current user: public

If you have questions about the server, please let us know.

Query: 4c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .
# Score Template Links and tools%idFirst MQSLQDKASVLSGVDQAEAFAIDESNLFDKLGLQTFINLSTNFYTRVYDDEEEWFQSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDSVDIDQDSKIKMMKFFRHTAFFLVAGNELKNQNEKPKHKPQCACKHAANKPAEELast
1 -82.1004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model  100  1MQSLQDKASVLSGVDQAEAFAIDESNLFDKLGLQTFINLSTNFYTRVYDDEEEWFQSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDSVDIDQDSKIKMMKFFRHTAFFLVAGNELKNQNEKPKHKPQCACKHAANKPAEE 175
2 -59.3004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  20  1...MIKRLFSKSKPATIEQTPTPEKTPYEILGGAGALAIANRFYDIMATDEYAKPLYDMHPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDL-EVDNPLLREGLKQSFGQLASHMINQ............................ 144
3 -56.8002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  19  1...................MSSETVTLYEAIGGATVRALTRRFYELMDTLPEAARCRAIHPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDE-TIENAKLREIIWAPVERLAFHMQNQEADNP....................... 133
4 -56.4004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  23  10GTRSALGEASTYPVGAMTSQHDDQMTFYEAVGGETFTRLARRFFEGVAADPVLR--PMFPEEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDL-ALPAHLEQQLWEYLVYAAYAMVNVPEDAQPPMVQ.................. 164
5 -55.1002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  28  2.........................TFYEAVGGETFTRLARRFYEGVAADPVLR--PMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDD-LALPAHLEQQLWEYLVYAAYAMVNVPE.......................... 123
6 -54.2001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  26  2.......................PKSFYDAVGGKTFDAIVSRFYAQVAEDEVLR--RVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASI-TLDDEHRRELLDYLEMAAHSLVNSP........................... 127
7 -53.0005v3t_A mol:protein length:132 Globin  ali model follow..  26  1...................MSKQPMTPFEAIGGQCIEILVDTFYSYVSKHPDLSPIF---PDDLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDD-TGVHGHIREFVFERLALTAQHMVNTPNETGE...................... 131
8 -53.0005d1v_A mol:protein length:127 Globin  ali model follow..  31  1.....................MSEPTIYEQIGGATFRRIVDIFYARVEADPRLRHLF---PADLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNE-AGVPEPARSVMENYFRHAAQAMMNRLGED........................ 127
9 -52.5001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  28  1...................MGQSFNAPYEAIGEELLSQLVDTFYERVASHPLLKPIF---PSDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDH-VGLEGEIREFLFGRLELTARHMVNQTEAEDRSS.................... 132
10 -51.5004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  14  28.KTAESGSICEARIDFVFPEVKFPSKKVYLAAGELLRKLVEVHHENLMKSKIHYL-FPTSHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKD-VHFPLSVLEEFWQWIESFSIRMINRRTTLEPPRR................... 181
11 -50.7004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  17  1.................AADTAPADSLYSRMGGAAVEKAVDVFYERIVADPQLA--PFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQE-LGVAQELKAEAMAIVASARPLIFGTGEAGAAN..................... 135
12 -50.6002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  27  2......................QWQTLYEAIGGETVAKLVEAFYRRVAAHPDLRPIF---PDDLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDE-IGLSGPAREQFYHRLVLTAHHMVNTPDHLD....................... 128
13 -49.3001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  13  19QPVRPSTSATAAAATAPAPARKCPSSLFAKLGGEAVEAAVDKFYNKIVADPTVS--TYFSNTDMKVQRSKQFAFLAYALGGASEWKGK--DMRTAHKDLVPHLSDVHFQAVARHLSDTLTE-LGVPPEDITDAMAVVASTRTEVLNMPQ.......................... 163
14 -48.9001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  19  2.............GLLSRLRKREPISIYDKIGGEAIEVVVEDFYVRVLADDQLS--AFFSGTNMSRLKGKQVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTA-AGVPSETITEILGVIAPLAVDVTSGESTTAP...................... 135
15 -48.9002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  17  2.............GLLSRLRKREPISIYDKIGGEAIEVVVEDFFVRVLADDQLS--AFFSGTNMSRLKGKVVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTA-AGVPSETITEILGVIAPLAVDVTSGESTTAP...................... 135
16 -48.2006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  13  1........................STLHAKLGGAAVAATVDVFYKKLMNDPDLE--PFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKE-MGVGQELIDEAAGVLIGVRPLFDPERYKGKVD..................... 128
17 -48.1003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  18  2.....................NKPQTIYEKLGGNAMKAAVPLFYKKVLADERVK--HFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGK----NMTEAHKGMNLQNLHFDAIIENLAATLKE-LGVTDAVINEAAKVIEHTRKDMLGK............................ 121
18 -47.5002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  18  1........................ASLYEKLGGAAVDLAVEKFYGKVLADERVN--RFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQE-LNVSQDLIDEVVTIVGSVQHDVLNR............................ 123
19 -47.2001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  17  1.........................SLFEQLGGAAVQAVTAQFYANIQADATVA--TFFNGIDMPNQTNKTAAFLCAALGGPNAWTGR----NLKEVHANMGVSNAQFTTVIGHLRSALTG-AGVAAALVEQTVAVAETVRGDVVT............................. 115
20 -46.7001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  17  2........................STLYEKLGGTAVDLAVDKFYERVLQDDRIK--HFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKE-MGVPEDLIAEVAAVAGAPARDVLNQ............................ 124
21 -40.8002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  14  4............................ETINQESIAKLMEIFYEKVRKDKDLGPIFN-SDEEWKEHKAKIGNFWAGMLLGEGDYNGQP----LKKHLDLPPFPQEFFEIWLKLFEESLNIVY--NEEMKNVILQRAQMIASHFQNM............................ 120
22 -16.1005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  13  34................................APHFPRLAEEFYDRILGHEGARTALVGGESQVGHLKVTMIAWLDELLGGPEAYWDR--RYRIGRVHVRIGLPQHAMNVHRTGLARLAYERFHGDPPELERVRNALGKV................................... 145
23 -15.1002w31_A mol:protein length:162 GLOBIN  ali model follow..  10  1MLTMQEIKAHYRFTDEDAELLGSLFPLAE----TNKERLADQFYDYLLGIPETAEF-LKEDLVLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKIL............................... 139
24 -15.0001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  21.....................................GFFDDFYRHFLASS--QIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEHDRCDAETRDAWRDVMGRGIAVIKSYYGS......................... 134
25 -14.9004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  1MEMYFKRMKDEWTGLVEQADPPIRAKAAEIA-VAHAHYLSIEFYRIVRIDPHAE-EFLSNEQVERQLKSAMERWIINVLSAQERLIQI--QHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSI............................... 144
26 -14.6004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  10  74................................TTHQSELPGYFYEQMLQDEQAMLF-LTHEQVKSRLHGTLRQWIVSVFSMSQALIAQ--QKQIGEIHARIKIPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISETV............................... 188
27 -14.5001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  10  59................................QENIVNIVDAFYKNLDHESSLMDI-INDHSSVDRLKQTLKRHIQEMFAGVDEFIEK--RNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKIL............................... 169
28 -13.8004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  27................................VAHAHYLSIEFYRIVRIDPHAEEF-LSNEQVERQLKSAMERWIINVLSAQERLIQI--QHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSI............................... 139
29 -13.7004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  1MKPSPEILALRWKDTSAHYSPHEWVAARNVV-TANKAALADYFYESMLADPNAA-FFLSDQLVKTKLHASMQDWLESVYAAAEEYER-AFQRKVGEVHARIDIPVHGASALIRRICELLDRDASLSAAQAAATCRYVADV................................... 145
30 -13.6002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  21....................................EDLTNEFYKIMFNYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLEN----DKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFYIDIEKKLYDK..................... 140
31 -11.8002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  1MSVEKIPGYTYGETENRAPFNLEDKLLKEAVMEDQVEEILDTWYGFVGSHPHLLYYFT-NEKYLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNVAFIYPITATMKPFLARKGHTPEEVEKMYQAWFKAT............................... 178
32 -11.7001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  22....................................VTITTTFYKNLFAHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIENLPALPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGATDDILDAWGKAYGVIADVFIQVEADLYAQAV................... 145
33 -11.4003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  4LTGPQKAALKSSWSRFMNNAVTNGTNFYMDL-YPDTLTPFKSLFQNVSFNQMT------NHPTMKAQSLVFCNGMSSFVDNLDDHEV----QKMAKLHFNRGIRIKELRDGYGVLLRYLEDHCHVEGSTKNAWEDFIAYICRVQGDFMKER........................ 151
34 -10.7001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  13  19................................KANIPQYSVVFYTSILEAPAAKDLFSFTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGWSDELSRAWEVAYDELAAAIKKA............................ 143
35 -10.7001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  10  2LSAAEADLAGKSWAPVFANKNANGDAFLVAL-FPDSANFFADFKGKSVAD-------IKASPKLRDHSSTIFTRLNEFVNNAANAGK----SQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAAGK.......................... 146
36 -10.6003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  21....................................DEAGLLFYRRLFDEPKVRPLFKIDIEKQGRKLMDVLNWIVLNLQDIDAALDA---RELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGWTKQLEQLWTQAYEALAQVMIEE............................ 132
37 -10.5002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  11  1MNSEEVNDIKRTWEVVAAKMTEAGVEMLKRY-YPHNLNHFPWFKEIPFDD-------LPENARFKTHGTRILRQVDEGVKALSVDFGDK--KKLAQTHHEKKVERRSYNELKDIIIEVVCSCVKLNEKQVHAYHKFFDRAYDIAFAEMAKM........................ 150
38 -10.5002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  10........................KKTWEIPVATPTDSGAAILTQFFNRFPSNLEKFPFRNARFRAHAGRIIRVFDESIQVLGQDGDLE--TKIAVSHIPRTVSKESYNQLKGVILDVLTAASSLDESQAATWAKLVDHVYAIIFKAIDDDGNAK.................... 153
39 -10.5003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  22....................................NEIGLLFYANLFKEPTVSVLF---QNPISSQSRKLMQVLGILVQGIDNLEGIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGFTEEAKAAWTKVYGIAAQVMTAE............................ 133
40 -10.4002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  4LTNPQKAAIRSSWSKFMDNGVSNGQGFYMDL-HPETLTPFKSLFGGLTLAQLQ------DNPKMKAQSLVFCNGMSSFVDHLDDNDM----QKMAKLHNNRGIRASDLRTAYDILIHYMEDHNHMVGGAKDAWEVFVGFICKTLGDYMKELS....................... 152
41 -10.1001ith_A mol:protein length:141 HEMOGLOBIN (CYANO MET)  ali model follow..  1............GLTAAQIKAIQDH--WFLNIKGCLQAAADSIFFKYLTASSVPLYGLRSNPAYKAQTLTVINYLDKVVDALGGNAGA---KAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSADPTTVAAWGDAAGVLVAAM............................... 140
42 -9.9502wtg_A mol:protein length:159 GLOBIN-LIKE PROTEIN  ali model follow..  3MNRQEISDLCVKSLEGRMVGTEAQN---IENGNAFYRYFLRVYFKGAEKYTADDVK---KSERFDKQGQRILLACHLLYTNEEVFKG----RETINRHRIYKMDPALWMAFFTVFTGYLESVGSLNDQQKAAWMALGKEFNAESQTHLKNSNLPH.................... 158
43 -9.9001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  10  3LSAAEADLAGKSWAPVFANKNANGLDFLVAL-FPDSANFFADFKGKSVAD-------IKASPKLRDVSSRIFTRLNEFVNNAANAGK----SQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAA............................ 145
44 -9.7601d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  10  1MALVEDNNAVAVSFSEEQEALVLKS-------KKDSANIALRFFLKIFEAPSASQMFSFKNPKLKTHAMSVFVMTCEAAAQLRKAGK----KRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADPAMKSAWSEAYDHLVAAIKQEMKPAE....................... 166
45 -9.6801gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  19................................NANIPKHTHRFFILVLEAPAAKDLFSFNNPELQAHAGKVFKLVYEALEVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGWSEELNSAWTIAYDELAIVIKKEMDDAA....................... 153
46 -9.4701flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  2LEAAQKSNVTSSWAKASAAWGTAGPEFFMAL-HDDVFAKFSGLFSGAAKGTVK------NTPEMAAQAQSFKGLVSNWVDNLDNAGA----KTFAANHKARGISAGQLEAAFKVLSGFMKSYGGDEGAWTAVAGALMGEIEPDM............................... 142
47 -9.4701cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  10  21............................KQITAKALERVFVVYPWTTRLFSKLQGLFSANDIGVQQHADKVQRALGEAIDDLKKVEIN---QNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKFRPKEHAAAYKFFRLVAEALSSN............................ 139
48 -9.3601hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  1.XGATQSFQSVGDLTPAEKDLIRST--WDQLMTHRTGFVADVFIRIFHNDPTAQRKFLRTSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGFTKQVHDAWAKTFAIVQGVLITKHAS......................... 159
49 -9.3301eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  13  6....................................ISTVQASFDKVKGDPVGILYAVFKTAPFETHANRIVGFFSKIIGELPNIEAD---NTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTD-FAGAEAAWGATLDTFFGMIFSK............................ 135
50 -9.3203wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  1...........SECGPLQRLKVKRQWAEAYGSGNGREEFGHFIWANVFKAPSARDMFNIYTPAFRAHATRVLGGLDMCVALLDDESV----AHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDKDAWQACLDVITSGIQGN............................ 144
51 -9.2801ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  2LSAAQKDNVTSSWAKASAAWGTAGPEFFMAL-HDDVFAKFSGLFSGAAKGTVK------NTPEMAAQAQSFKGLVSNWVDNLDNAGA----KTFAANHKARGISAGQLEAAFKVLSGFMKSYGGDEGAWTAVAGALMGEIEPNM............................... 142
52 -9.2601b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  2LSAAQKDNVKSSWAKASAAWGTAGPEFFMAL-HDDVFAKFSGLFSGAAKGTVK------NTPEMAAQAQSFKGLVSNWVDNLDNAGA----KTFAANHKARGISAGQLEAAFKVLAGFMKSYGGDEGAWTAVAGALMGMIRPDM............................... 142
53 -9.1502d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  21................................GTNRELLGNRIWEDLANMPDARGLFDIDSSEFQAHSLRVLGGLDMCVASLDDVPV----ARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGIS.............................. 141
54 -9.0201oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  12  1MERPEPELIRQSWRAVSRSPLEHGTVLFARL-EPDLLPLFQYNGRQFSSPEDS-----LSSPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGFTPATRAAWSQLYGAVVQAMSRGWDGE........................ 151
55 -9.0101yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  23................................GNSREEFGHFIWSHVQHSPAARDMFNIHTPAFRAHATRVLGGLDMCIALLDDEPV----AHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGIQG............................. 144

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.