current user: public

If you have questions about the server, please let us know.

Query: 3uhi_A mol:protein length:146 Globin-1, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAALLast
1 -67.2003uhi_A mol:protein length:146 Globin-1  ali model  100  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
2 -67.2003uhb_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITKKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
3 -67.2003ugy_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNYIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
4 -67.2002auo_A mol:protein length:146 Globin I  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKYAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
5 -67.2003uh6_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSIALMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
6 -67.2001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGNVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
7 -67.1003ugz_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
8 -67.1003uhd_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
9 -67.1002r4x_A mol:protein length:146 Globin-1  ali model follow..  97  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGVSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
10 -67.1003uhc_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQAFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
11 -67.1002grf_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALVTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
12 -67.0002r4z_A mol:protein length:146 Globin-1  ali model follow..  98  1PSVYDAAAQLTADVKKDLRDSWKVWGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL 146
13 -61.8004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  54  4VAELANAVVSNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKTSPSAKGKFARLGDVSAGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKGNYFDEDTVAAWASLVAVVQAAL 152
14 -61.6004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  51  3.DAAVAKVCGSEAIKANLRRSWGVLSADIEATGLMLMSNLFTLRPDTKTYFTRLGDVQKGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKGNYYSDDVAGAWAALVGVVQAAL 150
15 -58.8004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  13  3...TLEAMQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMEENPETFQIFPWADASKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVEAKWSEEKKEAWLKAYGIITVMV 152
16 -57.4001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  16  4TQSFQSVGDLTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHNDPTAQRKFPQMAGLAELRTSRQMHAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKGVGFTKQVHDAWAKTFAIVQGVL 153
17 -57.3002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  25  1......XTTLTNPQKAAIRSSWSKFMDNGVSNGQGFYMDLFKAHPETLTPFKSLLTLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHNNRGIRASDLRTAYDILIHYMEHNHMVGGAKDAWEVFVGFICKTL 144
18 -57.0001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  23  4TLAIQAQGDLTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSQLRSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQGSDFNEKTRDAWAKAFSVVQAVL 153
19 -56.9003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  16  2.SSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKPEMWSPEMKNAWGVAYDQLVAAI 153
20 -56.6001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  22  1.......XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAPPAGADAAWTKLFGLIIDAL 142
21 -56.6002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  16  1......GSHMERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEGPDFTPATRTAWSRLYGAVVQAM 147
22 -56.5001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  15  1.....AFVGLSDSEEKLVRDAWAPIHGDLQGTANTVFYNYLKKYPSNQDKFETLKGHDEVKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIADMSGPHVARPITHGSYNDLRGVIYDSMH---LDSTHGAAWNKMMDNFFYVF 140
23 -56.5002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  17  4AEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLRYGVADGHFEVTGFALLETIKADMWSLEMKKAWAEAYSQLVAAI 157
24 -56.5002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  17  2.SAAEGAVVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEIAPSARQMFPFLRDSVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITTTLKRLGGTHLKYGVADGHFEVTRFALLETIKADMWGPEMRNAWGEAYDQLVAAI 154
25 -56.4001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  24  1........SLSAAEADLAGKSWAPVFANKNANGDAFLVALFEKFPDSANFFADFKGKADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAPPAGADAAWTKLFGLIIDAL 141
26 -56.2003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  23  1......SSGLTGPQKAALKSSWSRFMNNAVTNGTNFYMDLFKAYPDTLTPFKSLVSFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHHVEGSTKNAWEDFIAYICRVQ 144
27 -56.2003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  17  2.SSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSPPLEQNPKLKPHAMTVFVMTCESAVQLRKAGKRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKPEMWSPEMKNAWGEAYDQLVAAI 153
28 -56.1004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  15  1.........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEGPAFTPATRAAWSQLYGAVVQAM 144
29 -56.0001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  14  6.DNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKADMWSPAMKSAWSEAYDHLVAAI 158
30 -56.0001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  16  1.........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNGSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEGPAFTPATRAAWSQLYGAVVQAM 144
31 -55.5003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  16  3...SEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSPPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKPEMWSPEMKVAWGQAYDHLVAAI 152
32 -55.0001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  21  10IERRERSEELSEAERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMEEMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAASDFPPETQRAWAKLRGLIYSHV 162
33 -54.5002lhb_A mol:protein length:149 HEMOGLOBIN V (CYANO MET)  ali model follow..  15  1PIVTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLDELKKSADVRWHAERIINAVDDAVASMDDTEKMSMKLRNLSGKHAKFQVDPEYFKVLAAVIADTV------AAGDAGFEKLMSMICILL 145
34 -54.4001f5o_A mol:protein length:149 HEMOGLOBIN V  ali model follow..  16  1PIVTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQEFFPKFKGLDQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKFQVDPQYFKVLAAVIADTV------AAGDAGFEKLMSMICILL 145
35 -54.3002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  14  1.........MNSEEVNDIKRTWEVVAAKMTEAGVEMLKRYFKKYPHNLNHFPWFKEIDDLPENARFKTHGTRILRQVDEGVKALSGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCKLNEKQVHAYHKFFDRAYDIA 143
36 -54.3001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  12  1.......GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTEVPQNNPELQAHAGKVFKLVYEAAIQLEVTGVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKGAKWSEELNSAWTIAYDELAIVI 145
37 -54.2001uc3_A mol:protein length:149 Globin  ali model follow..  16  1PIVSGSVAPLSAAEKTKIRSAWAPVYSNYETSGVDILVKFFTSTPAAQEFFPKFKGMDQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRDLSGKHAKFQVDPQYFKVLAAVIADTV------AAGDAGFEKLMSMICILL 145
38 -53.6002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  22  1.........MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRDPLEELSGNARFRAHAGRIIRVFDESIQVLGDLEKLDEIWTKIAVSHIPRTVSKESYNQLKGVILDVLTASSLDESQAATWAKLVDHVYAII 142
39 -53.2001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  15  1.......VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLAN-GVDPTNPKLTGHAEKLFALVRDSAGQLKASGTV-VADAALGSVHAQKAVTDPQFVVVKEALLKTIKGDKWSDELSRAWEVAYDELAAAI 140
40 -53.1001v5h_A mol:protein length:193 Cytoglobin  ali model follow..  21  13IERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAASDFPPETQRAWAKLRGLIYSHV 165
41 -53.0001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  19  1........SLEAAQKSNVTSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSY----GDEGAWTAVAGALMGEI 138
42 -52.9001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  19  1........SLSAAQKDNVTSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSY----GDEGAWTAVAGALMGEI 138
43 -52.8001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  19  1........SLSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSY----GDEGAWTAVAGALMGMI 138
44 -52.6002vyw_A mol:protein length:148 HEMOGLOBIN  ali model follow..  21  1.......AVLTQTQIDSILADLAHHTEHITEMGVSIYKTLFAAHPEYISYFSKLQGLDNVGQSEGIRYYGRTLGEELIRLLKAASNPSVLEERIVQGAKDHKARPVTKDQFTGAAPIFIKFFQGLLKKQEDKDAIEKFLLHVMQAI 144
45 -52.6004u8u_D mol:protein length:141 Globin d Chain  ali model follow..  17  1........DCSILELLKVKNQWREAGHHRVQFGLELWKRFFDTHPEVKGLFKGVNG--DNIYSPEFAAHAERVLSGLDMTIGLLDDTNAFKAQVTHLHSQHVERSINPEFYEHFLGALLHVLPKYLGTKLDQDAWTKCFHTIADGI 139
46 -52.5002d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  16  2.........CNRLEQILVKTQWAQSAENRAAFSRDLFSELFNIQGSSRALFSGVGV--DDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLDASNFAAMGQAVMSVVP-THLDCFNQHAWGECYERIASGI 138
47 -52.4001x9f_D mol:protein length:140 hemoglobin chain d1  ali model follow..  18  1........ECLVTESLKVKLQWASAAHERVAFGLELWRDIIDDHPEIKAPFSRVRG--DNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFGAWHDCVDQIIDGI 139
48 -52.4001it2_A mol:protein length:146 hemoglobin  ali model follow..  12  1PIIQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKVFKVDSIWFKELSSIFVSTI-------DGGAEFEKLFSIICILL 142
49 -52.3001x9f_B mol:protein length:145 Globin II, extracellular  ali model follow..  20  1......KKQCGVLEGLKVKSEWGRAGHDREAFSQAIWRATFAQVPESRSLFKRVHG--DDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGI 141
50 -52.2003wct_A mol:protein length:146 A1 globin chain of giant V2 hemoglobin  ali model follow..  17  1........DCNILQRLKVKMQWAKAGTERAKFGNSLWTSIFNYAPDARDLFKSVKS--EDMRSPQFKAHIARVIGGLDRVISMFDNEDALNADLEHLKSQHDPRGLDALNFVVFGKALFATVGGQFGVCFDLPAWESCYKVIAMGI 139
51 -52.1003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  17  1.......SECGPLQRLKVKRQWAEAGNGREEFGHFIWANVFKVAPSARDMFKRVRG--DNIYTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEGQNVFDK--DAWQACLDVITSGI 141
52 -52.0004jac_A mol:protein length:138 Dehaloperoxidase A  ali model follow..  11  2................GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDHSEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 132
53 -51.8004u8u_B mol:protein length:142 Globin b Chain  ali model follow..  17  1.......SECDVLTRLKVKAQWRRAYSNREDFAQAIWRALFAQVPDSRTLFKRVHG--HDTTSPEFQAHALRVLAGFDIAISTLDQPDALKAELDHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRCWDKDAWSACFDHIAHGI 140
54 -51.7002qfn_A mol:protein length:138 Dehaloperoxidase A  ali model follow..  10  2................GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDHTEKVFNLMMEVADRATDSVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 132
55 -51.6005oja_A mol:protein length:163 Myoglobin  ali model follow..  19  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPEILEKFDDLKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHPGDFGADAQGAMNKALELFRKDI 143
56 -51.6002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  17  1........DCTSLNRLLVKRQWAEAGTNRELLGNRIWEDLFANMPDARGLFSRVNG--NDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRAT--RSFDNDAWNSCMNQIVSGI 140
57 -51.6005v5r_B mol:protein length:137 Dehaloperoxidase A  ali model follow..  10  2.................FKQDIATLRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
58 -51.5003mym_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  10  1................GFKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQEKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
59 -51.5003ixf_A mol:protein length:137 Dehaloperoxidase B  ali model follow..  2.................FKQDIATLRGDLRTYAQDIFLAFLNKYPDEKRNFKNYVGKQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDASTLVQMKQHSGLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
60 -51.4005ojc_A mol:protein length:163 Myoglobin  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDTLIRLFKSHPEILEKFDGLKHLAEMKASEDLKEHGVTLLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKHLEFFSEAIIHVLHPGDFGADAQGAMNKALELFRTDI 143
61 -51.4001yhu_A mol:protein length:145 hemoglobin A1 chain  ali model follow..  17  1........ACAMLERAKVKDEWAKAGAARSKFGDALWRNVFNYAPNARDIFESVNS--KDMASPEFKAHIARVLGGLDRVISMLDNQATLDADLAHLKSQHDPRTIDPVNFVVFRKALIATVAGTFGVCFDVPAWQGCYNIIAKGI 139
62 -51.4001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  17  2.......YVCGPLQRLKVKRQWAEAGNSREEFGHFIWSHVFQHSPAARDMFKRVRG--DNIHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVEGSEVFDQ--DAWKPCLNVITNGI 142
63 -51.4003oj1_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  10  2.................FKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDDTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
64 -51.3005ycg_A mol:protein length:157 Ancestral myoglobin aMbWp of Pakicetus relative  ali model follow..  19  1....GSHMGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLDEMKASEDLKKHGNTVLTALGGILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISDAIIHVLQPGDFGADAQGAMNKALELFRNDI 146
65 -51.3003k3u_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  10  2.................FKQDIATIRGDLRTYAQDIFLAFLNKYPDERRYFKNYVGKQELKSMAKFGDHTEKWFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
66 -51.3001kfr_A mol:protein length:147 Hemoglobin  ali model follow..  18  1........TLTKHEQDILLKELGPHPAHIVETGLGAYHALFTAHPQYISHFSRLEGHENVMQSDGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVADAEGKAAVEKFLKHVFPMM 143
67 -51.3001obm_A mol:protein length:154 MYOGLOBIN  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLAEMKASEDLKKQGVTFLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPGNFGADAQGAMNKALELFRKDI 143
68 -51.2001x46_A mol:protein length:150 hemoglobin component VII  ali model follow..  14  3.....TWVDMEAGDIALVKSSWAQIHDK----EVDILYNFFKSYPASQAKFSAFAGKESLKDTAPFALHATRIVSVINEAIALMENRPALKNVLKQQGINHKGRGVTAAHFEEFETALEAFLEASGYNAGTKKAWDSAFNNMYSVV 146
69 -51.2005oj9_A mol:protein length:163 Myoglobin  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPGDFGADAQGAMNKALELFRKDI 143
70 -51.2004kmw_A mol:protein length:137 Dehaloperoxidase A  ali model follow..  10  2.................FKQDIATIRGDLRTYAQDIFLAFLNKYPDERRNFKNYVGKQELKSMAKFGDHTEKVFNLMMEVADRATDCVPLASDANTLVQMKQHSSLTTGNFEKLFVALVEYMR-ASGQSFDSQSWDRFGKNLVSAL 131
71 -51.1004lpi_A mol:protein length:154 Myoglobin  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIHIRLFKSHPETLEKYDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPGDFGADAQGAMNKALELFRKDI 143
72 -51.1002w6x_A mol:protein length:154 MYOGLOBIN  ali model follow..  18  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLAEMKASEDLKKQGVRVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHPGDFGADAQGAMNKALELFRKDI 143
73 -51.100101m_A mol:protein length:154 MYOGLOBIN  ali model follow..  21  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPGNFGADAQGAMNKALELFRKDI 143
74 -51.0002oha_A mol:protein length:154 Myoglobin  ali model follow..  21  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHPGNFGADAQGAMNKALELWRKDI 143
75 -51.0001h1x_A mol:protein length:154 MYOGLOBIN  ali model follow..  20  1.......MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVRVLTALGAILKKKGH---HEAELKPLAQDHAKHKIPIKYLEFISEAIIHVLHPGNFGADAQGAMNKALELFRKDI 143

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.