current user: public

If you have questions about the server, please let us know.

Query: 3uhd_A mol:protein length:146 Globin-1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAALLast
1 -67.3003uhd_A mol:protein length:146 Globin-1  ali model  100  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
2 -67.2003uh6_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSIALMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
3 -67.2002r4x_A mol:protein length:146 Globin-1  ali model follow..  97  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGVSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
4 -67.2003ugz_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
5 -67.2003ugy_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNYIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
6 -67.2003uhc_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQAFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
7 -67.2003uhb_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITKKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
8 -67.1002auo_A mol:protein length:146 Globin I  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKYAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
9 -67.1003uhi_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
10 -67.1001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGNVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
11 -67.0002r4z_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVWGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
12 -67.0002grf_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALVTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
13 -62.0004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  54  4VAELANAVVSNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKTSPSAKGKFARLGDVSAGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKGNYFDEDTVAAWASLVAVVQAAL 152
14 -61.7004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  51  3.DAAVAKVCGSEAIKANLRRSWGVLSADIEATGLMLMSNLFTLRPDTKTYFTRLGDVQKGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKGNYYSDDVAGAWAALVGVVQAAL 150
15 -58.9004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  13  3...TLEAMQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMEENPETFQIFPWADASKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVEAKWSEEKKEAWLKAYGIITVMV 152
16 -57.5001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  16  4TQSFQSVGDLTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHNDPTAQRKFPQMAGLAELRTSRQMHAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKGVGFTKQVHDAWAKTFAIVQGVL 153
17 -57.4002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  25  1......XTTLTNPQKAAIRSSWSKFMDNGVSNGQGFYMDLFKAHPETLTPFKSLLTLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHNNRGIRASDLRTAYDILIHYMEHNHMVGGAKDAWEVFVGFICKTL 144
18 -57.0001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  23  4TLAIQAQGDLTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSQLRSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQGSDFNEKTRDAWAKAFSVVQAVL 153
19 -57.0003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  15  2.SSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKPEMWSPEMKNAWGVAYDQLVAAI 153
20 -56.7002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  16  1......GSHMERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEGPDFTPATRTAWSRLYGAVVQAM 147
21 -56.7001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  22  1.......XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAPPAGADAAWTKLFGLIIDAL 142
22 -56.7001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  15  1.....AFVGLSDSEEKLVRDAWAPIHGDLQGTANTVFYNYLKKYPSNQDKFETLKGHDEVKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIADMSGPHVARPITHGSYNDLRGVIYDSMH---LDSTHGAAWNKMMDNFFYVF 140
23 -56.6002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  16  4AEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLRYGVADGHFEVTGFALLETIKADMWSLEMKKAWAEAYSQLVAAI 157
24 -56.6002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  16  2.SAAEGAVVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEIAPSARQMFPFLRDSVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITTTLKRLGGTHLKYGVADGHFEVTRFALLETIKADMWGPEMRNAWGEAYDQLVAAI 154
25 -56.5001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  24  1........SLSAAEADLAGKSWAPVFANKNANGDAFLVALFEKFPDSANFFADFKGKADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAPPAGADAAWTKLFGLIIDAL 141
26 -56.4003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  24  1......SSGLTGPQKAALKSSWSRFMNNAVTNGTNFYMDLFKAYPDTLTPFKSLVSFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHHVEGSTKNAWEDFIAYICRVQ 144
27 -56.3003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  16  2.SSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKPEMWSPEMKNAWGEAYDQLVAAI 153
28 -56.2004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  15  1.........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEGPAFTPATRAAWSQLYGAVVQAM 144
29 -56.1001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  13  6.DNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKADMWSPAMKSAWSEAYDHLVAAI 158
30 -56.1001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  16  1.........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNGSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEGPAFTPATRAAWSQLYGAVVQAM 144
31 -55.6003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  16  3...SEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKPEMWSPEMKVAWGQAYDHLVAAI 152
32 -55.1001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  22  10IERRERSEELSEAERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEEMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAASDFPPETQRAWAKLRGLIYSHV 162
33 -54.4002lhb_A mol:protein length:149 HEMOGLOBIN V (CYANO MET)  ali model follow..  16  1PIVTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLDELKKSADVRWHAERIINAVDDAVASMDDTEKMSMKLRNLSGKHAKFQVDPEYFKVLAAVIADTVA------AGDAGFEKLMSMICILL 145
34 -54.4001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  12  1.......GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTEVPQNNPELQAHAGKVFKLVYEAAIQLEVTGVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKGAKWSEELNSAWTIAYDELAIVI 145
35 -54.4001f5o_A mol:protein length:149 HEMOGLOBIN V  ali model follow..  16  1PIVTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLDQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKFQVDPQYFKVLAAVIADTV------AAGDAGFEKLMSMICILL 145
36 -54.3002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  15  1.........MNSEEVNDIKRTWEVVAAKMTEAGVEMLKRYFKKYPHNLNHFPWFKEIDDLPENARFKTHGTRILRQVDEGVKALSGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCKLNEKQVHAYHKFFDRAYDIA 143
37 -54.1001uc3_A mol:protein length:149 Globin  ali model follow..  16  1PIVSGSVAPLSAAEKTKIRSAWAPVYSNYETSGVDILVKFFTSTPAAQEFFPKFKGMDQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKFQVDPQYFKVLAAVIADTV------AAGDAGFEKLMSMICILL 145
38 -53.7002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  23  1.........MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDPLEELSGNARFRAHAGRIIRVFDESIQVLGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTASSLDESQAATWAKLVDHVYAII 142
39 -53.3001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  15  1.......VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLAN-GVDPTNPKLTGHAEKLFALVRDSAGQLKASGTV-VADAALGSVHAQKAVTDPQFVVVKEALLKTIKGDKWSDELSRAWEVAYDELAAAI 140
40 -53.1001v5h_A mol:protein length:193 Cytoglobin  ali model follow..  22  13IERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAASDFPPETQRAWAKLRGLIYSHV 165
41 -53.1001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  18  1........SLEAAQKSNVTSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSY----GDEGAWTAVAGALMGEI 138
42 -52.9001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  18  1........SLSAAQKDNVTSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSY----GDEGAWTAVAGALMGEI 138
43 -52.9001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  18  1........SLSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSY----GDEGAWTAVAGALMGMI 138
44 -52.7002vyw_A mol:protein length:148 HEMOGLOBIN  ali model follow..  21  1.......AVLTQTQIDSILADLAHHTEHITEMGVSIYKTLFAAHPEYISYFSKLQGLDNVGQSEGIRYYGRTLGEELIRLLKAASNPSVLEERIVQGAKDHKARPVTKDQFTGAAPIFIKFFQGLLKKQEDKDAIEKFLLHVMQAI 144
45 -52.5004u8u_D mol:protein length:141 Globin d Chain  ali model follow..  17  1........DCSILELLKVKNQWREAGHHRVQFGLELWKRFFDTHPEVKGLFKGVNG--DNIYSPEFAAHAERVLSGLDMTIGLLDDTNAFKAQVTHLHSQHVERSINPEFYEHFLGALLHVLPKYLGTKLDQDAWTKCFHTIADGI 139
46 -52.4002d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  16  2.........CNRLEQILVKTQWAQSAENRAAFSRDLFSELFNIQGSSRALFSGVGV--DDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLDASNFAAMGQAVMSVVP-THLDCFNQHAWGECYERIASGI 138
47 -52.4001x9f_D mol:protein length:140 hemoglobin chain d1  ali model follow..  18  1........ECLVTESLKVKLQWASAAHERVAFGLELWRDIIDDHPEIKAPFSRVRG--DNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFGAWHDCVDQIIDGI 139
48 -52.3001it2_A mol:protein length:146 hemoglobin  ali model follow..  12  1PIIQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKVFKVDSIWFKELSSIFVSTI-------DGGAEFEKLFSIICILL 142
49 -52.2001x9f_B mol:protein length:145 Globin II, extracellular  ali model follow..  20  1......KKQCGVLEGLKVKSEWGRAGHDREAFSQAIWRATFAQVPESRSLFKRVHG--DDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGI 141
50 -52.1003wct_A mol:protein length:146 A1 globin chain of giant V2 hemoglobin  ali model follow..  17  1........DCNILQRLKVKMQWAKAGTERAKFGNSLWTSIFNYAPDARDLFKSVKS--EDMRSPQFKAHIARVIGGLDRVISMFDNEDALNADLEHLKSQHDPRGLDALNFVVFGKALFATVGGQFGVCFDLPAWESCYKVIAMGI 139
51 -52.1003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  17  1.......SECGPLQRLKVKRQWAEAGNGREEFGHFIWANVFKVAPSARDMFKRVRG--DNIYTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEGQNVFDK--DAWQACLDVITSGI 141
52 -52.1004jac_A mol:protein length:138 Dehaloperoxidase A  ali model follow..  11  2................GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDHSEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 132
53 -51.8002qfn_A mol:protein length:138 Dehaloperoxidase A  ali model follow..  10  2................GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDHTEKVFNLMMEVADRATDSVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 132
54 -51.8005oja_A mol:protein length:163 Myoglobin  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPEILEKFDDLKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHPGDFGADAQGAMNKALELFRKDI 143
55 -51.7004u8u_B mol:protein length:142 Globin b Chain  ali model follow..  17  1.......SECDVLTRLKVKAQWRRAYSNREDFAQAIWRALFAQVPDSRTLFKRVHG--HDTTSPEFQAHALRVLAGFDIAISTLDQPDALKAELDHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRCWDKDAWSACFDHIAHGI 140
56 -51.7002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  16  1........DCTSLNRLLVKRQWAEAGTNRELLGNRIWEDLFANMPDARGLFSRVNG--NDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRAT--RSFDNDAWNSCMNQIVSGI 140
57 -51.6003ixf_A mol:protein length:137 Dehaloperoxidase B  ali model follow..  2.................FKQDIATLRGDLRTYAQDIFLAFLNKYPDEKRNFKNYVGKQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDASTLVQMKQHSGLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
58 -51.5005ojc_A mol:protein length:163 Myoglobin  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDTLIRLFKSHPEILEKFDGLKHLAEMKASEDLKEHGVTLLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKHLEFFSEAIIHVLHPGDFGADAQGAMNKALELFRTDI 143
59 -51.5005v5r_B mol:protein length:137 Dehaloperoxidase A  ali model follow..  10  2.................FKQDIATLRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
60 -51.5003mym_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  10  1................GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQEKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
61 -51.5005ycg_A mol:protein length:157 Ancestral myoglobin aMbWp of Pakicetus relative  ali model follow..  19  2.....SHMGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLDEMKASEDLKKHGNTVLTALGGILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISDAIIHVLQPGDFGADAQGAMNKALELFRNDI 146
62 -51.5001obm_A mol:protein length:154 MYOGLOBIN  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLAEMKASEDLKKQGVTFLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPGNFGADAQGAMNKALELFRKDI 143
63 -51.4003oj1_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  10  2.................FKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDDTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
64 -51.4005oj9_A mol:protein length:163 Myoglobin  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPGDFGADAQGAMNKALELFRKDI 143
65 -51.3001kfr_A mol:protein length:147 Hemoglobin  ali model follow..  18  1........TLTKHEQDILLKELGPHPAHIVETGLGAYHALFTAHPQYISHFSRLEGHENVMQSDGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVADAEGKAAVEKFLKHVFPMM 143
66 -51.3001yhu_A mol:protein length:145 hemoglobin A1 chain  ali model follow..  17  1........ACAMLERAKVKDEWAKAGAARSKFGDALWRNVFNYAPNARDIFESVNS--KDMASPEFKAHIARVLGGLDRVISMLDNQATLDADLAHLKSQHDPRTIDPVNFVVFRKALIATVAGTFGVCFDVPAWQGCYNIIAKGI 139
67 -51.3001x46_A mol:protein length:150 hemoglobin component VII  ali model follow..  14  3.....TWVDMEAGDIALVKSSWAQIHDK----EVDILYNFFKSYPASQAKFSAFAGKESLKDTAPFALHATRIVSVINEAIALMENRPALKNVLKQQGINHKGRGVTAAHFEEFETALEAFLEASGYNAGTKKAWDSAFNNMYSVV 146
68 -51.3001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  17  2.......YVCGPLQRLKVKRQWAEAGNSREEFGHFIWSHVFQHSPAARDMFKRVRG--DNIHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVEGSEVFDQ--DAWKPCLNVITNGI 142
69 -51.3003k3u_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  10  2.................FKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDHTEKWFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
70 -51.3004lpi_A mol:protein length:154 Myoglobin  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIHIRLFKSHPETLEKYDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPGDFGADAQGAMNKALELFRKDI 143
71 -51.200101m_A mol:protein length:154 MYOGLOBIN  ali model follow..  21  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPGNFGADAQGAMNKALELFRKDI 143
72 -51.2002w6x_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLAEMKASEDLKKQGVRVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHPGDFGADAQGAMNKALELFRKDI 143
73 -51.2002oha_A mol:protein length:154 Myoglobin  ali model follow..  21  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPGNFGADAQGAMNKALELWRKDI 143
74 -51.2001h1x_A mol:protein length:154 MYOGLOBIN  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVRVLTALGAILKKKGH---HEAELKPLAQDHAKHKIPIKYLEFISEAIIHVLHPGNFGADAQGAMNKALELFRKDI 143
75 -51.2006bmg_A mol:protein length:154 Myoglobin  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADIAGHGQDILIRLFKHHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPADFGADAQGAMSKALELFRKDI 143

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.