current user: public

If you have questions about the server, please let us know.

Query: 4bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# Score Template Links and tools%idFirst GSSSSGLVPRGSHMASTEAAAQPHALPADAPDIAPERDLLSKFDGLIAERQKLLDSGVTDPFAIVMEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSASVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIGLLast
1 -113.0004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model  100  1GSSSSGLVPRGSHMASTEAAAQPHALPADAPDIAPERDLLSKFDGLIAERQKLLDSGVTDPFAIVMEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSASVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIGL 436
2 -110.0002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  99  1................TEAAAQPHALPADAPDIAPERDLLSKFDGLIAERQKLLDSGVTDPFAIVMEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEPAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIGL 420
3 -107.0002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  74  2.....................................DLLSKFDPLIAEREALLATGVRDPYAIVMDKVLSPTEAMINGRKTILLGTYNYMGMTFDPDVIAAGKQALDEFGSGTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPAEAGKLVVLEGVYSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEEAGVEADVDFVVGTFSKSVGTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHAGDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATGVI.. 398
4 -103.0003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  35  5.......................................LGEKISQFKIVEELKAKGLYAYFRPI--QSKQDTEVKIDGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPEDSAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLNDDVDLIMGTFSKSLASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLG--ATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAEVETL 397
5 -102.0005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  25  1..........................AAAAANHSTQESGFDYEGLIDSELQKKRLDKSYRYFNNINRKEFPLAHRQREADKVTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPKSVPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVI--PNPSHIVPVLIGNADLAKQASDILIKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQLP.. 433
6 -100.0001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  33  6.......................................GEFYQQLTNDLETARAEGLFKEERIITSAQQADITV-ADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEAREARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTLGKALGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLA--GADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVIA. 401
7 -99.9003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  30  1...................................SNAMQEILSQLNKEIEGLKKAGLYKSERII--TSPQNAEIKVGEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADEKRFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYCGVADRVDILTGTLGKALGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEPQLRKQLQENSRYFRAGMEKLGFQLV--PGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGAI.. 399
8 -99.2002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  32  1.......................................MDYNLALDKAIQKLHDEGRYRTFIDIEREKGQWNRPDGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDPAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQRDAQQMHAKVLKMRLKALGMPII--DHGSHIVPVVIGDPVHTKAVSDMLLDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA.... 401
9 -98.9005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  30  1.......................................MNLLDTLQRGLADLDAQGLRRVRRTA--DSACDAHMTVNGREIVGFASNDYLGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHADTATLGALLEACTSQ-TKLIVTDTVFSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALAAAALRSPHLVYVGTLGXAAGVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEARRAHLAALIERTRALLRRTRWQPV--DSHTAVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA..... 393
10 -98.6005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  29  3.......................................MHLLDTLAEGLKEIDARGLRRRRRTA--DTPCAAHMTVDGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDTDALSAMLEASDAD-VKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIAQAALRSPNLISIGTLDKAAGVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEARRAHLQQLIGRTRAMLKATPWLPV--DSHTAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA.... 396
11 -98.3001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  27  1.......................................MSWQEKINAALDARRAADALRRRYPV--AQGAGRWLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPG-QQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKV--KPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEARREKLAALITRFRAGVQDLPFTLA--DSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG........ 384
12 -98.3003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  23  21...............................................PDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHG---PGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIR---SESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF... 400
13 -98.0002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  23  7...............................................PDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRHG---PGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTIR---SESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF... 386
14 -97.3003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  32  22.......................................LSPLAWLADIEQRRRAEGLRREL-----------RVRPPVAAELDLASNDYLGLSQHPDVLDGGVEALRTWGGGAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDACRLSRARVVVSPHRDVDAVDAALAART-EERAVVVTESVFSADGDLAPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHEVGLAGAPDVMTTTLSKALGSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALRVLDAEPQRARAVLDRAAELATIAGVTE------APVSAVVSVILGDPEIAVGAAAACLDRGVRVGCFRPPTVPAGTSRLRLAARASLTDDEMALARQVLTDVLATAR.... 397
15 -96.0004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  25  17........................................NAMLNLQDKYTQYQRDNLLREL-----------TPFIKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYDG-----KSFITTEGVFSTSGSITQLDKLAKITPEK---LIVDEAHSFGVLGKNGRGAINSFRISKNCLICVFPLGKAFGGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELV-SKDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEYIRS. 392
16 -29.1002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  15  2..........................................................................FKRETKDFINIDPLQTGG-----KLTEEARQALLEWGDGYSVCDFCT-TPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTTPENFAQTIEETKKRGEVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEI--------GADFIVGSGHKSMAASGGVMGMKEEWAEIVLRRSEKYLLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNHLYEISKKAKGGRFFLYRELKSRKIHG------IKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIEKYS.... 371
17 -23.1002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  20  3.............................................................................SDKIMIDLRSDTVTK---TEEMRKAMAQA--------EVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVAVLSGVMPHPVPGKNPDDVRKAIRPRNIHRTSLIAIENTHNRSGPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKE---YAGYADSVMFCLSKGLCAVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALT---KMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKNAHGFIEALRNSGVLA-------NAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS.... 349
18 -21.8004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  16  1.................................................................................MIDLRSDTVTR---SRAMLEAMMAA--PVGDDV-------GDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHFARTKLLSLENTHNGKVLPLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALK---NNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRV---GEENAAALGEYMKARNVLIN---------ASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR...... 333
19 -21.5003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  16  1.................................................................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPTKLLSLENVLPRE----YLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALK---NNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRV---GEENAAALGEYMKARNVLIN---------ASPIVRLVTHLDVSREQLAEVAAHWRAFLAR...... 333
20 -21.2005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  14  52.........................................................................................LNPIQRGGILPKEAKKAVYEYWDGYSVCRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYENLEGYKEVIDNLEDKGKGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEV--------KADFIVASGHKSMASAPGILAFSEEFSDKITKTSEKFMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGKQLGIKPKEHDLIKFETPDKRRGFFFYDELKKRGIGGIRA------GVTKEIKMSVYGL-EWEQVEYVVNAIKEIVESCK.... 411
21 -20.8003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  17  2.............................................................................SHMRYIDLRSDTVTQ---TDAMRQCMLHA--EVGDDV-------GEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHSAVLGSVALQPVPMQADGSLALADVRAAIAPDDVHFTPTRLVCLENTHNGKVLPLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRE---LVAPFDSVSICLSKGLGAVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQ---QHVVRLADDHRRARQLAEGLAALGIRLDLAQVQTNMVFLQL-TSGESAPLLAFMKARGILFS---------GYGELRLVTHLQIHDDDIEEVIDAFTEYLGA...... 341
22 -20.7006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  15  48.............................................................................SGAYLTDPDGRRWIDFDGDEEVAEAIARAARG------RSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVDARDRSIVLSSGYHGYHCDEPFTPNQHGIVEFLFDLDVLAEWLSRPEQ---AAVVISPDHMHLGE---YTEFTRLTKEADVPVIADEV----KVGLRYRAGLSTPLLDPAV-----IVAKCLA--NGSVGGDAHLLAALEDVSFTSYFE----PTAMAAATTTLRRMATG-EPQQAIRAAGDRFIAHTRAAFANAGVLAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFE-------------NQTPSAAFTDEVVEDACGRIDRVSAALT.... 389
23 -20.3004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  17  36...............................................................................KIAARIGANE---FGPAPSVLLAIRQAAGDTWKYADPE---------NHDLKQALARHLGTSANIAIGEGIDGLLGQIRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADREDLEGLLAAVGRENAPLVYLANPDNPMGSWWPAERVVAFAQALTTLLVLDEAY-CETAPRDALPPIESLIDKPNV-IRARTFSKAYGLAGGYTLSTPGTAQAFDKIRNHF----GMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDASYARAIVDRLMSDHGIFIRMPGVAPLNR----IRISTA---PDAEMDLLAAALPEVIRSLA.... 374
24 -19.5003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  13  22................................................................................................PRNVGVLTEALQNIDDNLESD--IYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADENRRVAYHPLSHLEIHEQKELQQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGGQLPALEKISEYCHEQGISLHLDGARLWEITPFYQKSAEE---ICALFDSVYVSFYKGIGGAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFE---KRIGKMAEYFEAAKGLAERFNSCGVKTVPEVPVSNMFHVYFENSADEIGLTKIQDETGVGISGYLQEKS-ADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL..... 359
25 -19.5006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  13  45.............................................................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPER---AAVVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVA-TGEPQRAVREAGDRFLRHARKALDDASLIAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL..... 387
26 -19.4004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  16  59.............................................................................GGCLLRDVEDGEIIDLNADREVLDAVADQFAK-GHMTGLP------HELDARAGALIAELVPGVEQVRFNSGTEAVASALRATTGRTLVVTFEGHYHGW-SETVLRAGAHTVQLGWNDPDALRELFARDGDRIAAVIV-EPVLANAGVIPPLQLLRELTGRSGAMLVFDEV--TGFRVARG-GAQERYGVEPDL----TVLSKVMG--GGFFGGRRHAMRMLASNEAHHAGVYAGNHAALRAVVAMLGKIRSLPDLYERLEDTGQYMEDTVREVFATEKRPVHINRVGTLMLVDFPRHRRLQTLAQKEGVYFHP---------NALEPWFLSTAHTRDVIDKVAGALQRSLVGLG.... 458
27 -19.4001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  13  11.............................................................................AKPKPYSFVNDYSVG---HPKILDLMARD-------NMTQHAGYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHEAIEATGHKVVTAPCPDVADIESALHENRSEHPKLVYISTQYTKQ----ELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLA-DIARLTDMFYIGATKAGGMGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMK------ELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPIL--ENTMIAELNNDFDMYTVEP-------LKDGTCIMRLCTSWATEEKECHRFVEVLKRLVASTA.... 359
28 -19.3001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  14  25...............................................................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAY-YHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAENIAYICLAVTVNLAGSMANMRAVRELTAAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAV--FLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDI.. 434
29 -19.3003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  14  27.........................................................................RLENPQHTVINLSIGD--TQPLNASVAEAFASSIARLSSPTTCRGYDFGLPALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQEN-AFFPEFPEDTHIDILCLCSPNNPTGTVLNLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGGWTVIPQELTYADGHFVIQDWTFNGASIPAQEAGVAGLS--LPQLEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQANISDRDLFDFFLRE---YHIAITPGIRSGSGFVRFSSLG--KREDILAACERLQMAPALQS.... 394
30 -19.3006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  13  29.............................................................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPER---AAVVVSPDHMHLSP---YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVA-TGEPQRAVREAGDRFLRHARKALDDASLIAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL..... 371
31 -19.2003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  14  14..........................................................................................GQISGHGKRNVGVLKTAFAAVADEMASDQY-GTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQKELHPIETILVGAADRLMTLDEIKALPDIACLLLELP---EIGGVAPALETISRYCRERGIRLHLDGARLFEMLPYYEKTAAE---IAGLFDSIYISFYKGLGGAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYE---LRKDRMGQYYEQAKQLAEQFNALGVHTTPEVPVSNMFHLHFDGQAADISLEQVQEETGLGFVG------YLVDKDGYCSTEISVGDAYGELDQQTRDAGFARL..... 352
32 -19.1006DK6 Entity 1(prereleased)  ali follow..  16  34.............................................................................AAQRLIRCGIGD--TEALPEAVRYAMHEAVDELGNRSTFKGYEQGYDFLRNAIADNDYKARGLPDEIFISDGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVGFVPDIPQEKADLIYLCYPNNPTGAVATLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIEGARDCAIEFRSFSKNGGFTGAYVVIPKSLMGRKKNGEAQALHPNGASYIVQKGAEALYT--SQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPAGLTSWQMFDKMLNEANVVITP------SAGEGYFRISAFN--SRANVEEVCRRIAAL......... 410
33 -19.0002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  17  2GSSSSGLVPRGSHMNEPIGEPGRSPASDTAEKAQAIAAARNTFARDNPVSAGHHERARHRPFPLVIAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHPVIRAAVERALAV-GLNLSTQ----------TENEALFAEFPSIDLVRFTNSGTEANLMALAAITGRKTVLAFDGGYHGG-LLNFASGHAHVVLGVYNDVEGTADLLKRHGHDCAAILV-EPMLGAGGCVPALDLLRAEASRCGALLIFDEV----MTSRLSGGAQEMLGISADL-----TLGKYIG--GGMFGGRRDLMERFDPARDGAFAHAGTNILTMSAGHAALTQIY-TRQAASDLSASGDRFRANLNRIAVENQAPLQFTGLGSLG-ADQQLKELFFFHMLRKGIYLAP-----------RGMYALSLEIADAGRDAFAEALADFIGEQRALLM 459
34 -19.0004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  15  21.............................................................................MRESIKLIASENITS----LAVREACATDFHRYAEGLPGKRLYQGCKEVETLCIELSKELFKAEHANV--SGVVANLAVFFAETKPGDKLMAPDGGHISHWKVSAAGIRGLKVINHPDADAMVKKILEEK---PKLILFGG--SLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLI----AGKQFQDPLREGAEYLMGSTHKTFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHKDFTESHQVIDIEFSASELAKMYEEANIILNKNLLPNNSDNPSGIRLGTQEC-KEKEMEEIAEFMKRIAID...... 392
35 -19.0003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  14  16...............................................................................DNPIRINFNE---LGMSPKAQAAARDAVVKANRYAKNEI---------LMLGNKLAAHHQVEPSILLTAGSSEGIRAAEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDIEGLKAAVAAYSG--PSIVYLVNPNNPTGTITPADVIEPWIAS-NTMFIVDEAYAEFVNDPRFRSISPMITQGAENIILLKTFSKIHAMAGGYAVAHPTVIALMGRYVAGE----KINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGN-----VFHQLVVPLKDYQTHMADAGVLIGRAFPPA----DNWCRISLG---TPQEMQWVADTMREFRKKSWI... 354
36 -18.9002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  19  42.............................................................................EGAYVWDADGNRYLDYVAHPKVLARVRETLER-GLTFGAP------SPLEVALAKKVKRAYPFVDLVRFNSGTEATMSALRGYTGRPYIVKFRGNYHGH-ADGLLVEAGSTLVLEYNDPEGLREVLKRRGEEIAAIIF-EPVVGNAGVLVPTEDFLKEAKAYGVLLIADEV--TGFRLAFG-GATELLGLKPDL----VTLGKILG--GGLYAGRREIMEKVAPLGPVYQAGTSGNPLAMAAGLATLELLEENPGYYAYLEDLGARLEAGLKEVLKEKGLPHTVNRVGSMI-TDTELFKRFFHGLLDRGIYWPP---------SNFEAAFLSVAHREEDVEKTLEALRKA......... 423
37 -18.8003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  16  24.............................................................................DIASWIKLNTNE---YPPSPEVVKAILEELGP-----DGAALRIYPSASSQKLREVAGELYGFDSWIIMANGSDEVLNNLRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTG-----RIAGFPERYEGKVFFLTTPNAPLGPSFPLEYIDELARRCAGMLVLDETYAEFAESNALELVRRHENV-----VVTRTLSKSYSLAGGLAIARPEVIAALDKIRDHY----NLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATP---PDRDGKRVYDGLYARKVLVRHFSDPLLAH----MRISIG---TREEMEQTLAALKEIGE....... 353
38 -18.8006MME Entity 1(prereleased)  ali follow..  14  25...............................................................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAENIAYICLAVTVNLAGSMANMRAVRELTEAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAV--FLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDI.. 434
39 -18.8001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  12  45................................................EREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSVNQG--CHPKIVNALKSQVDKLTLTSRA------YNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLAKYKAKIVFAAGNFWGRTLSAISSSTDPTSYFDIIPYNDLPALERALQDPNVAAFMVEPIQGEAGVVVPLMGVRELCTRHQVLFIADEIQT---LARTGR-AVDYENVRPDI-----LLGKALSG--SAVLCDDDIMLTIKPGEHGSTYGGN--PLGCRVAIAALEVLEEEIILRNELMKLPSDVVTAVRGKGLLNA--------IVIKETKDWDAWKVCLRLRDNGLLA-------KPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF..... 439
40 -18.7001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  18  22......................................................................................QHAKIELIASENFVSRAVMEANKYAEGYPGRRYYGGCEIVEELARERAKQLFGAEHANV--SGAQANMAVYFTVLEHGDTVLGSHGGHLTHGSPVNFSGVQYNFVAYGDYDDVREKARLHR---PKLIVAAA--SAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAG-----LHPNPVPYAHFVTTTTHKTLGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDKAYAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQTGKTAEKVLDEVGITVNKNTIPYDPESTSGIRIGTAAV-GLEEMDEIAAIIGLVLKN...... 386
41 -18.7004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  13  23...............................................................................PGAIKLASNE---FGPLPSVRAAIDRATDTVNRYPDNGC---------VQLKAALARHLGPDEHVAVGCGSVSLCQQLQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNV-VVLRTFSKAYGLAGGYAIGHPDVITALDKVYVPF----TVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQAN-----VWLPLGSRTQDFVEQAADARIVVRPYG-------TDGVRVTVA---APEENDAFLRFARRWRSD...... 353
42 -18.7004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  12  40.............................................RNVNLEKLKNNYLFPEI----NRRELEHIEKHPNVQLISLGTGD--TEPIPEQITSHMSNFAHGLSTVEGYRGYEQGNKTLRKAIAETFYRDLHVKNEVFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKGPNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIPGAREVA-IEVSSFSKFAGFTGGWSIIPDELLPIINDFHR--IVTTSFNGASNIAQAGGLACLSSGGSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGSKSWDV-FNEILENTHIITVP------PGGEEYLRISGFG--RRDHIVEASKRLQNFFNTR..... 442
43 -18.7006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  14  36..........................................................FDPHGLFISDAQGVHKTDVDGNVYLDFFGG-VLG--GHPRVNAAIAEALSH-GVQYAAS------HPLEVRWAERIVAAFPSIRKLRFGSGTETTLLALRAFTGRRMILRIATHYHGW-HDFSASGYNNTLLIRPDDIEGMREVFAQHGSDIAAFIA-EPVGSHFGVTPVLREGAELARQYGALFILDEV--SGFRVGNH-GMQALLDVQPDL----TCLAKASA--GGLLGGREDVMGVLSRGSDRKVLHQGTNPITAAAAIAAIDTIL-EDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGF-PDVKMIAAMRMALILEGVDIGG-------------SVFLSAQHEREHVEHLVTTFDRVLDRLADENL 440
44 -18.7002c44_A mol:protein length:471 TRYPTOPHANASE  ali model follow..  16  28...............................................................................EEAIIKSGMNPFLLDSEDVFIDLLTDSGTGAVTQSMQAAMMRGDEAY-YALAESVKNIFGYQYTIPTHQGRGAEQIYIPVLIKKREQEKGLDRSKMVAFSNSQINGCTVRNVYIKDLEGLERGIEEVGPNNVPYIVATITSNSAGSLANLKAMYSIAKKYDIPVVMDSAENAYFIKQREAEYKDW-ETYKYADMLAMSAKKDAMVMGGLLCMKDDSFFDVYTECRGFPTYGGLEGGAMERLAVGLYDGMNLDWLAYRI-AQVQYLVDGLEEIGVVCQQAGGHAAFVDAIPADQFPAQALACELYVAGIRAVEI---QLPCPAELLRLTIRATYTQTHMDFIIEAFKHVKENASNI.. 449
45 -18.7003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  17  27...............................................................................NVDIRLNTNE---YPPSEALVADLVATVDKIATELN---------RDAVELRDELAAYITKQTGLWAANGSNEILQQLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGA--DMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYA-----SPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGYFVANPAFIDAVMLVRLPY----HLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESN-----VFFGDFSDQHAAWQAFLDRGVLIRDVGIAGH------LRTTIG---VPEENDAFLDAAAEIIKL...... 364
46 -18.7002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  15  36..........................................................FDPHGLFISDAQGVHKTDVDGNVYLDFFGG-VLG--GHPRVNAAIAEALSH-GVQYAAS----------HPLEVRWAERISIRKLRFTGSGTETTLLALRAFTGRRMILRFEGHYHGW-HDFSASGYANTLLIRPDDIEGMREVFANHGSDIAAFIA-EPVGSHFGVTPVLREGAELARQYGALFILDEV--SGFRVGNH-GMQALLDVQPDL----TCLAKASA--GGLLGGREDVMGVLSRGSDRKVLHQGTNPITAAAAIAAIDTIL-EDDVCAKINDLGQFAREAMNHLFARKGLNWLAYGRFSGF-PDVKMIAAMRMALILEGVDIGG-------------SVFLSAQHEREHVEHLVTTFDRVLDRLADENL 440
47 -18.6003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  14  39.............................................RNENFGKLRAGYLFPEI----ARRRKAHQEKNPDAKIISLGIGD--TEPLPKYIADAMAKAAAGLATREGYSGYEQGQGALREAVASTFYGHAGRADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHKRTDIIFFCSPNNPTGAAATLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGGWTVVPKALKYANGEPVHADWCFNGASNIVQAGGLACLQ-LKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGKPSWDV-FAEILERCNIVTTP------PAGEGFVRASAFG--SRENILEAVRRFKEAYGKRN.... 441
48 -18.6005ykr_A mol:protein length:461 Probable aminotransferase  ali model follow..  16  65.............................................................................QGARVTDIDGQQYVDFAAQPAVADAIARQARR-GSTLMLP------TEDSLWVGAELARRFGLPYWQVTTSATDANRFVLRMLSGRDKVVVFNCNYHGS-VDESQVE-TTTRLVEFNDLDALEAALAHGD----AAVLTEPFMTNVGMVPPHAGLRELTRRHDVALIIDETHTISC-----AGYSGAHGLEPDF-----VLGKCIA--GGIWGCSQAQAERIWAVLPHF--TLAGNALQLAAMRATFAEVMT-EDAYRHMFQLAAQLEAGVRATLEELRLPWHVTRIGARVARNGLIEACLHLYLLNRGVLLTP----------FHNMALTCPATRAEDVELHDRLLRDCLGEL..... 456
49 -18.6004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  12  34..........................................................YAPVPVVISKGKGARVWDINGNEYYDFLAGLSQG--CHPRVIAALCRQAERLTLTLRA------GNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIAPDSAKVILCNNNYWGRTITACSSSTTFDCYFELIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPLKRAHELCRSKNVLLIVDEIQT---LCRTGR-AADHDEVHPDI-----LLGKSLSA--SAVMGRADVMDVLKPGTHGSTFGGN--PLACAVAVEALTVLKDE-KLADRAERLGAQFRDCLRRELYGKVPWIKEIRGRGLLNADAIDPNDVVMKLKENGILS-------KPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV..... 420
50 -18.5004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  12  39................................................ACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGLSQG--CHPRVIAALCRQAERLTLTLRA------GNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIAPDSAKVILCNNNYWGRTITACSSSTTFDCYFELIDYDDVGALEEALKDPNVAAFFVEPIQGEGGVNVPLKRAHELCRSKNVLLIVDEIQT---LCRTGR-AADHDEVHPDI-----LLGKSLSA--SAVMGRADVMDVLKPGTHGSTFGGN--PLACAVAVEALTVLKDE-KLADRAERLGAQFRDCLRRELYGKVPWIKEIRGRGLLNADAIDPNDVVMKLKENGILS-------KPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV..... 435
51 -18.5001v72_A mol:protein length:356 Aldolase  ali model follow..  13  5.............................................................................SRPPALGFSSDNIAG---SPEVAQALVKH-------SSGQAGPYGTDELTAQVKRKFCEIFERDVEVFLPTGTAANALCLSAMTPPWGNIYCHPASHINNDECEFFSNGAKLMTVDGDIVRLRERTREKVGDVHTVSITQAIYTLD----EIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAE-MTWKAGVDALSFGATKNGVLAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLT------RNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDSA-----MIDALLKAGFGFY-----HDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQ.... 354
52 -18.5004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  16  60..........................................................YAPFPLTIARGEGAALWDADGHRYADFIAEYTAGVYGHPEIRDAVIEAMQG-GINLTGH----------NLLEGRLARFPQIEQLRFTNSGTEANLMALTHFTGRRKIVVFSGGYHGG-VLGFGARPSDFLVLPYNDAQTARAQIERHGPEIAVVLV-EPMQGASGCIPGLQALRESATQVGALLVFDEV----MTSRLAHGLANKLGIRSDL-----TLGKYIG--GGMFGGRADVMALFDPRTGPLAHSGTFNVMTMAAGYAGLTKLF-TPEAAGALAERGEALRARLNALCANEGVAMQFTGIGSLM-VDGRLRQLLFFHLLNEDIYSSP-----------RGFVVLSLPLTDADIDRYVAAIGSFIGGHG.... 441
53 -18.5004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  14  32...............................................................................AVPVRLNTNE---HPPTRALVDDVVRSVRE-----AAIDLHRYPDRDAVALRADLAGYLTAQTGIWAANGSNEILQQLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRAN--DVDVAVAAVVDRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIVDEAYG-----SSQPSAVSLVEEYPSKLVVTRTMSKAFAFAGGYLIATPAVIDAMLLVRLPY----HLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDAN-----VLFGEFADAPAAWRRYLEAGILIRDVGIPGY------LRATTG---LAEENDAFLRASARIATDL..... 370
54 -18.3005uc7_A mol:protein length:431 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase  ali model follow..  14  1...........................................QGMTTDDLAFDRRHIWHPYTSMTSPLPVFPVERAEGCELILSGGERLVDGMSHPQLNAAMKTQIDAMSHVMFGG-----THAPAIELCRKLVAMTPAPLECVFDSGSVAVEVAMKMALSRQRFLTFRNGYHGDTFGAMSVCDPHNSMHSERDMVAFARLMAAHRHEIAAVILEPIVQGAGGMRIYLQRIRQMCDREGILLIADEI-ATG-FGRTGR-ACEHAGIAPDILCLGKALTGGTMTLSATLTSRQVAETISNGEAGCFMHGPTFMPLACAVANASLTLLESG-DWRRQVAAIEAQLREELAPAA-QVADVRVLGAIGVVETTRPVNIAALQQFFVRQGVWVRPF--------GKLIYLMPPYIIQPEQLRRLTQAVNEAVREETFFSV 431
55 -18.3005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  18  42.............................................................................EGAYVLDEDDKRYVDYVSHPDVLDAVRRQLDH-GLSYGAP------TALEVEMADLVCSMVPSMEMVRMSSGTEATMSAIRGYTGRDSIIKFEGCYHGH-SDSLLVKAGHTLTLPFNDIEAVRKTLGEVGKEVACIIV-EPVAGNMNCVPPLEGLREACDEHGVVLIFDEV--TGFRVALG-GAQAYYGVTPDL----STFGKIIG--GGMFGGKREIMQQISPLGPVYQAGTSGNPLAMAAGLTTLRLIS-RPGFHDELTAYTTRMLDGLQQRGLYFSGADAIVTFEDVMASDVERFKRFFHLMLDGGVYLAP---------SAFEAGFTSIAHGDKELEITLNAAEKAFAALK.... 429
56 -18.3003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  18  38.............................................................................QRDTLEMIASENFVP----RAVLQAQGSVLNKYAEGLPGRRYYGGCEVVENLARDRAKALFGAEFANV--SGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYE--DMDAVRATALEFR---PKVIIAGW--SAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAG-----LHPSPVPHADVVSTTVHKTLGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEADRQRRTLSGARIIADRLMAPDVAKAGVSTDVHLVLVDLRDSPDGQAAEDLLHEVGITVNRNAVPNDPRPTSGLRIGTPAL-GDTEFTEVADIIATALAT...... 407
57 -18.3002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  18  47.............................................................................KDAYAWDVDGNRYIDYVAHPEVIEALKVAMEK-GTSFGAP------CALENVLAEMVNDAVPSIEMVRFNSGTEACMAVLRAYTGRDKIIKFEGCYHGH-ADMFLVKAGNTLTTPYNDLEAVKALFAENPGEIAGVIL-EPIVGNSGFIVPLEGLREITLEHDALLVFDEV--TGFRIAYG-GVQEKFGVTPDL----TTLGKIIG--GGLYGGKREIMQLVAPAGPMYQAGTSGNPLAMTAGIKTLELLR-QPGTYEYLDQITKRLSDGLLAIAQETGHAACGGQVSGMF-SDLQKFSRFHRGMLEQGIYLAP---------SQFEAGFTSLAHTEEDIDATLAAARTVMSAL..... 432
58 -18.2002cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE  ali model follow..  18  26.............................................................................KGAHIWDVDGNQYIDYVAHPEVIDALHAALEK-GTSFGAP------CLLENILAEMVIAAVPSVEMVRFNSGTEACMAVLRAYTQREKVIKFEGCYHGH-ADMFLVKAGATLTAPYNDLEAVSRLFEQYPNDIAGVIL-EPVVGNAGFIPPLEGLRELTKQYGALLVFDEV--TGFRIAYG-GAQEKFGVTPDL----TTLGKVIG--GGLYGGRAEIMKMVAPAGPVYQAGTSGNPLAMTAGIKTLEILS-RPGSYEHLDRITGKLVQGLLDAAREFGHEVCGGHISGMF-SDLKKFAAFHRGMLEQGIYLAP---------SQFEAGFTSLAHTEADIERTIAAARTVLSQL..... 411
59 -18.2002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  12  18...........................................DRVHEVLGRSMLVDGLDIVLDLTRSGGSYLVDAITGRRYLDMFTF--LG--NPPALVDDREFHAELMQAALNKPSNSDVYSVAMARFVETFARVLALPHLFFVEGGALAVENALKAA-LGTQVLHLRGAFHGRSGYTLSLTNTKPTILEAEALRQARAAFETRPHDIACFVA-EPIQGEGGDRHFFAAMRELCDEFDALLIFDEVQT---CGLTGT-AYQQLDVAPDI-----AFGKKTQVCGGRRVDEVADNVFAVPSRLNSTWGGN--LTDMVRARRILEVIEAE-GLFERAVQHGKYLRARLDELAADVLDPRGRGLMCAFSLPTTADRDELIRQLWQRAVIV-------LPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVVT.... 449
60 -18.1003bs8_A mol:protein length:438 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  13  45.............................................................................KGSKIFDIDGNEYIDYVTNDRVVESLKKVAEY-GTSFGAP----------TEVENELAKLVSVEIVRMVSSGTEATMSALRGYTGRNKILKFEGCYHGH-GDSLLIKAGNTITVPYNDLESVKLAFQQFGEDIAGVIV-EPVAGNMGVVPPLQGLRDITEQYGSLLIFDEV--TGFRVDYN-CAQGYFGVTPDL----TCLGKVIG--GGLYGGKAEIMEQIAPSGPIYQAGTSGNPLAMTAGLETLKQLT--PDSYKNFIKKGDRLEEGISKAAEAHGIPHTFNRAGSMI-SDLKLFASYYKGMANEGVFLPP---------SQFEGLFLSTAHTDEDIENTIQAAEKVFAEIS.... 430
61 -18.1005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  14  14................................................ELEEKHGAHNYHPLPVVLDRGEGVFVWDVEGKKYYDFLSAVNQG--SHPKIVEALVEQASKLALTSRA------YNSKLGEYEQKITSLLGFDKVLPMNSGAEAVETAVKLAENAAKIIVCENNFHGRTTTIVSFSNDPDANIPYNDIAALEEVLSKEAGNIAAFLV-EPIQGEAGVYVPLKQSSELCKKHNVLFIADEVQT---IARTGK-ACHHEDVQPDI-----ILGKALSG--SAVLANNNIMDVIKPGQHGSTFGGN--PLACAVAMAALDVVQDE-KLSERAEKLGNLFRSEIEKLIEKITKVRGKGLLNAILINDTSTAWNLCLALKENGLLA-------KPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILEF..... 413
62 -18.1004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  20  30.............................................................................QEDHIELIASENYTS----PAVMAAQGSQLNKYAEGYPGKRYYGGCEVVEQLAIDRVKQLFGAEAANV--SGSQANQGVFFAMLKPGDTIMGAHGGHLTHGSPVNMSGKWFNVVSYGDYDAAEKLANEHKP---KLIVAGA--SAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAG-----VYPNPVPHADFVTTTTHKSLGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAHITGKAAEAALGAAHITVNKNAIPNDPEKTSGIRLGSPAGFGPAEAEQVGNLIADVLEN...... 393
63 -18.1004e77_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  16  43.............................................................................DGAYLFDVDGKAYIDYVNHPAIRQAVIEAVER-GLSFGAP------TEMEVKMAQLVTDLVPTMDMVRMNSGTEATMSAIRGYTGRDKIIKFEGCYHGH-ADCLLVKAGHTLTCTYNDLASVRQAFEQYPQEVACIIV-EPVAGNMNCIPPLPGLRALCDEFGALLIIDEV--TGFRVALA-GAQDYYHVIPDL----TCLGKIIG--GGMFGGRREVMNALAPTGPVYQAGTSGNPIAMAAGFACLTEIS-QVGVYETLTELTDSLATGLRHAGLFFTNADTVTCYQDVMNCDVERFKRFFHLMLEEGVYLAP---------SAFEAGFMSLAHSNEDIQKTVNAARRCFAKL..... 429
64 -18.1003k28_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase 2  ali model follow..  14  43.............................................................................KGSKVYDIDGNEYIDYVANDRVVEALKAVAER-GTSFGAP----------TEIENKLAKLVSIEIVRMVNSGTEATMSALRGYTGRNKILKFIGCYHGH-GDSLLIKAGNTITVAYNDLESVKYAFEQFGDDIACVIV-EPVAGNMGVVPPLEGLREVTEQNGALLIFDEV--TGFRVAYN-CGQGYYGVTPDL----TCLGKVIG--GGLYGGKAEIMRQVAPSGPIYQAGTSGNPLAMAAGYETLVQLT--PESYVEFERKAEMLEAGLRKAAEKHGIPHHINRAGSMI-SNLQFFAAYYREMVEQGVFLPP---------SQFEGLFLSTVHSDADIEATIAAAEIAMSKLK.... 428
65 -18.0005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  15  77............................................................................TQGQEFIDCLGG--VG--RNPVVVSAVQNQLAKQPLHSQE------LDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLA-GKFTFIATSGAFHGKSLGALSATAKSTFRVPFGNIEAMRTALNECKKTGDDVVILEPIQGEGGVILPLTAVRKLCDEFGALMILDEVQT---MGRTGK-ACEHENVQPDI-----CLAKALGG--GATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQ-NLPAQAEQKGDMLLDGFRQLAREVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVA-----GTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAM..... 450
66 -18.0001dty_A mol:protein length:429 ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE AMINOTRANSFERASE  ali model follow..  12  1.............................................MTTDDLAFDERHIWHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSHPQLNAAMKSQIDAMSHVMFGE-----THAPAIELCRKLVAMTPQPLECVFDSGSVAVEVAMKMALARDRFLTFRNGYHGDTFGAMSVCDPDNSMHSERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYLKRIRKICDREGILLIADEI-ATG-FGRTGK-ACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISDGEAGCFMHGPTFMPLACAAANASLAILESG-DWQQQVADIEVQLREQLAPAR--VADVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIRPF--------GKLIYLMPPYIILPQQLQRLTAAVNRAVQDE..... 424
67 -18.0003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  16  29.............................................................................QEEHIELIASENYTS----PRVMQAQGSQLNKYAEGYPGKRYYGGCEVVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLQPGDTVLGAQGGHLTHGSPVNFSGKLYNIVPYGDYDEMAKLAKEHK---PKMIIGGF--SAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAG-----VYPNPVPHAHVVTTTTHKTLGPRGGLILAKGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEKVYQQQVAKNAKAMVEVFLNRGYKVSGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRIGSPAGFKEAEVKELAGWMCDVLDN...... 395
68 -18.0004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  15  79............................................................................TQGQEFIDCLGGFNVG--RNPVVVSAVQNQLAKQPLHSQE------LDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLA-GKFTFIATSGAFHGKSLGALSATAKSTFRVPFGNIEAMRTALNECKKTGDDVVILEPIQGEGGVILPLTAVRKLCDEFGALMILDEVQT---MGRTGK-ACEHENVQPDI-----CLAKALGG--GATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQ-NLPAQAEQKGDMLLDGFRQLAREVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVA-----GTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAM..... 452
69 -18.0002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  13  26.............................................RNSNMSKLQAGYLFPEI----ARRRSAHLLKYPDAQVISLGIGD--TEPIPEVITSAMAKKAHELSTIEGYSGYEQGAKPLRAAIAKTFYGGLGIGDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPENRTDIIFFCSPNNPTGAAATLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVA-METASFSKYAGFTGGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSSWDV-FAEILEKTHVVTTP------PGGEGFVRVSAFG--HRENILEACRRFKQLYK....... 426
70 -18.0001mgv_A mol:protein length:429 7,8-diamino-pelargonic acid aminotransferase  ali model follow..  12  1.............................................MTTDDLAFDQRHILHPYTSMTSPLPVYPVVSAEGCELILSDGRRLVDGMSHPQLNAAMKSQIDAMSHVMFGG-----THAPAIELCRKLVAMTPQPLECVFDSGSVAVEVAMKMALARQRFLTFRNGYHGDTFGAMSVCDPDNSMHSERDMVGFARLMAAHRHEIAAVIIEPIVQGAGGMRMYLKRIRKICDREGILLIADEI-ATG-FGRTGK-ACEHAEIAPDILCLGKALTGGTMTLSATLTTREVAETISNGEAGCFMHGPTFMPLACAAANASLAILESG-DWQQQVADIEVQLREQLAPAR--VADVRVLGAIGVVETTHPVNMAALQKFFVEQGVWIAPF--------GKLIYLMPPYIILPQQLQRLTAAVNRAVQDE..... 424
71 -18.0002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  13  18........................................................................RKARERGVGLIDLSIGS--DLPPPEAPLKALAEALND--PTTYGYCLKSCTLPFLEEAARWYEGRYGVGEALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLREDGLADKAVPEGVWREAKVLLLNYPNNPTGAVADFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGAKERV-VELFSLSKSYNLAGGFALGSEEALARLERVKGVI--DFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWG--LPEGVDDLEFGLRLVERGVALAP------PGGKGFVRIALVR--PLEELLEAAKRIREALD....... 376
72 -18.0003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  16  30...............................................................................KEVIKLASNE---FGTPPKAIECLRQNANKAHLYPDDSM---------IELKSTLAQKYKVQENIIIGAGSDQVIEFAHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITHNLDEKKLYETHKDEIKLIFLCLPNNPLGECLDASEATEFIKGVDCLVVIDAAYNEFASFKDSKKHLEPCELIKEFDLYLGTFSKLYGLGGGYGIANANIISAFYKLRAPF----NVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFF---DEKNSTDLSEKLLKKGIIIRNLKSYGLN-----IRITIG---TSYENEKFFTEFDKILR....... 365
73 -18.0005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  14  4................................................................................KSQQFASDNYSG---CPEAWAAMEKA-------NHGHDRAYGDDQWTERASEYFRNLFETDCEVFFFNGTAANSLALASLCQSYHSVICSETAHVETDECEFFSNGSKLLTAASTPQSIREVALKRQDYPKPRVVTITQATEVGTVYRLKAISATCKELGLNLHMDGARFTNACAFLGCSPAE-LTWKAGVDVLCFGGTKNGMAGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLE------RHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQMPEH-----AIEALRAKGWRFYT-------IGSGGARFMCSWDTEEERVRELAADIRSIIT....... 345
74 -18.0003l44_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1  ali model follow..  16  45.............................................................................KGAYFWDVDGNKYIDYLAHPHITKAITTAAEN-GVLYGTP----------TALEVKFAKMLALDKVRFVNSGTEAVMTTIRAYTGRTKIMKFAGCYHGH-SDLVLVAAGEVITVPFNNVETLKEALDKWGHEVAAILV-EPIVGNFGIVEPLEKVNELVHEAGALVIYDEV--TAFRFMYG-GAQDLLGVTPDL----TALGKVIG--GGLYGGKKEIMEQVAPLGPAYQAGTAGNPASMASGIACLEVLQ-QEGLYEKLDELGATLEKGILEQAAKHNIDITLNRLKGAL-TDGEMFGKFFKLMLQEGVNLAP---------SKYEAWFLTTEHTKEDIEYTIEAVGRAFAALA.... 431
75 -17.9002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  10  1.......................................MGSSSSGLVPRGSHMISNKLANIPDSYFGKTMGRKIEHGPLPLINMAVGI--DGPTPQGIIDHFQKALTI---ENQKYGAFHGKEAFKQAIVDFYQRQYNVTEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLEPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASENGKDVA-IEIYSLSKGYNMSGGFAVGNKDMIQALK-KYQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPPGYDSEQFEQFLVQEKSILVAP------ENGNRYVRISLAL--DDQKLDEAAIRLTELAYLYE.... 398

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.