current user: public

If you have questions about the server, please let us know.

Query: 3wlx_B mol:protein length:333 Low specificity L-threonine aldolase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330
# Score Template Links and tools%idFirst MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVLINASPIVRLVTHLDVSREQLAEVAAHWRAFLARLast
1 -120.0003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model  100  1MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVLINASPIVRLVTHLDVSREQLAEVAAHWRAFLAR 333
2 -117.0004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  98  1MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVLINASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR 333
3 -113.0003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  53  6YIDLRSDTVTQPTDAMRQCMLHAEVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLENTHNGKVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADDHRRARQLAEGLAALPLDLAQVQTNMVFLQLTSGESAPLLAFMKARGILFSGYGELRLVTHLQIHDDDIEEVIDAFTEYLGA 341
4 -102.0002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  43  7MIDLRSDTVTKPTEEMRKAMAQAEVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRNIPRTSLIAIENTHNRSGGRVVPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKEDHENARFLALKLKEIGYSPEDVKTNMVILRTDNLKVNGFIEALRNSGVLANSDTEIRLVTHKDVSRNDIEEALNIFEKLFRK 347
5 -100.0005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  23  5SQQFASDNYSGICPEAWAAMEKANHGHDAYGDDQWTERASEYFRNLFETDCEVFAFNGTAANSLALASLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALQDIHYPKPRVVTITQATEVGTVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSPAELTAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANAQLLALLVSDLPGLMFPVEANGVFLQMPEHAIEALRAKGWRFYTFI-GSGGARFMCSWDTEEERVRELAADIRSIIT. 345
6 -100.0001v72_A mol:protein length:356 Aldolase  ali model follow..  18  9ALGFSSDNIAGASPEVAQALVKHSSGQGPYGTDELTAQVKRKFCEIFERDVEVFVPTGTAANALCLSAMTPPWGNIYCHPASHINNDECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKVHTTQPACVSITQATEVGSIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAEWKAGVDALSFGATKNGVLAAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDDLWNARKANAAAQRLAQGLEGLGGVLGGTEANILFCRLDSAMIDALLKAGFGFYHDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADR 352
7 -99.7001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  20  15PYSFVNDYSVGMHPKILDLMARDNMTQHAYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHETGAIEATGHKVVTAPCPDGKLRVADIESALHENRSEHMVIPKLVYISNTTEVGTQYTKQELEDISASCKEHGLYLFLDGARLASALSSPVNDLTDIARLTDMFYIGATKAGGMFGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNLFFELGAHSNAAILKAGLEACGIRAWPSASNQLFPILENTMIAELNNDFDMYTVEPDGTCIMRLCTSWATEEKECHRFVEVLKRLVAS 357
8 -84.9003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  20  12.TTGQISGHGKRNVKTAFAAVADEMASDQYGTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQDGLKELHPIETILVGAADRLMTLDEIKAL------PDIACLLLELPQREIGGVAPAFSELETISRYCRERGIRLHLDGARLFEMLPYYEKTAAEIAGLFDSIYISFYKGLGGIAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPTTPEVPVSNMFHLHFDGDISPKLEQVQEETGLGFVVDKDGYCSTEISVGDAYGELDQQTRDAGFAR 351
9 -82.8003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  21  13TPYKLGGNGPRNVGVLTEALQNDNLESDIYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWAKENRRVAYHPLSHLEIHEQDGLKELQQITPLLLGTANQLLTIDD-----IKSLREPVSSVLIELPQREIGGQLPAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEEICALFDSVYVSFYKGIGGIAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFEKRIGKMAEYFEAAKGLAERFNSCSTVPEVPVSNMFHVYFENEIGAILTKIQDETGVGISGQEKSADVCAFEVSVGDAKNLELVFRCLEKE 358
10 -56.2001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  16  44YIDLLTDSGTNAMSDKQWA--GMMMGDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLKGDIDLKKLQKLIDEKGAENIAYICLAVTVNGQPVSMANMRAVRELTAAHGIKVFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRLGDKLKAAGVIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAAPKLETVRLTIPRRVTYAHMDVVADGIIKLYQH 430
11 -55.8002c44_A mol:protein length:471 TRYPTOPHANASE  ali model follow..  15  47FIDLLTDSGTGAVTQSMQAA--MMRGDEAYSGSRSYYALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSNYFFDTTQGHSQINGCTVRNVYIKEAGNFDLEGLERGIEEGPNNVPYIVATITSNSAGGQPVSLANLKAMYSIAKKYDIPVVMDSARFAENAYFIKQRTRETYKYADMLAMSAKKDAMVPMGGLLCMKDDSFFDVYTECRTLYGGLEGGAMERLAVGLYDGMNLDWLAYRIAQVQYLVDGLEEIGVVCQQAGGHAAFVDAGKLLPHIPADQFPAQALACCPAELLRLTIPRATTQTHMDFIIEAFKHVKEN 445
12 -55.2001c7g_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  17  44YIDLLTDSGTNAMSDKQWAG--MMIGDEAYAGSENFYHLEKTVKELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMTTTRFHQEKNGATFVDIVRDEAHDASLNLPFDIDLNKLATLIKEKGAENIAYICLAVTVNGQPVSMANMRAVHEMASTYGIKIFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGL-YIEHRVKQVRYLGDKLREAGVIVEPTGGHAVFLDARRFCPHLTQDQFPAQSLAAPKLETVRLTIPRRVTYAHMDVVADGIIKLYQH 430
13 -54.5006MME Entity 1(prereleased)  ali follow..  16  44YIDLLTDSGTNAMSDKQWAG--MMMGDEAYAGSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGGDIDLKKLQKLID--EKGAENIAYICLAVTVNGQPVSMANMRAVRELTEAHGIKVFYDATRCVENAYFIKEQVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRLGDKLKAAGVIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASKLETVRLTIPRRVTYAHMDVVADGIIKLYQH 430
14 -50.4001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  15  43AVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLKDKAKELFNYDYIIPAHQGRGAENILFPVLLKYKQKEGKAKNPVFISNFTAAHVELNGCKAINIVTEKAGDFDIKKLKENIAQGADNIVAIVSTVTCNSAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCENAYFIKARIFDMYKYADALTMSAKKDPLLNIGGLVADNEEIFTLARQRCVPMEGFVTYGGLAGRDMAAMVQGLEEGTEEEYLHVKYLGDRLREAGIIQYPTGGHAVFVDCKKLVPQIPGDQFPAQAVINADMEFMRLTIARRVTNDHMDYIADALIGLKEK 440
15 -25.8005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  13  49FINLNPIQRGGILPEAKKAVYEYWDGYSV--TCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNLEDKGKNVGLILLTDGEYGNLND---AKKVGKIAKEKGIPFLLNCAY---TVGRMPVNGKEV--KADFIVASGHKSMAASAPGILAFSEEFSDKITKTSEMLGCTSRGLPIVTMASFPHVVERVKKWDEELKKTRYVVDELEKIGKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFYDELKKRGIGGYGLEWEQVEYVVNAIKEIVES 409
16 -24.6001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  15  47VINFCANNYLG-HPDLIAAAKAGASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNH--------ASIIDGVRLCKAKRYRYANNDMQELEARLKEAREAGARHVLIATDG-----VFSMDNLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEAGSELRDRLWANARQFREQMSAAGFTLAGADHAIIPVMLDAVVAQKFARELQKEGIYVKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQ 396
17 -24.3003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  13  45VLNFCANNYLG-HPALIKTAQTVASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNH--------ASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKGARFKLIATDG-----VFSMDDLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLEEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHPIIPVMLDAQLATNMADHLLQEGIYVMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKK 395
18 -24.2003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  18  34IFGSMCSNVLPITRKIVDIFLETNLGD--PGLFKGTKLLEEKAGSLLNNKDAHIVSGGTEANLMALRCIKNIWREIIVPITAHFSFEKG---REMMDLEYIYAPIKEDYTIDEKFVKDAVEDYD---VDGIIGIAGTTELGTI---DNIEELSKIAKENNIYIHVDAA-LDDKYKKKGVNYKDFSLGVDSITIDPHKMGHCPSGGILFKDIGYKRYLDVDAPYLTETRTRVGFGGACTYAVLEGQRKIVNECMENTLYLYKKLKENNFKPV-IEPILNIVAIEDEDYKEVCKKLRDRGIYVNCVKALRIVVMPHIKREHIDNFIEILNSIKRD 397
19 -23.8002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  12  48...........................DEIKTPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETKKRGEVVLALITYPDGNYGNL---PDVKKIAKVCSEYDVPLLVNGA---YAIGRMPVSLKEI--GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLRRSEKYKNKEVEL-ITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNVLYEISKKAKYRELKSRKIHGIKPGLTRYFK-LSTYGLSDEEVDYVLNAFKEIIEK 369
20 -23.4003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  16  45VLMFGSNSYLG-DTRIIKAAQDAAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDH--------ASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPEDSAKLICTDGIFSMEGDIVN---LPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASLNDDVDLIMGTFSKSLAS-LGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALENEPEHIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFISNEKTFWVTKMLQDDGVFVNEESLIRFSLMATHTYDQIDEAIEKMVKVFKQ 391
21 -23.4002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  122................................ASIMYALTNKIFKQLGLNVATPISTGMSISLCLSAARKKYGSVVIYPYASHKSPIKAVSFVGMNMRLVETVLDGDRVYVPVEDIENAIKKEELGNRPCVLSTLTFFPPRNS---DDIVEIAKICENYDIPHIINGAYAIQNNYYLEKLKKAFKYRVDAVVSSSDKNLLTPIGGVYSTDAEFIKEISLSYPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDLS-FLDVESPIASCISVNSDPVEKKTDHFGNCYLGTYTHDYIVMNAAIGVRTEDIVNSVSKLEKIL.. 449
22 -22.8004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  13  96.....EEKLTELLVKAYGDFAWSNPLH--PDIFPGLRKIEAEIVRIACSSCGCVTSGGTESILMACKAYRDKTPEIVAPQSAHAAFNKA---ASYFGMKIVRVPLTKMMEVDVRAMRRAISRN----TAMLVCSTPQFPHGVI---DPVPEVAKLAVKYKIPLHVDAC--LGGFLIVFMEKAGYVKGVTSISADTHKYGYAPKGSVLYSDKKYRNYQFFVDTDWQGGISRPGGISAACWAALNGYVEATKQIIKTARFLKSELENIKGVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLQFPPSIHFITLLHARKRVAIQFLKDIRESVTQ 453
23 -22.4001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  13  41YLNFSSNDYLG-HPQIIRAWQQGGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSH--------ASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPG---QQMVVTEG-----VFSMDPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWQKVKPELLVVTFGKGFGV-SGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLDEGDARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVDNSRALQLAEKLRQQGCWVAGTARLRLTLTAAHEMQDIDRLLEVLHGN... 383
24 -22.3002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  16  46TILLGTYNYMG-DPDVIAAGKQATGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSH--------ASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPAEAGKLVVLEGVYSMMGDIAP---LQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEVEADVDFVVGTFSKSVGT-VGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRHAGDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVDMAQAVALWQGLLEAGLYVAGMFLLRCSLCAEHSDEQVEQILGMFESAGRA 394
25 -21.9002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  15  41DIILQSNDYLA-HPLIKARLAKSFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEG---ARYANAQAHPFMHNNCDHLRMLIQRHG----------PGIIVVDS-----IYSTLPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLALTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNY 383
26 -21.8002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  16  66TILLGTYNYMG-DPDVIAAGKEANGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSH--------ASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAP---LKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYELEGQIDFVVGTFSKSVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVDQEQAAMMWQALLDGGLYVAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRA 414
27 -21.6003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  15  55DIILQSNDYLA-HPLIKARLAKSFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEG---ARYANAQAHPFMHNNCDHLRMLIQRH----------GPGIIVVDS-----IYSTLPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLALTREVHFMTASLAKTFAY-RAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLESADNRRQHLDRMARKLRIGLSQLGLTIRSESQIIGLETGDERNTEKVRDYLESNGVFGSNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNY 397
28 -21.5004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  16  82TILLGTYNYMG-DPDVIAAGKEANGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDG---CQQGNAEIVRFRHNSVEDLDKRLGRLPKEP-------AKLVVLEG-----VYSMLPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYELEGQIDFVVGTFSASVGT-VGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVDQEQAAMMWQALLDGGLYVNGTFLLRCSICAEHTPAQIQTVLGMFQAAGRA 430
29 -21.4004w8i_A mol:protein length:551 Probable sphingosine-1-phosphate lyase  ali model follow..  15  117...............LKEVYGATALTNPLHDKWPRINAMQAEVQNLFHGSKGLLTHGGTTSIIEAMAAYVIRARAIVVPETAHAAFKK--AAELTGAILITVPVDKKTGAVNPNVMSSYITRNT-----VMVGSAPSFMNGIH---DPISELGQLAKKKNVPFHVDACLGGFLTAFLDTSSEPMVPGVTSISADLHKYGCCPKGTCLFSEDSPALSVYAALNWSGGLYSTSGARVAEVYATLNKYQEIAKSIIRLRNAIQKELTALV-VYGNPQWSILGFRSNTCNAHFIADELEKRGWKLNLLQHLCLTHVHTLVGSFETQFIKDLREAVID 473
30 -21.3005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  15  43IIGFASNDYLG-HPQLIAAIAEGGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNH--------ASLIDGARLSRADVQIYPHCDTDALSAMLEASDAD---VKVIVSDT-----VFSMDPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIALRSPNLISIGTLDKAAGV-SGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLEEGDARRAHLQQLIGRTRAMLKATPWLPVDSHTAVQPLIIANDATLEIAATLDRAGLWVTGTSRLRISLSAAHSQADLDRLEAGLQQLGAK 394
31 -21.2003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  17  53ELDLASNDYLG-HPDVLDGGVEAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSH--------ASLVDACRLSRARVVVSPHRDVDAVDAALAARTEE---RAVVVTES-----VFSADPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHLAGAPDIVMTTLSKALGS-QGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALR--LDAEPQRARAVLDRAAELATIAGVTEAPVSAVVSVILDPEIAVGAAAACLDRGVRVAGTSRLRLAARASLTDDEMALARQVLTDVLAT 395
32 -21.1005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  14  41IVGFASNDYLG-HPKLVAAFAEGGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNH--------ASLIDGTRLSRATVQVYPHADTATLGALLEACTSQ---TKLIVTDT-----VFSMDPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALALRSPHLVYVGTLGXAAGV-AGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLDEGDARRAHLAALIERTRALLRRTRWQPVDSHTAVQPLVISNEATLAAMRALDAHGLWVAGTSRLRISLSAAHSFDDLARLETALLRASEE 392
33 -21.1003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  12  82..............DISAVQPKAAGSSLLNKITNSLVLNVIKLAGVHSVASCFVVPMATGMSFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPE-HILCLHSTTACFAPRV--PDRLEELAVICANYDIPHVVNGLQSSKCMHLIQQGAR--VGRIDAFVQSLDKNFMVPVGGAIIFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLNERLLQTPHNPISLAMTDKAVTQLGSMLFTRQV-NYPCAYLNAAAAIGMKMQDVDLFIKRLDKCLNI 442
34 -20.8004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  13  47IIDFTTSDYLN-AHNLKHAIVNGKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIH--------ASIIDGIKLSQAKLRRYKHQQLSQLQDIYDG-------KSFITTEG-----VFSTSSITQLDKLAKITPEKLIVDEAHSFGVLGKNGRGAIN-YKNCLICVFPLGKAFGG-VGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNVNDNRARLQQNITFFNELCDAKDLELVSKDLSPIRSIQNANLAIRLKDKLFENKIIVKDQAILRFSLHSNNTFDQIQQALEIISKEVKY 387
35 -20.7005gp4_C mol:protein length:468 Glutamate decarboxylase  ali model follow..  10  65...FCQTYMEPEAVELMKDTLEKNAID--KSEYPRTAEIENRCVNIIESFTGTSTIGSSEACMLAGLAMKFAWRKIVISAGYQVCWEK--FCVYWDIDMHVVPMDDDHMSLNVDHVLDYVDDYTIGI--GIMGITYTGQYDDLARLDAVVERYNRTTKFPVYIHVDAA-SGGFYTPFIEPELKWLNNVISINASGHKYGLVYPGVVIWRDQQYLPKELVFKVSYLGGFSHSASQLIGQYYNFDGYREIQEKTHDVARYLAKSLTKLGGLINDGHELPLICYEREWTLYDLSDRLLMKGWQVTDRVIQRIVVRADFGMSMAHDFIDDLTQAIHD 447
36 -20.3003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  15  117.............IAFLNEVYALQSQSNPLHPDPSTAKFEAEVVAMTGTVCGTVTSGGTESLLLAMKTYRDTAPEAVVPVSAHAAFDKA---AQYFGIKLVRTPLDADYRADVAAMREAITPN----TVVVAGSAPGYPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFLEGVTSVSADTHKYGYGATSVILYRRPDLLHYQYFIAADWPGGLSRPGALSATAWAAMEGYLDATRRILQAADRLKAGVRAIP-ILGDPLWVIAVASDEYQVMEEMAGRGWRLNGLHRPPAFHVALTLRHTEPGVVDRFLADLQDAVAQ 472
37 -20.3005k1r_A mol:protein length:480 Burkholderia pseudomallei sphingosine-1-phosphate lyase Bpss2021  ali model follow..  14  60....GDHEHYAFLNEAYGLFSHVNALQ--RDLCPSMNRMESEIVAMTHRACGALSLGGTESILNATLAYREKA-RMIWPASAHPAFRKA---AHLFGFDVTVAPIDPVTMQVDADFVRDAVDAN---TVMLVGSACNYPYGTI---DPIGALSAIAVEKDVWLHVDGC--LGGWMLPWGEALGYLPGVTSISADTHKFGYGPKGGLAWRDASFRRHQYFLMTDWVGGGSRSGGLIAATWAALEGYLARAKAIFETAFDMQAAVRAIPELRVLGKPTFCFAFTSDHVNDFMRQRGWRFNGLQHPDALHMCVTGPQTQPGVAERFRQDLGEAVEH 427
38 -20.2002qma_A mol:protein length:497 Diaminobutyrate-pyruvate transaminase and L-2,4-diaminobutyrate decarboxylase  ali model follow..  15  117...............AAEAMIAANQSMDSWDQASSATYVEQKVVNWLCDADGIFTSGGTQSNQMGLMLARDW--RIVCSKKSHFTVQKSASWMGLGEKAVMTVDANADGTMDITKLDEVIAQAKAEIPFAIVGTAGTTDHGAI---DDLDFIADMAVKHDMWMHVDGAYGGALILSSHKSRLKGVERAHSISVDFHKLFYQTCGALLVNDKSNFKFLLHHADATTKRFDALKVFMTMQNVGPKALGDMYDHLLAQTLEVADMIRTND-LLAEPSLSTVLFRATHETADALRLEALTRGTIVDGKTALKFILNPCLTTSDFESLLSKINMLAVE 495
39 -20.0005eud_A mol:protein length:514 Putative sphingosine-1-phosphate lyase  ali model follow..  15  113.............IAFLNEVYALQSQSNPLHPDPSTAKFEAEVVAMTGTVCGTVTSGGTESLLLAMKTYRDTAPEAVVPVSAHAAFDKA---AQYFGIKLVRTPLDADYRADVAAMREAITPNT-----VVAGSAPGFPHGVV---DPIPEIAALAAEHGIGCHVDGGFILPWAERLGYPVPPFLEGVTSVSADTHKYGYGAKGTILYRRPDLLHYQYFIAADWPGGGSRPGALSATAWAAMEGYLDATRRILQAADRLKAGVRAIP-ILGDPLWVIAVASDE-QVMEEMAGRGWRLNGLHRPPAFHVALTLRHTEPGVVDRFLADLQDAVAQ 468
40 -19.9004rit_B mol:protein length:486 Pyridoxal-dependent decarboxylase  ali model follow..  17  97.....MPATMAILGDLVAAAVNNNML--SLEMSPSFSRLETLLAGLFGQAGGVLTSGGSLANLQALAVARNV--VIFASEAAHTSLQKAAMLLGLGTAAVIPVRATADSRMDPEDLRARIDQARGAHPFCVVATAGTTTTGNI---DPLAEIGAIAREHGLWFHVDAA--YGGALVFSERHRWRLAGIDSITFNPQKWLYVACAMVLFRDAGVLERAFRIPAQGTRHADVVKLWLTLQHIGQQGYARLIDDGYRLAERVVEGVRQRP-LAGEIDTNIVCFRGEPDWLPALQALLLREGPVYRGGRWLRALLNPYTTDAVIDAMFKQIDRFAGR 480
41 -19.9002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  14  48ITVWCGNDYLG-HPVVLAAMHEAGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLRVPGLIIYSDSLNH--------ASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGP---IKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAELMHRIDIFNGTLAKAYGV-FGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAEGQKLRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIPVHTKAVSDMLLSDYGVYVRGTERLRFTPSPVHDLKQIDGLVHAMDLLWAR 399
42 -19.8004obu_E mol:protein length:490 Pyridoxal-dependent decarboxylase domain protein  ali model follow..  14  102.....PASSVSWLGDIMTSAYNIHAG--GSKLAPMVNCIEQEVAKQVGFTEGVFVSGGSMANITALTAARDN--TAYISDQTHSSVAKGLRIIGITDSRIRRIPTNSHFQMDTTKLEEAIETDKKSIPFVVIGTAGTTNTGSI---DPLTEISALCKKHDMWFHIDGA--YGASVLLSPKYKSLLTGTDSISWDAHKWLFQTCAMVLVKDIRNLFHSFHVNPELTRPARGLKLWLTLQVLGSDLIGSAIEHGFQLAVWAEEALNPKK-IVSPAQMAMINFRYAPKDLTKISHRILESGTVLNGKTVLRIAIHPEATQEDMQHTIDLLDQYGRE 482
43 -19.6004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  16  28...IASENITSLATDFMHRYAEGLPGKRLYQGCKYIDEVEELSKELFKAEHAVQPTSGVVANLAVFFAETKPGDKLMAPDGGHISHWKVSAAGIRGLKVINHPFDPEEMNIDADAMVKKILE----EKPKLILFGGSL----FPFPHPVADAYEAAQEVGAKIAYDGAHVL-GLIAGKQFQDPLREGAEYLMGSTHKTFFGPQGGVILTTKENADKIDSH--VSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVLCTESHQVIIDIIEFSASELAKMYEEANIILNKNLLIRLCTRLGMKEKEMEEIAEFMKRIAID 392
44 -19.6003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  10  100..............DISAVQPKAAGSSLLNKITNSLVLDIIKLAGVHTVANCFVVPMATGMSFLTLRHKRPKAKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELG-PDCILCIHSTTSCFAPRV--PDRLEELAVICANYDIPHIVNNAYGVQSSKCMHLIQQGARVGIDAFVQSLDKNFMVPVGGAIIFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLNERLLHTPHNPISLAMSMQTVSGYTFRGFMSHTNNYPCAYLNAASAIGMKMQDVDLFIKRLDRCLKA 460
45 -19.5003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  11  69.............EPECDKLIMSSINKNYVDMDPVTTELQNRCVNMIETAVGVGTVGSSEAIMLAGLAFKRKW-NIVTGANVQVCWEK--FARYFEVELKEVKLSEGYYVMDPQQAVDMVDEN----TICVAAILGSTLNGEFEDVKLLNDLLVKETGWDTPIHVDAA-SGGFIAPFLYPELEWLPLVKSINVSGHKYGLVYAGIVIWRNKEDLPEELIFHINYLGAFSKGSSQVIAQYYQLEGYRNVMENCRENMIVLREGLEKTE-IVSKDEGVPLVAFSSCHTEFEISDMLRRYG--AQHITVLRVVIREDFSRTLAERLVIDIEKVMRE 443
46 -19.5005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  12  58VTVWCSNDYLA-HPEVLDAMHKTKYGCGA-GHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKMKDIFSDELNH--------ASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPKSVPKLIAFESVYSMAGSVAD---IEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEVMDRVDMITGTLGKSFGS-VGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIVPVLIGNADLAKQASDINKHQIYVRGTERLRITPTPGHTNDLSDILINAVDDVFNE 429
47 -19.5003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  12  28LLDYSSNNPLGIPKSFLNNIDEGIKNLGVY-PDVNYRRLNKSIENYLKLKDIGIVLGNGASEIIELSISL---EKILIIVPSYA---EYEINAKKHGVSVVFSYLDENMCIDYEDIISKIDDVD-----SVIIGNPNNPNGGLINKEKFIHVLKLAEEKKKTIIIDEA-FIEFTGDPSSSFVGEIKNYSCLFIAMTKFFAMPFGYGITNNKEIAAKIKAKQN-----WNINCFAEMAAINCLKDTNYIEESLLKERKRFIEELNKIGFRVFSPHANFVLCRLENISGEKLYDSLLKEDIVIRRDSFVRFAIK---DEKKNTKFLRALKGVENN 360
48 -19.3005k8b_A mol:protein length:403 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase  ali model follow..  15  7...FGPEEKQEVADVMEHGFTFRYNFDHMRNDRWKTRDMEQLLCEKMNVKHAHLLSSGTAALQTAMMAAIGAGDEVIVPPFTFVASVEA----FMAGAVPIFAEIDETLCLSPEGIEAVITPRTKAINLVHMC-----------SMAKMDEIKAICKKHNLVLLEDACQAIGGSYK-GQALGTIGD-VGCYSFDSVKTITC-GGAVITNNTEIYDNAHMFSPIMGLNFRISEMNAALGLAQLRKLDTIIDIQRKNKKAIKDAMASIPEVSFREIPDLSFMLPTEARTQEISKKLAANGV-AIMSRTISMLIKLSWTDAQIAERIENIKKAFAQ 395
49 -19.2003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  16  45...IASENFVPRASVLTNKYAEGLPGRRYYGGCEHVDVVEDRAKALFGAEFAVQPHSGAQANAAVLHALMSPGERLLGANGGHLTHGMRLNFSGKLYENGFYGVDPATHLIDMDAVRATALE----FRPKVIIAGWSAYPRVL----DFAAFRSIADEVGAKLLVDMAHFAGLVAA---LHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFAD--SGARIIADRLMAPDVAKAGTDVHLVLVDLRDSPLDAAEDLLHEVGITVNRNAVLRILATRGFGDTEFTEVADIIATALA. 406
50 -19.2005i90_A mol:protein length:427 PvdN  ali model follow..  15  53YLHFANFLLTSHPRPVREAIFDRNPGEAVD--WKYEDEARAWAGRYFAPGQVALTGSTTDGAAIYGGLLVQPGKEILTSSHEHYSTYTT--RHKRMGTQVREFPLFKDPHRVSADEILSSIAAQIRPQTRVLGMTWQSGSGVKLPIREIGKLVR-DEQDRIIYVVDGVH---GFGVEDVSFADF--DCDYFIAGTHKWLFGPRGGVIIARSEQLQEH---LMTPGGYHAFEHRLALGTAFELHLQLGKQARIHQLNAYLKQRLGEHPKV-PELSSGFTFFRVEGRDCEAVAKHLMAHRVISDVGPVVRLAPSLLNDEAEIDRVLEILAPQLA. 427
51 -19.2003lvj_A mol:protein length:423 Cysteine desulfurase  ali model follow..  17  18.IYLDYSATTPVDPRVAEKMMQFMTMDGTFGNEEAVDIARNQIADLVGPREIVFTSGATESDNLAIKGAAKKGKHIITSKTEHKAVLDTCRQLEREGFEVTYLAPQRNGIIDLKELEAAMRDDTILVS----IMHVNNEIGVVQD---IAAIGEMCRARGIIYHVDATQ---SVGKLPIDLSQL--KVDLMSFSGHKIYGPKGIGALYVRRK--PRVRIEAQMHGGGHERSGTLPVHQIVGMGEAYRIMATEMERLRGLRNRLWNGIKDIEEVYLNILNVSFNYVEGESLIMALKDLAVSSGSASSIRFSLGRFTTEEEIDYTIELVRKSIGR 392
52 -19.1003mc6_A mol:protein length:497 Sphingosine-1-phosphate lyase  ali model follow..  14  77.....GDDLIHLQTIAYEKYCVANQLH--PDVFPAVRKMESEVVSMVDTGCGTTTSGGTESLLLACLSAKMYA-EIIAPVTAHAGFDK--AAYYFGMKLRHVELDPTTYQVDLGKVKKFINKNT-----LLVGSAPNFPHGIA---DDIEGLGKIAQKYKLPLHVDSCLGSFIVSFMEKAGYK-VPGVTSISCDTHKYGFAPKGSIMYRNSDLRMHQYYVNPAWTGGLSRPGAIVVGCWATMNGYIESCQEIVGAAMKFKKYIQENI-IMGNPRYSVISFSSKTLNIHELSDRLSKKGQKPVALHMAFTRLSAHVVDEICDILRTTVQELKSE 440
53 -19.0005o5c_A mol:protein length:519 Putative decarboxylase involved in desferrioxamine biosynthesis  ali model follow..  12  113.....PVVLPSLLAEQIMAAVNSSVD--TWDQSAGGTLIEQKVLSRIGLPAGIFTSGGTQSNLMAMLLARDS--RVFTSKLSHFSIQKSMAILGLGYDAVIPVDYDERYRMDVDCLKQEVQRCLQQIPVAVVATSGTTDFGSI---DPLGAISELCKHHGMWMHVDAA--YGCGLLVSESHRPRLAGIDSVTVDYHKSFFQTCGAFFVRDKHHLSHVTHHADQTTRRFDALKMWLTLRVSGPMALGNAFDDILALTQIAHQLLNAHP-VLHVPELTTQIFRYVDEINTNIRKAVFRSGTKVNGRQYLKFLLNPNTTAADIEDVIALIVHYGRE 507
54 -18.9003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  17  71IISLGIGDTTEPLPKIADAMAKAREGYSGYGAEQGQGALREAVASTFYGHDEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHFFPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAA-ISNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLTVVPKALKYRVMTTCFNGASNIVQAGGLACLQPEGLKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPIWVGFPGKPSWDVFAEILERGYGPAGEGFVRA--SAFGSRENILEAVRRFKEAYGK 439
55 -18.9002po3_A mol:protein length:424 4-dehydrase  ali model follow..  16  32.............ARLYERLDRALDSQWLSNGGPLVREFEERVAGLAGVRHAVATCNATAGLQLLAHA-AGLTGEVIMPSMTFAAT--PHALRWIGLTPVFADIDPDTGNLDPDQVAAAVTPRTSAVVGVHLW-----------RPCAADQLRKVADEHGLRLYFDAAHALGCAVD-GRPAGSLGD-AEVFSFHATKAVNA-GGAVVTDDADLAARIRALHNAGGTNAKMSEAAAAMGLTSLDAFPEVIDRNRRNHAAYREHLADLPGVLVADHDQYVIVEIDEATTDLVMEVLKAEGVHTRAARVLSLPTGTAIGDDDIRRVADLLRLCATR 385
56 -18.8004ixo_A mol:protein length:380 NifS-like protein  ali model follow..  12  3MIYLDHNATTFIDPRVKEFIISSSAHSSGRFAKNLIETVRAQIATALGEYDITFTSSGTEGNNLIMKNFYD--GDIFISAIEHLSIYN----HINYAPNIKVISVNTQGLVDLEHLEELLAQSNTSKKLVSIIMANN-ESGVLQD---IAEIGKITKKYEAKFHSDLVQ---GFGRIPINIKAL--GLDFATISGHKIGGGQGGAALISSSNMIIGGGQEKSVRSGTENVLAIFGLASALRTDNISENYIKIKKLQENLEKKLKKYPNVNIVSNNNTTLITIPNTDAQAKLIGFDLHNICVSSGSAIRISLSHTNTVRDIEAFIEAFEEIYDV 371
57 -18.8003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  18  32...IASENFVSEGSVLTNKYAEGYPGRRYYGGCEFVDVTEDRAKALFGAEHVVQPHSGPQANMAVYLVALEMGDTVLGSHGGHLTHGAPVNFSGKFYNFVEYGVDKDTERINYDEVRKLALE----HKPKLIVAGASA----YSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAA---LHPNPVEYADFVTTTTHKTLRGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNFKT--KNAKVLAEALINEGFRIVSGGTDVDVKGSIGLTGKEAEETLDSVGITCNKNTIIRLATTRGFDEKAFEEVAKIISLALKN 390
58 -18.7003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  12  37....SNENPFGTPPKAIECLRQNANKAHLY-PDDSMIELKSTLAQKYKVQNENIIIGAGSDQVIEFHSKLNSKNAFLQAGVTFAMYE----YAKQCGAKCYKTQSITHNLDEFKKLYETHKDE----IKLIFLCLPNNPLGECLDASEATEFIKGVNEDCLVV-IDAAYNEFASFKDSKKHLEPCELIKLYLGTFSKLYGLGGLRI-IANANIISAFYKLRA-----FNVSNLALKAAVAAMDDDEFTEKTLENNFSLYKEFAKKHNIKIIDSYTNFITYFFDEKNSTDLSEKLLKKGIIIYGLNAIRITIG---TSYENEKFFTEFDKILR. 365
59 -18.6001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  17  29...IASENFVSRGSVLTNKYAEGYPGRRYYGGCEYVDIVEERAKQLFGAEHAVQPHSGAQANMAVYFTVLEHGDTVLGSHGGHLTHGSPVNFSGVQYNFVAYGVDPETHVIDYDDVREKARL----HRPKLIVAAASA----YPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAA---LHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKA--DNAKRLASALQNEGFTLVSGGTDLVDLRPQQLTGKTAEKVLDEVGITVNKNTIIRIVTTRGFGLEEMDEIAAIIGLVLKN 386
60 -18.5003ju7_A mol:protein length:377 Putative PLP-dependent aminotransferase  ali model follow..  15  14...........PVIEYLDELKEIDASHIYTNYGPINQRFEQTIMSGFNRGAVTTVANATLGLMAAIQLKRKKGKYALMPSFTFPAT--PLAAIWCGLEPYFIDISIDDWYMDKTVLWDKIEE----LKEEVAIVVPYATFGSWMNLEEYEELE----KKGVPVVVDAAPGFGLMNG-GMHYGQDFSGMIIYSFHATKPFGI-GGLIYSKNEEDIQRIKRMGNMMGFNCKMSEYAAAIGIATMKKWDDKLKERTRISEWYKQLLQSNGLMKKGWQLQMPILCPEEVRNKQVIEDLKKQKIEARAKRIVSLPLWEGMTKEIVEQIVICLGQKVVS 374
61 -18.4004e1o_A mol:protein length:481 Histidine decarboxylase  ali model follow..  15  92.............PSLLGDMLADAINCLGWASSPACTELEMNVAKMLGLPEGVLQSTVSESTLIALLAARKN--VAYASDQAHSSVEKA---GLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRVPVFVCATLGTTGVCAF---DCLSELGPICAREGLWLHIDAA--YAGTAFLCPEFRGFLKGIDSFTFNPSKWMMVHCTGFWVKDKYKLQQTFSVNPPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDP-IPAKRHLGLVVFRLPNSLTENVLKEIAKAGATIQDKLIIRFVTSQFTTRDDILRDWNLIRDAATL 477
62 -18.4004k2i_A mol:protein length:443 NTD biosynthesis operon protein NtdA  ali model follow..  12  71FLPVDRLITNDEVEDILNTLTEV-LPTGKFTSGPYLEQFEKVLSTYLHKRYVIATSSGTDAIMIGLLALLNPGDEVIMPANSFSAT--ENAVLASGGVPIYVDINPQTFCIDPDKIEEAITPYTKFILPVHLY-----------KHSDMQHIRQIANRYKLKVIEDACQ------GIGLTDLGKYADITTLSFNPYKNFGV-AGAIATDNEELAKKCIQFSYNFGFNSKMDNLQAAIGLERMKYLSLNNFKRLFLADRYITQLAELQNKGYIELPHLFPIKVRTEDRADIMTKLNEDF--KAHSQVLHLPLYPSFTLEEQDRVMEGLFHVIKQ 439
63 -18.4001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  15  26LLDFSANNPLGMPVSVKRALIDNLDCIERY-PDADYFHLHQALARHHQVPASWILAGNGETESIFTVASGLKPRRAMIVTPG-FAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLD-----CLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEA-FIDFIPHETGFIPALKDNPHIWVLSLTKFYAIPGGYLVNSDDAAMARMRRQQM-----WSVNALAALAGEVALQDSAWQQATWHEEGARFYQALCQLPLTVYPGRANYLLLRCERE-DIDLQRRLLTQRILIRDSRYYRVAIR---SAAQNERLLAALRNVLTG 359
64 -18.3001js3_A mol:protein length:486 DOPA decarboxylase  ali model follow..  16  87.............PAMLADMLCGAIGCIGWAASPACTELETVMMDWLGEGGGVIQGSASEATLVALLAARTK--VAYASDQAHSSVERA---GLIGGVKLKAIPSDGKFAMRASALQEALERDKAAIPFFVVATLGTTSCCSF---DNLLEVGPICHEEDIWLHVDAA--YAGSAFICPEFRHLLNGVDSFNFNPHKWLLVNCSAMWVKRRTDLTGAFKLDPPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDP-VCAEVTLGLVCFRLSDGLNEALLERINSARCRLRGQFVLRFICSRKVESGHVRLAWEHIRGLAAE 473
65 -18.3006blg_A mol:protein length:379 dTDP-4-amino-4,6-dideoxygalactose transaminase  ali model follow..  15  4MIPFNAPPVV---GTELDYMQSAMNSGKLCGDGGFTRRCQQWMEQRFGTAKALLTPSCTASLEMAALLLIQPGDEVIMPSYTFVST--ANAFVLRGAKIVFVDIRRDTMNIDETLIEAAITDKTRAIVPVHYA-----------VACEMDTIMAIADKYNLFVVEDAAQGVMSTYK-GRALGTIGH-IGCFSFHETKNYTA-GGATLINDRTLVERAEIIREKIGSSYLMSDLQAAYLWAQLEAAERINQQRLALWQNYYDALLPLARA-CGQNAHMFYIKLRDIE-SRLIAWLKEAEILAVSERLVRLPLFYNLSVVNQRTVINSLLSYFS. 379
66 -18.2004piw_A mol:protein length:396 TDP-4-keto-6-deoxy-D-glucose transaminase family protein  ali model follow..  15  15MIPFNAPPVV---GTELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLEMAALLLIQPGDEVIMPSYTFVST--ANAFVLRGAKIVFVDVRPDTMNIDETLIEAAITDKTRVIVPVHYA-----------VACEMDTIMALAKKHNLFVVEDAAQGVMSTYK-GRALGTIGH-IGCFSFHETKNYTA-GGATLINDKALIERAEIIREKIGSSYLMSDLQAAYLWAQLEAADRINQQRLALWQNYYDALAPLAKA-CVQNAHMFYIKLRDID-SALINFLKEAEIMAVSERLLRLPLFYNLSPVNQRTVIATLLNYFS. 390
67 -18.2004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  16  39...IASENVVSKATLLTNKYAEGYPGKRYYGGTAVIDVVEERAKKLFGAKFAVQPHSGSQANAAVYMSLIQPGDTVMGSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKE----VRPKLIVAGASAYSRII----DFAKFREIADAVGAYLMVDMAHIAGLVAS---HHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGEN-KNAAAMADVFNQHPDFRTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIIRVITSRGMGEAESRQIAEWMVEALEN 398
68 -18.2004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  16  33...IASENFVSPAALLTNKYAEGYPSKRFYNGCEEVDKAEERVKKLFNCKYAVQPHSGSQANQAVYLALLQPGDTVLGDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADL----HKPKLLIAGFSAYPRNI----DFAKFREIVDKVGAYFMADIAHIAGLVAT---EHQSPIPYAHAVTSTTHKTLRGPRGGLILSNDHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQ-SNAKALASSLQERGYDILTGGTDLVDLRKDGITGKLAANSLDRAGITCNKNAIIRLCTTRGFKEKDFVLVGHMVADILDG 391
69 -18.1003wco_A mol:protein length:392 L-seryl-tRNA(Sec) selenium transferase  ali model follow..  13  27.........APLSKDVINFISEIANG-EEGKRGSRIAHIEKYLNELTGAESSFVVNNNAGAVFLVLNTLAEGKEVIISRGELVEIGGSFRIPDIMKKSGAILREVGYYNKTKVSRYEGAINQN---TALLMKVHKSNFPMEGFVEEVKLEDLVKLGHKYGIPTYYDAGKEFGISVDEPNFRDCISLGIDLVSGSGDKLLGGPQAGIIVGKKNLIEKIK--KNPIARALRIDKLTLSGLEMTLKLYFEKRYEDRQKAKRLEKLLKDIPGL-LELPTYCVAIRHDRLSSQELSRRLRLAEIVCRIREDQLLFDMRTVFHEDLKTIKKTLQELLS. 391
70 -18.1003rbf_A mol:protein length:480 Aromatic-L-amino-acid decarboxylase  ali model follow..  16  87.............PAMLADMLCGAIGCIGWAASPACTELETVMMDWLGEGGGVIQGSASEATLVALLAARTK--VAYSSDQAHSSVERA---GLIGGVKLKAIPSDGNFAMRASALQEALERDKAAIPFFMVATLGTTTCCSF---DNLLEVGPICNKEDIWLHVDAA--YAGSAFICPEFRHLLNGVDSFNFNPHKWLLVNCSAMWVKKRTDLTGAFRLDPPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDP-ICVEVILGLVCFRLSNKVNEALLQRINSAKCHLRDKFVLRFICSRTVESAHVQRAWEHIKELAAD 473
71 -18.0005wt2_A mol:protein length:401 Cysteine desulfurase IscS  ali model follow..  15  5.IYLDNNATTRIDPKVKEIMDPF---RDHYGNHPAIAEALDKLYKGINIDDVIITSCATESNNWVLKGVYKGKNHIVTTVAEHPAVRSTCNFLESLGVEVTYLPINEHGSITAEQVREAITEKTALVS----VMWANNETGLIFP---IEEIGAICKEKGVLFHTDAVQ---AIGKIPVDVLKA--NADFLSFSAHKFHGPKGIGGL-----YIRSGVGLTPLFHGGEHMNGRMGEAMKLAVEHLDYEKEVVGKLRDKLEEALLKIPDVMVVGDRNTTLVSVRGIEGEAMLWDLNRSNIAASTGSAIRLSLSRFNTEAEIDKTIEVFSQAAVR 379
72 -18.0004j8l_A mol:protein length:361 Uncharacterized protein YhfS  ali model follow..  13  48...............................QPRVTQRVEQVLADAFAQAAALVQGAGTGAIRAGLAALLKPGQRLLVHDAPV-------------YPTTRVIIEQMGLTLITVDFNDLSALKQVVDEQQPDAALVQHTRQQPQDSYVLADVLATLRAAGVPALTD-----DNYAVMKVARIGCECGANVSTFSCFKLFGPEGVGAVVGDADVINRIRATLYSGGSQIQGQALEVLRGLVFAP----MHAVQAGVSERLLALLNG-SAVIANAQSKVLIVEFHQPIAARVLEEAQKRGALPYEHCAIRI----NPNRSGEETVLRILRESIAS 360
73 -18.0002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  15  58VISLGIGDTTEPIPEITSAMAKKIEGYSGYGAEQGAKPLRAAIAKTFYGGDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENGFFPDLSTVGRTDIIFFCSPNNGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEAMETSFSKYAGFTGVRLTVIPKKLLNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPVWVHFPNQSSWDVFAEILEKGFGPGGEGFVRV--SAFGHRENILEACRRFKQLYK. 426
74 -18.0001ecx_A mol:protein length:384 AMINOTRANSFERASE  ali model follow..  15  3.VYFDNNATTRVDDRVLEEMIVF---REKYGNNLHMEKAREKVAKVLGPSEIFFTSCATESINWILKTVAKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRGVVKLEELEKLVDEDTFLVS----IMAANNEVGTIQPVEDVTRIVK-KKNKETLVHVDAVQ---TIGKIPFSLEKL--EVDYASFSAHKFHGPKGVGIT-----YIRKGVPIRPLIHGGGQERGLAARAMEIAVEELSEAAKHMEKLRSKLVSGLMNLGAHIITPLENTLSVSFPNIRGSTLQNLLSGYGIYVSTSSAIRISLCKYNTEEEVDYFLKKIEEILSF 375
75 -17.8002okk_A mol:protein length:497 Glutamate decarboxylase 2  ali model follow..  11  98.....GLDMVGLAADWLTSTANTNMF--TYEIAPVFVLLEYVTLKKMREGDGIFSPGGAISNMYAMMIARFK--IAFTSEHSHFSLKKGAAALGIGTDSVILIKCDERGKMIPSDLERRILEAKQKVPFLVSATAGTTVYGAF---DPLLAVADICKKYKIWMHVDAA--WGGGLLMSRKHKWKLSGVNSVTWNPHKMMGVPLSALLVREEGLMQNCNQMHAQCGRHVDVFKLWLMWRAKGTTGFEAHVDKCLELAEYLYNIIKNREVFDGKPQHTNVCFWYIPPSLRVIKARMMEYGTTMVSYQPLGVISNPAATHQDIDFLIEEIERLGQD 497

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.