current user: public

If you have questions about the server, please let us know.

Query: 3wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst SECGPLQRLKVKRQWAEAYGSGNGREEFGHFIWANVFKVAPSARDMFKRVRGDNIYTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDKDAWQACLDVITSGIQGNLast
1 -67.8003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model  100  1SECGPLQRLKVKRQWAEAYGSGNGREEFGHFIWANVFKVAPSARDMFKRVRGDNIYTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDKDAWQACLDVITSGIQGN 144
2 -66.1001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  79  2YVCGPLQRLKVKRQWAEAYGSGNSREEFGHFIWSHVFQHSPAARDMFKRVRGDNIHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGIQG. 144
3 -65.1002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  51  1.DCTSLNRLLVKRQWAEAYGEGTNRELLGNRIWEDLFANMPDARGLFSRVNGNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGISG. 142
4 -62.9004u8u_D mol:protein length:141 Globin d Chain  ali model follow..  42  1.DCSILELLKVKNQWREAFGEGHHRVQFGLELWKRFFDTHPEVKGLFKGVNGDNIYSPEFAAHAERVLSGLDMTIGLLDDTNAFKAQVTHLHSQHVERSINPEFYEHFLGALLHVLPKYLGTKLDQD-AWTKCFHTIADGIKG. 141
5 -62.8004u8u_B mol:protein length:142 Globin b Chain  ali model follow..  40  1SECDVLTRLKVKAQWRRAYSHGHNREDFAQAIWRALFAQVPDSRTLFKRVHGHDTTSPEFQAHALRVLAGFDIAISTLDQPDALKAELDHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRCWDKD-AWSACFDHIAHGIKG. 142
6 -62.3003wct_A mol:protein length:146 A1 globin chain of giant V2 hemoglobin  ali model follow..  45  1.DCNILQRLKVKMQWAKAYGFGTERAKFGNSLWTSIFNYAPDARDLFKSVKSEDMRSPQFKAHIARVIGGLDRVISMFDNEDALNADLEHLKSQHDPRGLDALNFVVFGKALFATVGGQFGVCFDLP-AWESCYKVIAMGITGN 142
7 -62.1001x9f_D mol:protein length:140 hemoglobin chain d1  ali model follow..  39  1.ECLVTESLKVKLQWASAFGHAHERVAFGLELWRDIIDDHPEIKAPFSRVRGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFG-AWHDCVDQIIDGIK.. 140
8 -62.0001x9f_B mol:protein length:145 Globin II, extracellular  ali model follow..  42  2KQCGVLEGLKVKSEWGRAYGSGHDREAFSQAIWRATFAQVPESRSLFKRVHGDDTSHPAFIAHADRVLGGLDIAISTLDQPATLKEELDHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDRE-AWDACIDHIEDGIKGH 144
9 -61.2001yhu_A mol:protein length:145 hemoglobin A1 chain  ali model follow..  42  1.ACAMLERAKVKDEWAKAYGIGAARSKFGDALWRNVFNYAPNARDIFESVNSKDMASPEFKAHIARVLGGLDRVISMLDNQATLDADLAHLKSQHDPRTIDPVNFVVFRKALIATVAGTFGVCFDVP-AWQGCYNIIAKGITGS 142
10 -60.8002d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  35  2..CNRLEQILVKTQWAQSYGEAENRAAFSRDLFSELFNIQGSSRALFSGVGVDDMNSAAFTAHCLRVTGALNRLISQLDQQATINADLAHLAGQHASRNLDASNFAAMGQAVMSVVPTHLDCF--NQHAWGECYERIASGISG. 140
11 -56.9002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  20  2SHMERPESELIRQSWRVV---SRSPLEHGTVLFARLFALEPSLLPLFQYNGEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATAWSRLYGAVVQAMSRG 150
12 -56.7004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  21  11VVSNADQKDLLRMSWGVL---SVDMEGTGLMLMANLFKTSPSAKGKFARLGDAGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDAAWASLVAVVQAAL... 152
13 -56.3001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  19  1..MERPEPELIRQSWRAV---SRSPLEHGTVLFARLFALEPDLLPLFQYNGEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTPAAAWSQLYGAVVQAMSRG 147
14 -56.2004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  19  1..MERPEPELIRQSWRAV---SRSPLEHGTVLFARLFALEPDLLPLFQYNCEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPAAAWSQLYGAVVQAMSRG 147
15 -56.1004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  20  9VCGSEAIKANLRRSWGVL---SADIEATGLMLMSNLFTLRPDTKTYFTRLGQKGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDGAWAALVGVVQAAL... 150
16 -56.1001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  16  1.SLSAAEADLAGKSWAPV---FANKNANGDAFLVALFEKFPDSANFFADFKADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAA 144
17 -55.9001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  15  1XSLSAAEADLAGKSWAPV---FANKNANGLDFLVALFEKFPDSANFFADFKADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAA 145
18 -55.6001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  23  1GALTESQAALVKSSWEEF---NANIPKHTHRFFILVLEIAPAAKDLFSFLKEVPQNNPELQAHAGKVFKLVYEAAIQLEVTGVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEESAWTIAYDELAIVIKKE 148
19 -55.6003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  20  8KVFTEEQEALVVKAWAVM---KKNSAELGLQFFLKIFEIAPSAKNLFSYLKDPLEQNPKLKPHATTVFVMTCESAVQLRKAGVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSPENAWGVAYDQLVAAIKFE 156
20 -55.4002vyw_A mol:protein length:148 HEMOGLOBIN  ali model follow..  15  1AVLTQTQIDSILADLAHHTDTTEHITEMGVSIYKTLFAAHPEYISYFSKLQDNVGQSEGIRYYGRTLGEELIRLLKAASNPSVLEERIVQGAKDHKARPVTKDQFTGAAPIFIKFFQGLLKKQED-KDAIEKFLLHVMQAIAAK 147
21 -55.2004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  14  7MQVSEEQQSLIMEDVQVL---LPNYDDFVEDVLQQFMEENPETFQIFPWADKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSEA-EKKEAWLKAYGIITVMVT.. 153
22 -55.1001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  19  1.GLSAAQRQVIAATWKDIAG-ADNGAGVGKKCLIKFLSAHPQMAAVFGFSGA---SDPGVAALGAKVLAQIGVAVSHLGDEGKMVAQMKAVGVRHKGYGIKAQYFEPLGASLLSAMEHRIGGKMNAADAWAAAYADISGALISG 144
23 -55.0004u8u_C mol:protein length:151 Globin c Chain  ali model follow..  28  4.CCSAEDRNIVQKQWSVLWGDTESSIAFGRLILTKLAKEIPEVKELFNKVDIDNPEGGPFSAHCLRILNALDMSINLMDDPEALDSALDHLADQHHDRGVKKAHFKKIAEILHTGLQQVLDDYNAL--SWKSCFKGILGKIASK 148
24 -55.0004u8u_A mol:protein length:150 Globin a chain  ali model follow..  24  3DCCSAEDRREIQHIWDTVWSFTDRKVAIAGAVFKDLFHHYPSAKGLFERVKVAEPDSGEYHSHLVRVANGLDLLINLFQDTQVLDKQLAHLAEQHILKGVTQQFFKGIGESFARVFPQVSSC--FNLEAWNRCFHTLADRISRD 147
25 -55.0003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  20  2SGLTGPQKAALKSSWSRF---MNNAVTNGTNFYMDLFKAYPDTLTPFKSLFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHCHVEGSTKNAWEDFIAYICRVQGDF 147
26 -54.9003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  20  8KVFTEEQEALVVKSWAVM---KKNSAELGLKFFLKIFEIAPSAKNLFSYLKDPLEQNPKLKPHAMTVFVMTCESAVQLRKAGVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPENAWGEAYDQLVAAIKSE 156
27 -54.7001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  19  1.GLSAAQRQVVASTWKDIAG-ADNGAGVGKECLSKFISAHPEMAAVFGFSGA---SDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAADAWAAAYGDISGALISG 144
28 -54.7001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  18  1.GLSAAQRQVVASTWKDIAG-SDNGAGVGKECFTKFLSAHHDMAAVFGFSGA---SDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAADAWAAAYADISGALISG 144
29 -54.4001yhu_C mol:protein length:148 hemoglobin B1a chain  ali model follow..  31  2ANCADAAAAIVQAQWEDVWSAAASRVSAGEEVFAALFKMVPAAKNLFTRVNVADINSPEFQGHVVRVMGGLDILINALDDIPTLESMLDHLAGQHAVRGVTGAGFQLMATVLMESLPQVVEGF--NPDAWASCLAGIAAAISSA 147
30 -54.4003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  21  7IVFTEEQEALVVKSWSVM---KKNSAELGLKLFIKIFEIAPTTKKMFSFLRDPAEQNPKLKPHAMSVFVMCCESAVQLRKTGVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSPEVAWGQAYDHLVAAIKAE 155
31 -54.3001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  25  11GDLTLAQKKIVRKTWHQL---MRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGQLRSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKDAWAKAFSVVQAVLLVK 156
32 -54.3001kfr_A mol:protein length:147 Hemoglobin  ali model follow..  10  1.TLTKHEQDILLKELGPHVDTPAHIVETGLGAYHALFTAHPQYISHFSRLEENVMQSDGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVADAEGKA-AVEKFLKHVFPMMAAE 146
33 -54.3002d2m_C mol:protein length:147 Giant hemoglobin, B2(c) globin chain  ali model follow..  32  2SCCSSEDRANVMHNWDAAWSYSDRRVALAQAVFASLFSRDAAAQGLFSGVSADNPDSADFRAHCVRVVNGLDVAINMLNDPAVLNEQLAHLSAQHQARGVAAAHFDVMAEAFAEVMPQVSSCF--SSDSWNRCFARIANGISAG 146
34 -54.3001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  18  2.AFTEKQDALVSSSFEAF---KANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDTNPKLTGHAEKLFALVRDSAGQLKASGTV-VADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDERAWEVAYDELAAAIKKA 143
35 -54.2001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  20  11GDLTPAEKDLIRSTWDQL---MTHRTGFVADVFIRIFHNDPTAQRKFPQMAGELRTSRQMHAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTKQDAWAKTFAIVQGVLITK 156
36 -54.2001yhu_D mol:protein length:149 hemoglobin B2 chain  ali model follow..  27  2ASCTTEDRREMQLMWGNVWSFTGRRIAIAQAVFKDLFANVPDAVGLFGAVKGDEVNSNEFKAHCIRVVNGLDSSIGLLSDPATLNEQLSHLATQHKARGVTKGGFSAIAQSFLRVMPQ-VASCFNPD-AWSRCFNRITTGMTEP 146
37 -54.2001h97_A mol:protein length:147 GLOBIN-3  ali model follow..  10  1.TLTKHEQDILLKELGPHVDTPAHIVETGLGAYHALFTAHPQYISHFSRLEENVMQSEGIKHYARTLTEAIVHMLKEISNDAEVKKIAAQYGKDHTSRKVTKDEFMSGEPIFTKYFQNLVKDAEGKAKFLKHVFPMMAAEI... 147
38 -53.9002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  18  2TTLTNPQKAAIRSSWSKF---MDNGVSNGQGFYMDLFKAHPETLTPFKSLLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHNNRGIRASDLRTAYDILIHYMEDHNHMVGGAKDAWEVFVGFICKTLGDY 147
39 -53.8003wct_C mol:protein length:150 B2 globin chain of giant V2 hemoglobin  ali model follow..  29  3NSCTTEDRREMQLMWANVWSFTGRRLAIAQAVFKDLFAHVPDAVGLFDRVHGTEIDSSEFKAHCIRVVNGLDSAIGLLSDPSTLNEQLSHLATQHQERGVTKGGFSAIAQSFLRVMPQ-VASCFNPD-AWSRCFNRITNGMTEG 147
40 -53.7001x9f_C mol:protein length:153 Globin III, extracellular  ali model follow..  30  7..CSEEDHRIVQKQWDILWRSSKIKIGFGRLLLTKLAKDIPEVNDLFKRVDIEHAEGPKFSAHALRILNGLDLAINLLDDPPALDAALDHLAHQHEVEGVQKAHFKKFGEILATGLPQVLDDYD--ALAWKSCLKGILTKISSR 150
41 -53.3001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  21  1.SLEAAQKSNVTSSWAKA---SAAWGTAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGD----EGAWTAVAGALMGEIEPD 141
42 -53.3001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  22  1.SLSAAQKDNVKSSWAKA---SAAWGTAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGD----EGAWTAVAGALMGMIRPD 141
43 -53.3001x9f_A mol:protein length:151 Globin IV, extracellular  ali model follow..  27  5DCCSYEDRREIRHIWDDVWSFTDRRVAIVRAVFDDLFKHYPTSKALFERVKIDEPESGEFKSHLVRVANGLKLLINLLDDTLVLQSHLGHLADQHIQRGVTKEYFRGIGEAFARVLPQVLSCF--NVDAWNRCFHRLVARIAKD 149
44 -53.2001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  22  1.SLSAAQKDNVTSSWAKA---SAAWGTAGPEFFMALFDAHDDVFAKFSGLKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGD----EGAWTAVAGALMGEIEPN 141
45 -53.2001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  22  12VSFSEEQEALVLKSWAIL---KKDSANIALRFFLKIFEVAPSASQMFSFLRVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVADMWSPASAWSEAYDHLVAAIKQE 161
46 -52.9002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  22  11VVFGEEQEALVLKSWAVM---KKDAANLGLRFFLKVFEIAPSAKQMFSFLRDPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLRYGVADGHFEVTGFALLETIKEALADMWSLEKAWAEAYSQLVAAIKRE 160
47 -52.9002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  21  8VVFSEEKEALVLKSWAIM---KKDSANLGLRFFLKIFEIAPSARQMFPFLRVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITTTLKRLGGTHLKYGVADGHFEVTRFALLETIKEALADMWGPENAWGEAYDQLVAAIKQE 157
48 -52.7002zfo_D mol:protein length:145 Extracellular giant hemoglobin major globin subunit B1  ali model follow..  22  3..CSRGDAEVVISEWDQVFNAGSSESAIGVAIFDVFFTSSGVSPSMFPGGGD--SSSAEFLAQVSRVISGADIAINSLTNRATCDSLLSHLNAQHKAIGVTGAAVTHLSEAISSVVAQVLPSAHI--DAWGYCMAYIAAGIGAG 144
49 -52.5001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  14  2..LDQQTINIIKATVPVL---KEHGVTITTTFYKNLFAKHPEVRPLFDM------GRQESLEQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATDDDAWGKAYGVIADVFIQ. 135
50 -52.4003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  18  2..IDQKEKELIKESWKRI---EPNKNEIGLLFYANLFKEEPTVSVLF---------QNPISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAAWTKVYGIAAQVMTAE 133
51 -52.4003wct_D mol:protein length:149 B1 globin chain of giant V2 hemoglobin  ali model follow..  31  2EFCSEADATIVIKQWNQIYNGAKSRWTMGNEIFSSLFKLKPESEVLFNNVNVANMSSGAFHAHTVRVLSGLDMGINYLNDAGTLTSLTAHLAAQHVARGLKAVYFDAMGKVLMTVLPSLIDN--FNPDAWRNCLLPLKNAIAKG 147
52 -52.3002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  19  1..MNSEEVNDIKRTWEVV---AAKMTEAGVEMLKRYFKKYPHNLNHFPWFKDDLPENARFKTHGTRILRQVDEGVKALSGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCVKLNEKQVHAYHKFFDRAYDIAFAE 146
53 -52.1003uh6_A mol:protein length:146 Globin-1  ali model follow..  17  8AQLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSIALMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
54 -52.1003uhb_A mol:protein length:146 Globin-1  ali model follow..  16  8AQLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITKKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
55 -52.1003uhd_A mol:protein length:146 Globin-1  ali model follow..  17  8AQLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHITRKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
56 -52.1002r4x_A mol:protein length:146 Globin-1  ali model follow..  16  8AQLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGVSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKMNGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
57 -52.1003uhi_A mol:protein length:146 Globin-1  ali model follow..  17  8AQLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
58 -52.1002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  13  1..MTKEQIQIIKDCVPIL---QKNGEDLTNEFYKIMFNDYPEVKPMFNM------EKQISGEQPKALAMAILMAAKNIENLENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFYID. 132
59 -52.0003ugz_A mol:protein length:146 Globin-1  ali model follow..  17  8AQLTADVKKDLRDSWKVI---GSDKKGNGVAAMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
60 -52.0002grf_A mol:protein length:146 Globin-1  ali model follow..  17  8AQLTADVKKDLRDSWKVI---GSDKKGNGVALVTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
61 -52.0003ugy_A mol:protein length:146 Globin-1  ali model follow..  17  8AQLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNYIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
62 -52.0001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  17  8AQLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
63 -51.9002d2m_D mol:protein length:145 Giant hemoglobin, B1(d) globin chain  ali model follow..  23  3..CSRGDAEVVISEWDQVFNAGSSESAVGVAIFDAFFASSGVSPSMFPGGGD--SNNPEFLAQVSRVVSGADIAINSLTNRATCDSLLSHLNAQHRAIGVTGAAVTHLSQAISSVVAQVLPSAHI--DAWEYCMAYIAAGIGAG 144
64 -51.9002auo_A mol:protein length:146 Globin I  ali model follow..  17  8AQLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKYAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
65 -51.9003uhc_A mol:protein length:146 Globin-1  ali model follow..  17  8AQLTADVKKDLRDSWKVI---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQAFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
66 -51.8002r4z_A mol:protein length:146 Globin-1  ali model follow..  17  8AQLTADVKKDLRDSWKVW---GSDKKGNGVALMTTLFADNQETIGYFKRLGDQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKNAWAKLVAVVQAAL... 146
67 -51.7001ith_A mol:protein length:141 HEMOGLOBIN (CYANO MET)  ali model follow..  14  1.GLTAAQIKAIQDHWFLN--IKGCLQAAADSIFFKYLTAYPGDLAFFHKFSSGLRSNPAYKAQTLTVINYLDKVVDALGGN--AGALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSADPTTVAAWGDAAGVLVAAMK.. 141
68 -51.7001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  23  17EELSEAERKAVQAMWARL---YANSEDVGVAILVRFFVNFPSAKQYFSQFKHEMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAEEFASDFPPERAWAKLRGLIYSHVTAA 165
69 -51.7003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  19  1..MTREEIKMIQKSWLRV---IDKMDEAGLLFYRRLFDVEPKVRPLF---------KIDIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQQLWTQAYEALAQVMIEE 132
70 -51.4001la6_A mol:protein length:143 Hemoglobin alpha-1 chain  ali model follow..  14  1XSLSDKDKAAVRALWSKI---GKSSDAIGNDALSRMIVVYPQTKIYFSHWPDVTPGSPNIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYK--LRVDPSNFKILNHCILVVISTMFPKEFTPEVSLDKFLSGVALALAER 141
71 -51.2001xq5_A mol:protein length:143 Hemoglobin alpha-1 chain  ali model follow..  14  1XSLSSKDKDTVKALWGKI---ADKAEEIGSDALSRMLAVYPQTKTYFSHWKDLSPGSAPVNKHGKTIMGGIVDAVASIDDLNAGLLALSELHAFT--LRVDPANFKILSHCILVLLAVKFPKDFTPEISYDKFFSALARALAEK 141
72 -51.2003bcq_A mol:protein length:142 Alpha-chain hemoglobin  ali model follow..  14  1.SLSDKDKDSIKAFWAKI---SPKAEDIGADALARMLTVYPQTKTYFSHWKDLSPGSAPVKKHGKTVMGSVAEAVSKIDDLTNGLLTLSELHAFQ--LRVDPANFKILSHNLLVVLAQQFPNDFTPEVSMDKFLSLLSWSLSEK 140
73 -51.2001hbh_A mol:protein length:143 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  14  1XSLSDKDKAAVRALWSKI---GKSADAIGNDALSRMIVVYPQTKTYFSHWPDVTPGSPHIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYK--LRVDPANFKILNHCILVVISTMFPKEFTPEVSLDKFLSGVALALAER 141
74 -51.2005jgg_A mol:protein length:142 Alpha chain  ali model follow..  15  1.TLTSADKSHVKSIWSKA---SGKAEELGAEALGRMLEVFPNTKTYFSHYADLSVTSGQVHTHGKKILDAITTAVNHIDDITGVLTALSTLH--AKTLRVDPANFKILSHTILVVLALYFPADFTPELACDKFLASVSHTLATK 140
75 -50.9001v4u_A mol:protein length:144 hemoglobin alpha chain  ali model follow..  14  2TTLSDKDKSTVKALWGKI---SKSADAIGADALGRMLAVYPQTKTYFSHWPDMSPGSGPVKAHGKKVMGGVALAVSKIDDLTTGLGDLSELHAFK--MRVDPSNFKILSHCILVVVAKMFPKEFTPDVSLDKFLASVALALAER 142

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.