCINFACTKNFSDDVKEKASLYVPMTGIAMLLRNMLRLVR................... 312
52 -9.1802i99_A mol:protein length:312 Mu-crystallin homolog  ali model follow..  17  88...........................................................VPSHQATVLLFE-PSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEFSFKEVRIWNRTKENAEKFADTVQVRVCSSVQEAVAGADVIITVTLVGARPDWRELDDELMKEAVLYVD....................................................... 248
53 -9.1704huj_A mol:protein length:220 Uncharacterized protein  ali model follow..  11  19.............................................................................................................TYAIIGAGAIGSALAERFTAAQIPAIIANSRGPASLSSVTDRFGASVKAVELKDALQADVVILAVPYDSIADIVTQVSDW--GGQIVVDAS..................................................... 107
54 -9.1604oqy_A mol:protein length:290 (S)-imine reductase  ali model follow..  16  1.........................................................................................................MSKQSVTVIGLGPMGQAMVNTFLDNG--EVTVWNRTASKAEALVAR-GAVLAPTVEDALSANELIVLSLTDYDAVYAILEPVTGSLSGKVIANL---SSDTPDKAREAAKWAAKHGAKHL............................ 115
55 -9.0802yjz_A mol:protein length:201 METALLOREDUCTASE STEAP4  ali model follow..  13  12....................................................................................................TVDSSEKQGVVCIFGTGDFGKSLGLKMLQCG--SVVFGSRNPQVSSLLPRGAEVLC---YSEAASRSDVIVLAVHREHYDFLAELADSL--KGRVLIDVS..................................................... 105
56 -9.0804bv8_A mol:protein length:335 THIOMORPHOLINE-CARBOXYLATE DEHYDROGENASE  ali model follow..  15  104...........................................................VPSHQASVLLFD-PSNGSLLAVMDGNVITAKRTAAVSAIATKLLKPPGSDVLCILGAGVQAYSHYEIFTEFSFKEVRMWNRTRENAEKFASTVQVRVCSSVQEAVTGADVIITVTMVGARPDWRELDDELMRQAVLYVD....................................................... 264

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.