current user: public

If you have questions about the server, please let us know.

Query: 3wgb_A mol:protein length:341 L-allo-threonine aldolase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst GSHMRYIDLRSDTVTQPTDAMRQCMLHAEVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLENTHNGKVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMVFLQLTSGESAPLLAFMKARGILFSGYGELRLVTHLQIHDDDIEEVIDAFTEYLGALast
1 -128.0003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model  100  1GSHMRYIDLRSDTVTQPTDAMRQCMLHAEVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLENTHNGKVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMVFLQLTSGESAPLLAFMKARGILFSGYGELRLVTHLQIHDDDIEEVIDAFTEYLGA 341
2 -113.0003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  53  1.....MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQEDHDNAAWMAEQLREAG---ADVMRQDTNMLFVRVGEENAAALGEYMKARNVLINASPIVRLVTHLDVSREQLAEVAAHWRAFLAR 333
3 -111.0004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  52  1.....MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQEDHDNTAWMAEQLREAG---ADVMRQDTNMLFVRVGEENAAALGEYMKARNVLINASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR 333
4 -105.0005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  22  4....KSQQFASDNYSGICPEAWAAMEKANHGHDAYGDDQWTERASEYFRNLFETDCEVFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALQDIHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSPAELTAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDWLRHGNHANHCAQLLALLVSDLPGVEL-MFPVEANGVFLQMPEHAIEALRAKGWRFYTFI-GSGGARFMCSWDTEEERVRELAADIRSIITA 346
5 -104.0001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  18  11.AKPKPYSFVNDYSVGMHPKILDLMARDNMTQHAYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHETGAIEATGHKVVTAPCPDGKLRVADIESALHENRSEHMVIPKLVYISNTTEVGTQYTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTDIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDFFELGAHSNKMAAILKAGLEACGIRLA--WPSASNQLFPILENTMIAELNNDFDMYTVEPLKDGIMRLCTSWATEEKECHRFVEVLKRLVAS 357
6 -102.0001v72_A mol:protein length:356 Aldolase  ali model follow..  19  5.SRPPALGFSSDNIAGASPEVAQALVKHSSGQGPYGTDELTAQVKRKFCEIFERDVEVFVPTGTAANALCLSAMTPPWGNIYCHPASHINNDECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKVHTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAEWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDWLRNARKANAAAQRLAQGLEGLGGVEV-LGGTEANILFCRLDSAMIDALLKAGFGFYHDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADR 352
7 -102.0002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  44  2GSDKIMIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRNFPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYS-VNPEDVKTNMVILRTDNLKVNGFIEALRNSGVLANSDTEIRLVTHKDVSRNDIEEALNIFEKLFRK 347
8 -88.6003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  22  7.TSFQQTTGQISGRNVGVLKTAFAAVADEMASDQYGTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQDGLKELHPIETILVGAADRLMTLDEI------KALPDIACLLLELPQREIGGVAPAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAAEIAGLFDSIYISFYKGLGGIAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDGDISPKLEQVQEETGLGFVVDKDGYCSTEISVGDAYGELDQQTRDAGFAR 351
9 -84.5003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  20  9.SYQKTPYKLGGNGPRNVGVLTEALQNDNLESDIYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWAKENRRVAYHPLSHLEIHEQDGLKELQQITPLLLGTANQLLTIDD-----IKSLREPVSSVLIELPQREIGGQLPAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSGVKTVPEVPVSNMFHVYFENEIGAILTKIQDETGVGISGQEKSADVCAFEVSVGDAFAEIPALELVFRC 354
10 -56.2001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  16  40.SKDIYIDLLTDSGTNAMSDKQWA--GMMMGDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDKGDIDLKKLQKLIDEKGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTAAHGIKVFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRLGDKLKAAGVPIV--EPVGGHAVFLDARRFCEHLTQDEFPAQSLAAPKLETVRLTIPRRVTYAHMDVVADGIIKLYQH 430
11 -55.1001c7g_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  15  40.SKDIYIDLLTDSGTNAMSDKQWAG--MMIGDEAYAGSENFYHLEKTVKELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMTTTRFHQEKNGATFVDIVRDEAHDASLNLPFKNKLATLIKEKGAENIAYICLAVTVNLAGGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLRYIEHRVKQVRYLGDKLREAGVPIVE--PTGGHAVFLDARRFCPHLTQDQFPAQSLAAPKLETVRLTIPRRVTYAHMDVVADGIIKLYQH 430
12 -55.0002c44_A mol:protein length:471 TRYPTOPHANASE  ali model follow..  15  43.SEDVFIDLLTDSGTGAVTQSMQAA--MMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSNYFFDTTQGHSQINGCTVRNVYIKEAFDTGVRYERGIEEVGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQRTRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIG---VVCQQAGGHAAFVDAGKLLPHIPADQFPAQALACCPAELLRLTIPRATTQTHMDFIIEAFKHVKEN 445
13 -54.6006MME Entity 1(prereleased)  ali follow..  17  40.SKDIYIDLLTDSGTNAMSDKQWAG--MMMGDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGGDIDLKKLQKLIDEGAENIAYICLAVTVNLAGGQPVSMANMRAVRELTEAHGIKVFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRLGDKLKAAGVPIV--EPVGGHAVFLDARRFCEHLTQDEFPAQSLAAPKLETVRLTIPRRVTYAHMDVVADGIIKLYQH 430
14 -50.4001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  11  40..PSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLKDKAKELFNYDYIIPAHQGRGAENILFPVLLKYKQKEGKAKNPVFISNFTAAHVELNGCKAINIVTEKKGDFDIKKLKENIAQGADNIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARIFDMYKYADALTMSAKKDPLLNIGGLVADNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYGQVKYLGDRLREAGIPIQ--YPTGGHAVFVDCKKLVPQIPGDQFPAQAVINADMEFMRLTIARRVTNDHMDYIADALIGLKEK 440
15 -27.9005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  15  48....EFINLNPIQRGGILPEAKKAVYEYWDGYSV--TCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNLEDKGKNVGLILLTDGEYGNLND---AKKVGKIAKEKGIPFLLNCAY---TVGRMPVNGKEV--KADFIVASGHKSMAASAPGILAFSEEFSDKITKTSEMLGCTSRGLPIVTMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAFYDELKKRGIGGIRAGVTKEIK-YGLEWEQVEYVVNAIKEIVES 409
16 -26.8003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  15  33....NIFGSMCSNVLPITRKIVDIFLETNLGD--PGLFKGTKLLEEKAGSLLNNKDAHIVSGGTEANLMALRCIKNIWREIIVPITAHFSFEKG---REMMDLEYIYAPIKEDYTIDEKFVKDAVEDY---DVDGIIGIAGTTELGTI---DNIEELSKIAKENNIYIHVDAA-LDDKYKKKGVNYKDFSLGVDSITIDPHKMGHCPSGGILFKDIGYKRYLDVDAPYLTETRTRVGFGGACTYAVLEGQRKIVNECMENTLYLYKKLKENNFKPV----IEPILNIVAIEDEDYKEVCKKLRDRGIYVNCVKALRIVVMPHIKREHIDNFIEILNSIKRD 397
17 -25.0004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  17  96..........EEKLTELLVKAYGDFAWSNPLH--PDIFPGLRKIEAEICSLFNGGPGCVTSGGTESILMACKAYRDLAFEIVAPQSAHAAFNKA---ASYFGMKIVRVPLTKMMEVDVRAMRRAISRN----TAMLVCSTPQFPHGVI---DPVPEVAKLAVKYKIPLHVDAC--LGGFLIVFMEKAGYVKGVTSISADTHKYGYAPKGSVLYSDKKYRNYQFFVDTDWQGGISRPGGISAACWAALNGYVEATKQIIKTARFLKSELENIKGIFV-FGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLQFPPSIHFITLLHARKRVAIQFLKDIRESVTQ 453
18 -25.0002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  14  122.....................................ASIMYALTNKIFKQLGLNVATPISTGMSISLCLSAARKKYGSVVIYPYASHKSPIKAVSFVGMNMRLVETVLDGDRVYVPVEDIENAIKKEIELNRPCVLSTLTFFPPRNS---DDIVEIAKICENYDIPHIINGAYAIQNNYYLEKLKKAFKYRVDAVVSSSDKNLLTPIGGVYSTDAEFIKEISLSYPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLSKKTLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDIVMNAAIGVRTEDIVNSVSKLEKIL.. 449
19 -24.4002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  13  48................................DEIKTPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETKKRGEVVLALITYPDGNYGNL---PDVKKIAKVCSEYDVPLLVNGA---YAIGRMPVSLKEI--GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLRRSEKYKNKEVEL-ITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEVLYLYRELKSRKIHGIKPGLTRYFK-LSTYGLSDEEVDYVLNAFKEIIEK 369
20 -24.4005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  13  65........FCQTYMEPEAVELMKDTLEKNAID--KSEYPRTAEIENRCVNIIANFTGTSTIGSSEACMLAGLAMKFAWRKIVISAGYQVCWEKF---CVYWDIDMHVVPMDDDHMSLNVDHVLDYVDDYTIGIVGIMGITYTGQYDDLARLDAVVERYNRTTKFPVYIHVDAA-SGGFYTPFIEPELKWLNNVISINASGHKYGLVYPGVVIWRDQQYLPKELVFKVSYLGGFSHSASQLIGQYYNFDGYREIQEKTHDVARYLAKSLTKLGGFSLINDGHELPLICYELTADSDRDLSDRLLMKGWQVPTYPLQRIVVRADFGMSMAHDFIDDLTQAIHD 447
21 -22.4005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  16  60.........GDHEHYAFLNEAYGLFSHVNALQ--RDLCPSMNRMESEIVAMTHRACGALSLGGTESILNATLAYREKARAMIWPASAHPAFRKA---AHLFGFDVTVAPIDPVTMQVDADFVRDAVDAN---TVMLVGSACNYPYGTI---DPIGALSAIAVEKDVWLHVDGC--LGGWMLPWGEALGYLPGVTSISADTHKFGYGPKGGLAWRDASFRRHQYFLMTDWVGGGSRSGGLIAATWAALEGYLARAKAIFETAFDMQAAVRAIPELRVLGKPT---CFAFTSDAFDIYHVNDFMRQRGWRFQHPDALHMVTGPQTQPGVAERFRQDLGEAVEH 427
22 -22.4003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  12  77..........GDDLIHLQTIAYEKYCVANQLH--PDVFPAVRKMESEVVSMVDTGCGTTTSGGTESLLLACLSAKMYA-EIIAPVTAHAGFDKAAYYFGMKLRHVELDPTT--YQVDLGKVKKFINKNT-----LLVGSAPNFPHGIA---DDIEGLGKIAQKYKLPLHVDSC--LGSFIVSFMEKAGYVPGVTSISCDTHKYGFAPKGSIMYRNSDLRMHQYYVNPAWTGGLSRPGAIVVGCWATMNGYIESCQEIVGAAMKFKKYIQENIPDLDIMGNPRYSVISFSSKTLNIHELSDRLSKKGWHFNALQKAFTRLSAHVVDEICDILRTTVQELKSE 440
23 -22.4004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  14  117....................LKEVYGATALTNPLHDKWPRINAMQAEVQNLFHGSKGLLTHGGTTSIIEAMAAYVIRARAIVVPETAHAAFKK--AAELTGAILITVPVDKKTGAVNPNVMSSYITRNT-----VMVGSAPSFMNGIH---DPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSSEPMVPGVTSISADLHKYGCCPKGTCLFSEDSPALSVYAALNWSGGLYSTSGARVAEVYATLNKYQEIAKSIIRLRNAIQKELTALVEEGNGYGNPQWSILGFRSNTCNAHFIADELEKRGWKLNLLQHLCLTHVHTLVGSFETQFIKDLREAVID 473
24 -22.3003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  13  82...................DISAVQPKAAGSSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELG-PEHILCLHSTTACFAPRV--PDRLEELAVICANYDIPHVVNGLQSSKCMHLIQQGAR--VGRIDAFVQSLDKNFMVPVGGAIIFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHERLLQTPHNPISLAMTDKAVTQLGSMLFTRQV-NYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNI 442
25 -22.3001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  13  43.DGSHVINFCANNYLG-HPDLIAAAKAGASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNH--------ASIIDGVRLCKAKRYRYANNDMQELEARLKEAREAGARHVLIATDGSMDGVIAN---LKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAGADHAIIPVMLDAVVAQKFARELQKEGIYVKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQ 396
26 -22.1003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  13  41.GEKEVLNFCANNYLG-HPALIKTAQTVASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNH--------ASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKGARFKLIATDGSMDGIIAD---LKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLEEGPQLRKQLQENSRYFRAGMEKLG---FQLVPGNHPIIPVMLDAQLATNMADHLLQEGIYVMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKK 395
27 -22.0003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  19  117..................IAFLNEVYALQSQSNPLHPDPSTAKFEAEVVAMTGTVCGTVTSGGTESLLLAMKTYRDWARAAVVPVSAHAAFDKA---AQYFGIKLVRTPLDADYRADVAAMREAITPN----TVVVAGSAPGYPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFLEGVTSVSADTHKYGYGAKGTILYRRPDLLHYQYFIAADWPGGLSRPGALSATAWAAMEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVA---DELNIYQVMEEMAGRGWRLNGLHRPPALTLRHTEPGVVDRFLADLQDAVAQ 472
28 -21.9003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  15  41.DGRRVLMFGSNSYLG-DTRIIKAAQDAAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDH--------ASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPEDSAKLICTDGIFSMEGDIVN---LPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASLNDDVDLIMGTFSKSLAS-LGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALENEPEHIEKLWKNTDYAKAQLLDHG---FDLGATESPILPIFISNEKTFWVTKMLQDDGVFVNEESLIRFSLMATHTYDQIDEAIEKMVKVFKQ 391
29 -21.8002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase  ali model follow..  15  117....................AAEAMIAANQSMDSWDQASSATYVEQKVCDKYDKADGIFTSGGTQSNQMGLMLARDW--RIVCSKKSHFTVQKSASWMGLGEKAVMTVDANADGTMDITKLDEVIAQAKAEIPFAIVGTAGTTDHGAI---DDLDFIADMAVKHDMWMHVDGAYGGALILSSHKSRLKGVERAHSISVDFHKLFYQTIGALLVNDKSNFKFLLHHADATTKRFDALKVFMTMQNVGPKALGDMYDHLLAQTLEVADMIRTNDQFELLAEPSLSTVLFRATHDELNKALRLEALTRGIAVLGETIVDTILNPCLTTSDFESLLSKINMLAVE 495
30 -21.8003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  10  69..................EPECDKLIMSSINKNYVDMDPVTTELQNRCVNMIETAVGVGTVGSSEAIMLAGLAFKRKWQNIVTGANVQVCWEK--FARYFEVELKEVKLSEGYYVMDPQQAVDMVDEN----TICVAAILGSTLNGEFEDVKLLNDLLVKETGWDTPIHVDAA-SGGFIAPFLYPELEWLPLVKSINVSGHKYGLVYAGIVIWRNKEDLPEELIFHINYLGAFSKGSSQVIAQYYQLEGYRNVMENCRENMIVLREGLEKTERFNIVSKDEGVPLVAFSLKDSTEFEISDMLRRYGWIAQHITVLRVVIREDFSRTLAERLVIDIEKVMRE 443
31 -21.8005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  19  113..................IAFLNEVYALQSQSNPLHPDPSTAKFEAEVVAMTGTVCGTVTSGGTESLLLAMKTYRDWARAAVVPVSAHAAFDKA---AQYFGIKLVRTPLDADYRADVAAMREAITPN----TVVVAGSAPGFPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFLEGVTSVSADTHKYGYGAKGTILYRRPDLLHYQYFIAADWPGGGSRPGALSATAWAAMEGYLDATRRILQAADRLKAGVRAIPSLKILGDPLWVIAVA---DELNIYQVMEEMAGRGWRLNGLHRFHVLTLRHTEPGVVDRFLADLQDAVAQ 468
32 -21.6002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  17  42.NGRKTILLGTYNYMG-DPDVIAAGKQATGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSH--------ASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPAEAGKLVVLEGVYSMMGDIAP---LQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEVEADVDFVVGTFSKSVGT-VGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRHAGDKRAHLWKNSRRLHQGLRDM-GYKLGTETAQSAIIAVILDMAQAVALWQGLLEAGLYVAGMFLLRCSLCAEHSDEQVEQILGMFESAGRA 394
33 -21.4004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  19  97..........MPATMAILGDLVAAAVNNNML--SLEMSPSFSRLETLLAGLFGQAGGVLTSGGSLANLQALAVARNV--VIFASEAAHTSLQKAAMLLGLGTAAVIPVRATADSRMDPEDLRARIDQARGAHPFCVVATAGTTTTGNI---DPLAEIGAIAREHGLWFHVDAA--YGGALVFSERHRWRIEQADSITFNPQKWLYVACAMVLFRDAGVLERAFRIPAQGTRHADVVKLWLTLQHIGQQGYARLIDDGYRLAERVVEGVRQRPFLRLAGEIDTNIVCFRGEPDWLPAELQALLLREGKIFLSLPVYRVLLNPYTTDAVIDAMFKQIDRFAGR 480
34 -21.4004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain protein  ali model follow..  16  102..........PASSVSWLGDIMTSAYNIHAG--GSKLAPMVNCIEQEVAKQVGFTEGVFVSGGSMANITALTAARDN--TAYISDQTHSSVAKGLRIIGITDSRIRRIPTNSHFQMDTTKLEEAIETDKKSIPFVVIGTAGTTNTGSI---DPLTEISALCKKHDMWFHIDGA--YGASVLLSPKYKSLTGLADSISWDAHKWLFQTCAMVLVKDIRNLFHSFHVNPELTRPARGLKLWLTLQVLGSDLIGSAIEHGFQLAVWAEEALNPKKDWEIVSPAQMAMINFRYAPDILNEKISHRILESGTVLNGKTVLRIAIHPEATQEDMQHTIDLLDQYGRE 482
35 -21.3004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  15  1...MAMIYLDHNATTFIDPRVKEFIISSSAHSSGRFAKNLIETVRAQIATALGEYDITFTSSGTEGNNLIMKNFYD--GDIFISAIEHLSIYN----HINYAPNIKVISVNTQGLVDLEHLEELLAQSNTSKKLVSIIMANN-ESGVLQD---IAEIGKITKKYEAKFHSDLVQ---GFGRIPINIKAL--GLDFATISGHKIGGGQGGAAL-----ISSSNFQITPMIIGGGQEKSVFGLASALRTDNISENYIKIKKLQENLEKKLKKYPNVNIVSNNVAPNTTLITIPNTDAQAKLIGFDLHNICVSSGSAIRISLSHTNTVRDIEAFIEAFEEIYDV 371
36 -21.1002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  17  62.RGKDTILLGTYNYMG-DPDVIAAGKEAKFGSGT-GTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSH--------ASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAP---LKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYELEGQIDFVVGTFSKSVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRTAHEKRERLWSNARALHGGLKAM-GFRLGTETCDSAIVAVMLDQEQAAMMWQALLDGGLYVAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRA 414
37 -21.0003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  21  49.PVAAELDLASNDYLG-HPDVLDGGVEAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDA---CRLSRARVVVSPHRDVDAVDAALAARTEE--------RAVVVTES-----VFSADPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHLAGAPDIVMTTLSKALGS-QGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALR----VLDAEPQRARAVLDRAAELATIAGVTEAPVSAVVSVILDPEIAVGAAAACLDRGVRVAGTSRLRLAARASLTDDEMALARQVLTDVLAT 395
38 -21.0005i90_A mol:protein length:427 PvdN  ali model follow..  14  52....QYLHFANFLLTSHPRPVREAIFDRNPGEAVD--WKYEDEARAWAGRYFAPGQVALTGSTTDGAAIYGGLLVQPGKEILTSSHEHYSTYTT--RHKRMGTQVREFPLFKDPHRVSADEILSSIAAQIRPQTRVLGMTWQSGSGVKLPIREIGKLVR-DEQDRIIYVVDGVH---GFGVEDVSFADF--DCDYFIAGTHKWLFGPRGGVIIARSEQLQEH--RADNFGTLMTPGGYHAFEHRLALGTAFELHARIHQLNAYLKQRLGEHPKVRLTSPELSSGFTFFRVEGRDCEAVAKHLMAHRVISDVGPVVRLAPSLLNDEAEIDRVLEILAPQLA. 427
39 -20.8004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  17  78.RGKDTILLGTYNYMG-DPDVIAAGKEAKFGSGT-GTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSH--------ASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAP---LKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYELEGQIDFVVGTFSASVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRTAHEKRERLWSNARALHGGLKAM-GFRLGTETCDSAIVAVMLDQEQAAMMWQALLDGGLYVNGTFLLRCSICAEHTPAQIQTVLGMFQAAGRA 430
40 -20.8003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  15  87..................PAMLADMLCGAIGCIGWAASPACTELETVMGKMLELPKGVIQGSASEATLVALLAARTK--VAYSSDQAHSSVERA---GLIGGVKLKAIPSDGNFAMRASALQEALERDKAAIPFFMVATLGTTTCCSF---DNLLEVGPICNKEDIWLHVDAA--YAGSAFICPEFRHLVEFADSFNFNPHKWLLVNCSAMWVKKRTDLTGAFRLDPPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFLKGSNKVNEALLQRINSAKCHLRDKFVLRFICSRTVESAHVQRAWEHIKELAAD 473
41 -20.7001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  15  37.DDRQYLNFSSNDYLG-HPQIIRAWQQGGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSH--------ASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDG----DSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWQKVKPELLVVTFGKGFGV-SGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLDEGDARREKLAALITRFRAGVQDLP---FTLADSCSAIQPLIVDNSRALQLAEKLRQQGCWVAGTARLRLTLTAAHEMQDIDRLLEVLHGN... 383
42 -20.7005o5c_A mol:protein length:519 Putative decarboxylase involved in desferrioxamine biosynthesis  ali model follow..  15  113..........PVVLPSLLAEQIMAAVNSSVD--TWDQSAGGTLIEQKVLSRIGLPAGIFTSGGTQSNLMAMLLARDS--RVFTSKLSHFSIQKSMAILGLGYDAVIPVDYDERYRMDVDCLKQEVQRCLQQIPVAVVATSGTTDFGSI---DPLGAISELCKHHGMWMHVDAA--YGCGLLVSESHRPRIEKADSVTVDYHKSFFQTVGAFFVRDKHHLSHVTHHADQTTRRFDALKMWLTLRVSGPMALGNAFDDILALTQIAHQLLNAHPAIEVLHVPELTTQIFRYVPRPGMNNIRKAVFRSGTKVNGRQYLKFLLNPNTTAADIEDVIALIVHYGRE 507
43 -20.7001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  16  87..................PAMLADMLCGAIGCIGWAASPACTELETVMGKMLQLPEGVIQGSASEATLVALLAARTK--VAYASDQAHSSVERA---GLIGGVKLKAIPSDGKFAMRASALQEALERDKAAIPFFVVATLGTTSCCSF---DNLLEVGPICHEEDIWLHVDAA--YAGSAFICPEFRHLVEFADSFNFNPHKWLLVNCSAMWVKRRTDLTGAFKLDPPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAEVTLGLVCFLKGSDGLNEALLERINSARCRLRGQFVLRFICSRKVESGHVRLAWEHIRGLAAE 473
44 -20.6003k40_A mol:protein length:475 Aromatic-L-amino-acid decarboxylase  ali model follow..  15  87..................PAIVADMLSGAIACIGWIASPACTELEVVMGKMLELPAGVIQGTASESTLVALLGAKAK--VGYCSDQAHSSVERAGLLGGVKLRSVQSENHRMRGAALEKAIEQDVAEG--LIPFYAVVTLGTTNSCAF---DYLDECGPVGNKHNLWIHVDAA--YAGSAFICPEYRHLIESADSFNFNPHKWMLVNCSAMWLKDPSWVVNAFNVDPPLGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFLKGSNERNEALLKRINGRGAKIKDVYFLRMICSRFTQSEDMEYSWKEVSAAADE 470
45 -20.5004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  16  92..................PSLLGDMLADAINCLGWASSPACTELEMNVAKMLGLPEGVLQSTVSESTLIALLAARKN--VAYASDQAHSSVEKA---GLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRVPVFVCATLGTTGVCAF---DCLSELGPICAREGLWLHIDAA--YAGTAFLCPEFRGFIEYADSFTFNPSKWMMVHCTGFWVKDKYKLQQTFSVNPPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFLKGPNSLTENVLKEIAKAGATIQDKLIIRFVTSQFTTRDDILRDWNLIRDAATL 477
46 -20.5003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  100...................DISAVQPKAAGSSLLNKITNSLVLDIIKLAGVHTVANCFVVPMATGMSFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELG-PDCILCIHSTTSCFAPRV--PDRLEELAVICANYDIPHIVNGVQSSKCMHLIQQGAR--VGRIDAFVQSLDKNFMVPVGGAIIFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSGSMLFTRQVSGARVVPLGSMQTVSGYTFRGFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKA 460
47 -20.4002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  14  37.ASPDDIILQSNDYLA-HPLIKARLAKSFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEG---ARYANAQAHPFMHNNCDHLRMLIQRHG----------PGIIVVDSSTLGTIAP---LAELVNISKEFGCALLVDESHSLGTHGPNGAGLLALTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLET----DERNTEKVRDYLESNGVFGSNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNY 383
48 -20.4003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  11  27....ELLDYSSNNPLGIPKSFLNNIDEGIKNLGVY-PDVNYRRLNKSIENYLKLKDIGIVLGNGASEIIELSISL---EKILIIVPSYA---EYEINAKKHGVSVVFSYLDENMCIDYEDIISKIDDVD-----SVIIGNPNNPNGGLINKEKFIHVLKLAEEKKKTIIIDEA-FIEFTGDPSSSFVGEIKNYSCLFIAMTKFFAMPFGYGITNNKEIAAKIKAKQNNINCFAEMAAINCLKDTNYIEESLLWIKKERK---RFIEELNKIGFIK-RVFSPHANFVLCRLENISGEKLYDSLLKEDIVIRRDSFVRFAIK---DEKKNTKFLRALKGVENN 360
49 -20.2005k8b_A mol:protein length:403 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase  ali model follow..  13  7........FGPEEKQEVADVMEHGFTFRYNFDHMRNDRWKTRDMEQLLCEKMNVKHAHLLSSGTAALQTAMMAAIGAGDEVIVPPFTFVASVEA----FMAGAVPIFAEIDETLCLSPEGIEAVITPRTKAINLVHMC-------GS---MAKMDEIKAICKKHNLVLLEDACQAIGGSYK-GQALGTIG-DVGCYSFDSVKTITC-GGAVITNNTEIYDNAHMFSPIMGLNFRISEMNAALGLAQLRKLDTIIDIQRKNKKAIKDAMASIPEVSFREIPDPEGLSFMLPTEARTQEISKKLAANGVDGCMSRTISMLIKLSWTDAQIAERIENIKKAFAQ 395
50 -20.1003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  14  51.ASPDDIILQSNDYLA-HPLIKARLAKSFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEG---ARYANAQAHPFMHNNCDHLRMLIQRHG----------PGIIVVDSSTLGTIAP---LAELVNISKEFGCALLVDESHSLGTHGPNGAGLLALTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLET----DERNTEKVRDYLESNGVFGSNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNY 397
51 -20.0001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  13  16....NKTYFNFGGQGILPTVALEAITAMYGYLQENGPQQLIAQLRQALAETFNPNTITITDNVTTGDIVLWGLDWHQGDEILLTDCEHIAIVQAIAARFGITYRFFPVAATLNQGDAAAVLANHLGP-----KTRLVILSHLWNTGQVLP---LAEIMAVCRRHQVRVLVDGAQ---SAGSLPLDFSRL--EVDYYAFTGHKWFAGPAGGGLYIHGDCLGEIN--KRFEVATSAYPQYAALQLHQRQGTAEERYQAICQRSEFLWRGLNQLPHVHCATSAPQAGLVSFTVDSPGHRAIVQKLEEQRIYLRT-DCIRACCHYITDEEEINHLLARLADF... 388
52 -19.9001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  15  22.SPDQLLDFSANNPLGMPVSVKRALIDNLDCIERY-PDADYFHLHQALARHHQVPASWILAGNGETESIFTVASGLKPRRAMIVTPG-FAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLD-----CLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEA-FIDFIPHETGFIPALKDNPHIWVLSLTKFYAIPLGYLVNSDDAAMARMRRQQMSVNALAALAGEVALQDSAWQQATWHWLREEGA---RFYQALCQLPLLTV--YPGRANYLLLRCERE-DIDLQRRLLTQRILIRDSRYYRVAIR---SAAQNERLLAALRNVLTG 359
53 -19.8004eb5_A mol:protein length:382 Probable cysteine desulfurase 2  ali model follow..  14  1.....MAYFDYTSAKPVDERILEAMLPSSVHSYGFKAREAVQEAREKVAKLVNGGTVVFTSGATEANNLAIIGYARKGKHILVSAVEHMSVINPAKFLQKQGFEVEYIPVGKYGEVDVSFIDQKLRDDTILVSVQHA----NNEIGTIQP---VEEISEVLAGKAA-LHIDATA---SVGQIEVDVEKI--GADMLTISSNDIYGPKGVGAL-----WIRKEAKLQPVILGGGQENGLFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESYLNGHPEKPNNVNVRFSYIEGESIVLSLDMAGIQASTHGTLLLTLGRYNTDEDVDRLLEVLPGVIER 372
54 -19.8001pmm_A mol:protein length:466 Glutamate decarboxylase beta  ali model follow..  11  55NARQNLATFCQTWDDENVHKLMDLSINKNWIDK--EEYPQSAAIDLRCVNMVADKNGQAVGTNTIGSSEACMLGGMAMKPNLVCGPVQICWHK--FARYWDVELREIPMRPGQLFMDPKRMIEACDEN----TIGVVPTFGVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAA-SGGFLAPFVAPDIVWLPRVKSISASGHKFGLAPLGCVIWRDEEALPQELVFNVDYLGGQSRPAGQVIAQYYEFEGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPA--PGYTLYDLSERLRLRGWQVPAFTLMRIMCRRGFEMDFAELLLEDYKASLKY 447
55 -19.8002jis_A mol:protein length:515 CYSTEINE SULFINIC ACID DECARBOXYLASE  ali model follow..  18  111.........SGLDPHALAGRIITESLNTSQY--TYEIAPVFVLMEEEVRALVGWSSGIFCPGGSISNMYAVNLARYQ--ALFTSKECHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEVPFLVSATSGTTVLGAF---DPLEAIADVCQRHGLWLHVDAA--WGGSVLLSQTHRHLIQRADSVAWNPHKLLAAGLQCSALLLQDHGSQASYLFQQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPSKVAPVLKERMVKEGSMMIGYQPHGVVANSALTCADMDFLLNELERLGQD 508
56 -19.7003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  16  16....LPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNEEAVDIARNQIADLVGPREIVFTSGATESDNLAIKGAAKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVSIMHV----NNEIGVVQD---IAAIGEMCRARGIIYHVDATQ---SVGKLPIDLSQL--KVDLMSFSGHKIYG--IGALYVRRKPRVR----IEAQMHGGGHERGMMGEAYRIAKEEMATEMERLRGLRNRLWNGIKDIEEVYLNGDLEHGNILNVSFNYVEGESLIMALKDLAVSSGSHSSIRFSLGRFTTEEEIDYTIELVRKSIGR 392
57 -19.7002po3_A mol:protein length:424 4-dehydrase  ali model follow..  20  32..................ARLYERLDRALDSQWLSNGGPLVREFEERVAGLAGVRHAVATCNATAGLQLLAHA-AGLTGEVIMPSMTFAAT--PHALRWIGLTPVFADIDPDTGNLDPDQVAAAVTPRTSAVVGVHLW-------GRPCAADQLRKV---ADEHGLRLYFDAAHALGCAVD-GRPAGSLG-DAEVFSFHATKAVNA-GGAVVTDDADLAARIRALHNAGGTNAKMSEAAAAMGLTSLDAFPEVIDRNRRNHAAYREHLADLPGVLVADHDRHGLNNHQYVIGIHRDLVMEVLKAEGVHTRAARVLSLPTGTAIGDDDIRRVADLLRLCATR 385
58 -19.5001xey_A mol:protein length:466 Glutamate decarboxylase alpha  ali model follow..  12  63........FCQTWDDENVHKLMDLSINKNWID--KEEYPQSAAIDLRCVNMVAPKNGQAVGTNTIGSSEACMLGGMAMKWNLVCGPVQICWHK--FARYWDVELREIPMRPGQLFMDPKRMIEACDEN----TIGVVPTFGVTYTGNYEFPQPLHDAFQADTGIDIDMHIDAA-SGGFLAPFVAPDIVWLPRVKSISASGHKFGLAPLGCVIWRDEEALPQELVFNVDYLGFSRPAGQVIAQYYEFLEGYTKVQNASYQVAAYLADEIAKLGPYEFICTGRPDEGIPAVCPGYTLYDLSERLRLRGWQVPAFTLMRIMCRRGFEMDFAELLLEDYKASLKY 447
59 -19.5003ju7_A mol:protein length:377 Putative PLP-dependent aminotransferase  ali model follow..  12  1..GMENIPFLRASTV-PVIEYLDELKEIDASHIYTNYGPINQRFEQTIMSGFNRGAVTTVANATLGLMAAIQLKRKKGKYALMPSFTFPAT--PLAAIWCGLEPYFIDISIDDWYMDKTVLWDKIEELKEEVAIVVPYAT-----GSWMNLEEYEELE----KKGVPVVVDAAPGFGLMNG-GMHYGQDFSGMIIYSFHATKPFGI-GGLIYSKNEEDIQRIKRMGNMMGFNCKMSEYAAAIGIATMKKWDDKLKERTRISEWYKQLLQSNGLMKKGWQLQKTEMPILCPEEVRNKQVIEDLKKQKIEARAKRIVSLPLWEGMTKEIVEQIVICLGQKVVS 374
60 -19.4002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  14  97.........TGLDMVGLAADWLTSTANTNMF--TYEIAPVFVLLEYVTREIIGWPGGIFSPGGAISNMYAMMIARFK--IAFTSEHSHFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKVPFLVSATAGTTVYGAF---DPLLAVADICKKYKIWMHVDAA--WGGGLLMSRKHKWKVERANSVTWNPHKMMGVPLSALLVREEGLMQNCNQMHAQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREGYEMFDGKPQHTNVCFWYIPPSLRVIKARMMEYGTTMVSYQPLGVISNPAATHQDIDFLIEEIERL... 494
61 -19.3006enz_A mol:protein length:530 Acidic amino acid decarboxylase GADL1  ali model follow..  18  126.........AGLDYYSLAARIITEALNPSIY--TYEVSPVFLLVEEAVIECVGWKEGIFNPGGSVSNMCAMNLARYR--ILFTSAECHYSMKKAASFLGIGTQNVYFVETDGRGKMIPEDLEKQIWQARQEVPFLVCATSGTTVLGAF---DPLDEIAEVCERHGLWLHVDAS--WGGSALVSRKHRRLIHRADSVAWNPHKMLMAGIQCSALLVKDYSAKATYLFQQCSRRPDAFKFWMTWKALGTSGLEERVNRAFALSRYLVDEIKKREGFKLLMEPEYTNVCFWYIPSLVAPAIKEKMMKKGSLMLGYQPHRVVISPQVSREDMDFLLDEIDSLGRD 523
62 -19.3006eeq_A mol:protein length:490 4-hydroxyphenylacetaldehyde synthase  ali model follow..  13  99..........SSSNAGLLGELLCSGLSVIGF--TWSSSPAATELENVVAKMLNLPSGVLQANTCEAVLCTLAAARDK--VLYCSDQTHFTIHKGAKLIGIRSKNIKSITTKKENEFKLCPRDAIRSDLEAGLVPFYVCGT-TTALGVV---DPIKELGKVAREFDLWLHVDGA--YGGSACICPEFQHYVDLVDSISMNAHKWLLSNCCFLWLQSPNALIESLAAEASLSRRFRAIKMWMVIRRYGVSNLIEHIRSDVSMAVRFEEMVAADDRFEIVFPRKFALVCFKLSSSELTRELMERVNSSGVQMGRIFFIRCIGSSLTEERHVDNLWRLIQETAQS 487
63 -19.3005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  15  39.DGRAIIGFASNDYLG-HPQLIAAIAEGGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNH--------ASLIDGARLSRADVQIYPHCDTDALSAMLEASDADVKVIVSDTVFSMDG----DIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIALRSPNLISIGTLDKAAGV-SGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLEEGDARRAHLQQLIGRTRAMLKATP---WLPVDSHTAVQPLIIANDATLEIAATLDRAGLWVTGTSRLRISLSAAHSQADLDRLEAGLQQLGAK 394
64 -19.3004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  13  43.KDDSIIDFTTSDYLN-AHNLKHAIVNGKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDG---IKLSQAKLRRYKHQQLSQLQDIYDG------------KSFITTEGSTSGSITQLDKLAKITP-------KLIVDEAHSFGVLGKNGRGAIN-YKNCLICVFPLGKAFGG-VGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNVNDNRARLQQNITFFNELCDAKDLELVSKDLSPIRSIQL--NANLAIRLKDKLFENKIIVKDQAILRFSLHSNNTFDQIQQALEIISKEVKY 387
65 -19.2005wt2_A mol:protein length:401 Cysteine desulfurase IscS  ali model follow..  17  2...VQRIYLDNNATTRIDPKVKEIMDPF---RDHYGNHPAIAEALDKLYKGINIDDVIITSCATESNNWVLKGVYKGKNHIVTTVAEHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVREAITEK----TALVSVMWANNETGLIFP---IEEIGAICKEKGVLFHTDAVQ---AIGKIPVDVLKA--NADFLSFSAHKFHGPKGIGGL-----YIRSGVGLTPLFHGGEHMNGRMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRIHRNTTLVSVRGIEGEAMLWDLNRSNIAASTHTAIRLSLSRFNTEAEIDKTIEVFSQAAVR 379
66 -19.2005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  15  37.NGREIVGFASNDYLG-HPKLVAAFAEGGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNH--------ASLIDGTRLSRATVQVYPHADTATLGALLEACTSQTKLIVTDTVFSMDG----DIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALALRSPHLVYVGTLGXAAGV-AGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLDEGDARRAHLAALIERTRALLRRTR---WQPVDSHTAVQPLVISNEATLAAMRALDAHGLWVAGTSRLRISLSAAHSFDDLARLETALLRASEE 392
67 -19.1003wco_A mol:protein length:392 L-seryl-tRNA(Sec) selenium transferase  ali model follow..  13  27..............APLSKDVINFISEIANG-EEGKRGSRIAHIEKYLNELTGAESSFVVNNNAGAVFLVLNTLAEGKEVIISRGELVEIGGSFRIPDIMKKSGAILREVGYYNKTKVSRYEGAINQN---TALLMKVHKSNFPMEGFVEEVKLEDLVKLGHKYGIPTYYDAGKEFGISVDEPNFRDCISLGIDLVSGSGDKLLGGPQAGIIVGKKNLIEKIK--KNPIARALRIDKLTLSGLEMTLKLYFQDEKALRQKAKRLEKLLKDIPGLKISVIKLPTYCVAIRHDRLSSQELSRRLRLAEIVCRIREDQLLFDMRTVFHEDLKTIKKTLQELLS. 391
68 -19.1006blg_A mol:protein length:379 dTDP-4-amino-4,6-dideoxygalactose transaminase  ali model follow..  15  1..SNAMIPFNAPPVV---GTELDYMQSAMNSGKLCGDGGFTRRCQQWMEQRFGTAKALLTPSCTASLEMAALLLIQPGDEVIMPSYTFVST--ANAFVLRGAKIVFVDIRRDTMNIDETLIEAAITDKTRAIVPVHYA-------GVACEMDTIMAI---ADKYNLFVVEDAAQGVMSTYK-GRALGTIG-HIGCFSFHETKNYTA-GGATLINDRTLVERAEIIREKIGSSYLMSDLQAAYLWAQLEAAERINQQRLALWQNYYDALLPLARAGRIELPTVPHMFYIKLRDIE-SRLIAWLKEAEILAVSERLVRLPLFYNLSVVNQRTVINSLLSYFS. 379
69 -19.1004piw_A mol:protein length:396 TDP-4-keto-6-deoxy-D-glucose transaminase family protein  ali model follow..  15  12..GSHMIPFNAPPVV---GTELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALLLIQPGDEVIMPSYTFVST--ANAFVLRGAKIVFVDVRPDTMNIDETLIEAAITDKTRVIVPVHYA-------GVACEMDTIMAL---AKKHNLFVVEDAAQGVMSTYK-GRALGTIG-HIGCFSFHETKNYTA-GGATLINDKALIERAEIIREKIGSSYLMSDLQAAYLWAQLEAADRINQQRLALWQNYYDALAPLAKAGRIELPSIPDFYIKLRDIDDRSALINFLKEAEIMAVSERLLRLPLFYNLSPVNQRTVIATLLNYFS. 390
70 -18.9004k2i_A mol:protein length:443 NTD biosynthesis operon protein NtdA  ali model follow..  11  68..KVPFLPVDRLITNDEVEDILNTLTEV-LPTGKFTSGPYLEQFEKVLSTYLHKRYVIATSSGTDAIMIGLLALLNPGDEVIMPANSFSATEN--AVLASGGVPIYVDINPQTFCIDPDKIEEAITPYTKFILPVHLY-------GK---HSDMQHIRQIANRYKLKVIEDACQ------GIGLTDLGKYADITTLSFNPYKNFGV-AGAIATDNEELAKKCIQFSYNFGFNSKMDNLQAAIGLERMKYLSLNNFKRLFLADRYITQLAELQNKGYIELPELSHLFPIKVRTEDRADIMTKLNEDFTEKAHSQVLHLPLYPSFTLEEQDRVMEGLFHVIKQ 439
71 -18.8003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  18  45........IASENFVPRASVLTNKYAEGLPGRRYYGGCEHVDVVEDRAKALFGAEFAVQPHSGAQANAAVLHALMSPGERLLGANGGHLTHGMRLNFSGKLYENGFYGVDPATHLIDMDAVRATALEF----RPKVIIAGWSA----YPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAA---LHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIEFADRQRRTLSGARIIADRLMAPDGVSVVSGGTDVHLVLVDLRDSPLDAAEDLLHEVGITVNVTSGLRILATRGFGDTEFTEVADIIATALAT 407
72 -18.8003vp6_A mol:protein length:511 Glutamate decarboxylase 1  ali model follow..  13  104.........TGLDIIGLAGEWLTSTANTNMF--TYEIAPVFVLMEQITREIVGWSSGIFSPGGAISNMYSIMAARYK--VLFTSEQSHYSIKKAGAALGFGTDNVILIKCNERGKIIPADFEAKILEAKQKVPFYVNATAGTTVYGAF---DPIQEIADICEKYNLWLHVDAA--WGGGLLMSRKHRHKIERANSVTWNPHKMMGVLLSAILVKEKGILQGCNQMHAQCGRHVDIFKFWLMWKAKGTVGFENQINKCLELAEYLYAKIKNREEFEMFNGEPEHTNVCFWYIPQSLPKIKALMMESGTTMVGYQPFRMISNPAATQSDIDFLIEEIERL... 501
73 -18.8001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  10  154........FRAD-LCNADVAL----------GDLLIHEGPAVAAEKHAARVYNADKTYFVLGGSNANNTVTSALVSNGDLVLFDRNNHKSVYNSA---AMAGGRPVYLQTN-EKKIRELAAKVDPERAKWKRPFRLAVIQLGTYDGTIY---NAHEVVKRIGHLCDYIEFDSAPMMRNSSPLLIDDLGPEDPGIIVVQSVHKQQAGFSQTSQI-HKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKAGSMFRPFVPVDPNKFMLTTPGINPEIVANYLRDHGIIPEDLNSILFLMTPAETPAKMNNLITQLLQL... 562
74 -18.8006eei_A mol:protein length:490 Tyrosine decarboxylase 1  ali model follow..  13  94..........NSSVAGFLGEMLSAGLGIVGF--SWVTSPAATELEMIVAKLLNLPESKGNGGGVIQGSASEAVLVVLIAAVYSSDQTHSALQKACQIAGIHNCRVLTTDSSTNYALRPESLQEAVSRDLEAIPFFLCANVGTTSSTAV---DPLAALGKIANSNGIWFHVDAA--YAGSACICPEYRQYVETADSFNMNAHKWFLTNCSLLWVKDQDSLTLALSTNPPLGRRFRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDPNFEIVTPRIFALVCFRLVPNNRNRELLDAVNSSGTALSGKIVLRCIGAPLTEEKHVKEAWKIIQEEASY 486
75 -18.7002fn6_A mol:protein length:375 AMINOTRANSFERASE  ali model follow..  12  1...MKEFAYSEPCLDKEDKKAVLEVLNSK-----LTQGKRSLLFEEALCEFLGVKHALVFNSATSALLTLYRNF--DRNEIITTPISFVATANM---LLESGYTPVFAGIKNDGNIDELALEKLINERTKAIVSVDYA-------GK---SVEVESVQKLCKKHSLSFLSDSSHALGSEYQ-NKKVGGFA-LASVFSFHAIKPITT-GGAVVTNDSELHEKMKLFRKSIGHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDNPYFTPLHPLLKDKSSNHLYPFTCKKLILESLHKRGILAQYHAEISLPCHANLNLESVQNIAHSVLKTFES 371

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 4 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Bossy-Wetzel E, Barsoum MJ, Godzik A., Schwarzenbacher R, Lipton SA. Mitochondrial fission in apoptosis, neurodegeneration and aging. Curr Opin Cell Biol. 2003 Dec;15(6):706-16. Review.