current user: public

If you have questions about the server, please let us know.

Query: 4cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst MKPMSDYDIPTTENLYFEGAMSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIRNLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQLLast
1 -120.0004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model  100  1MKPMSDYDIPTTENLYFEGAMSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIRNLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFITPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL 425
2 -107.0001xi9_A mol:protein length:406 putative transaminase  ali model follow..  38  2.....................GSIRASKRALSV-EYAIRDVVLPARELEKKGIKVIRLNIGDPVKFDFQPPEHMKEAYCKAIKEGNYYGDSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEG-EHISPGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPENKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMD--YLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEV--GPWKNDKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPPIEILEEAMDRFEKFMKERLK. 399
3 -100.0001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  28  1.......................MALSDRLELVSASEIRKLFDIA----AGMKDVISLGIGEP---DFDTPQHIKEYAKEALDKGTHYGPNIGLLELREAIAEKLKKQNGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIER-----MVKFQMYNATCPVTFIQYAAAKALKDERSWKAVEEMRKEYDRRRKLVWKRLNEM-GLPTVKPKGAFYIFPRIRDTGL---TSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAYEKLEEAMDRMERVLKERKLV 389
4 -98.3001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  26  3........................GLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEP---DFDTPEHVKEAARRALAQGTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEG-EHFSPGRVAPE-HTLTVNGAAKAFAMTGWRIGYACGPKEVIKA-----MASVSSQSTTSPDTIAQWATLEALTNQEASRAVEMAREAYRRRRDLLLEGLTAL-GLKAVRPSGAFYVLMDTSPIA---PDEVRAAERLL-EAGVAVVPGTDFA--AFGHVRLSYATSEENLRKALERFARVLGR.... 384
5 -97.0001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  28  1.......................MKLAARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEP---DFNTPKHIVEAAKAALEQGTRYGPAAGEPRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAASPEERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKA-----ATKIQGHSTSNVCTFAQYGAIAAYENSQDCVQ--EMLAAFAERRRYMLDALNAMPGLECPKPDGAFYMFPSIAKTG---RSSLDFCSELLDQHQVATVPGAAFG--ADDCIRLSYATDLDTIKRGMERLEKFLHGI... 387
6 -96.8001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  23  7.........................SMSNHAGLVFNPIRTVSDNA-KPSPSPKPIIKLSVGDP---TLDKNLLTSAAQIKKLKEANGYFPTVGSPEAREAVATWWRNELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDFTSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYVDPHGNGPSFLEGLRVGMLVCGPCTVVQAALGEALLNTPQEH--LDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEKYDIKTDVEFFEKLLEEENVQVLPGTIFH--APGFTRLTTTRPVEVYREAVERIKAFCQRHAAV 416
7 -96.4001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  27  2...................GSDKIMVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEP---DFPTPEPVVEEAVRFLQKGVKYTDPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATA-----VSKIQSHTTSCINTVAQYAALKALEVDNS-----YMVQTFKERKNFVVERLKKM-GVKFVEPEGAFYLFFKVR------GDDVKFCERLLEEKKVALVPGSAFL--KPGFVRLSFATSIERLTEALDRIEDFLNS.... 382
8 -95.8003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  23  3........................LKNSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQP---GTGAPRGAVEALAKSLETDLGYTVALGLPALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADF---AGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAK---AVTALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRV-----VERIAQNMFICAPHASQVAALAALDCDA---ELQANLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVSDLT---DDSRAFAAEILEKAGVAVTPGLDFDPEGAGTLRFSYARATADIEEGLDRLEAFMQARGE. 384
9 -95.8002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  22  1................MGSDKIMDVFSDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQP---DLKTPEVFFERIYENKPEVVYYSHSAGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIP-QNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRG-EFASALSIESD-KVVVIDSVSKKFSACGARVGCLITRNEE-----LISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFFD--FVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPV-----EDAEEFARWMLTDETTMVAPLRGFYLTGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCS. 398
10 -95.4002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  27  2.........................LSKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEP---DFNTPKPIVDEGIKSLKEGTHYTDSRGILELREKISELYKDKYKADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF--------TVESLEEALSDKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEGKCYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEA-----ILKLQQNLFISAPTISQYAALKAFEKETE-REINSMIKEFDRRRRLVLKYVKDF-GWEVNNPIGAYYVFPNIG------EDGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYANSYENIKEGLERIKEFLNK.... 370
11 -95.3004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  23  2......................PMDLSKRFNKNLNKIEVSMIRQFDQSISDIPDVLKLTLGEP---DFATPKHIKEAAKRAIDADSHYTGMAGLLALRQAASAFVKEKYHLTYNPDEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDT-RSNDFVLTPEMLEEAILKALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEYLPD-QTILISGLSKSHAMTGWRLGLIFAPAVLTAQ-----LIKSHQYLVTAATTSVQFAAIEALTNGKD--DALPMKEEYIKRRDYIIEKMEAM-KFKIIKPDGAFYIFAKIPVA----QDSFKFLQDFAKEKAVAFIPGVAFGKYGEGYLRISYAASMETIKEAMKRLKEFMEQYAD. 393
12 -95.0003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  18  1..................GMSIEAKFKKLGTDNAPGQEVRQSAAGLEALIRGARPVDFSHGDVD-AHEPTPGAFDLFSAGVQSGGQAYTEYRGDLGIRDLLAPRLAAFTGAPVDADGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDDETRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAAENVVTIMGPSKTESLSGYRLGVAFGSRAIIA-----RMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWME--DRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKLAV---APAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYR.. 406
13 -94.7003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  17  15..........LMSTSRPKVVANKYFTSNTAKDVWSLTNEAAAKAANNSKNQGRELINLGQGFF---SYSPPQFAIKEAQKALDIPNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINRGEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSEIGQLTLTVGSAGKSFAATGWRIGWVLSLNAEL----LSYAAKAHTRICFASPSPLQEACANSINDALKIGYFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKEILNKGKDFRISHWLINELGVVAIPPTEFYIKAENLLRFAVCKDDAYLENAVERLKLLKDYL... 447
14 -94.3003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  22  7...........LGTENLYFQSMWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPTVFNLPTDPEVTQAMKDALDSGNGYAPSIGFLSSREEIASYYHCPE-APLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPG-EFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFEFENDVEFTERLVAEQSVHCLPATCFE--YPNFIRVVITVPEVMMLEACSRIQEFCEQHYH. 420
15 -94.1005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  25  48.MSSRICAMAKPNDAETLSSSVDMSLSPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEP---DFDTPKVVAEAGINAIREGTRYTLNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHTSFASLDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAA-----CSKLQGQVSSGASSIAQKAGVAALGLGKAGGEVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYGSINDSSSLALYFLDKFQVAMVPGDAFG--DDSCIRISYATSLDVLQAAVEKIRKALEPLRA. 471
16 -94.1004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  21  9MTGGQQMGRDLYDDDDKDRWTSFRRIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPTVDNLKTPDIVTEAMVDVVRSGNGYPPTVGADNLRQVVSTYWRRFCQTKLKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDTNVPRLILGGTAKYQVCPGWRVGWSILIDPMNVAGDWAVGMERLTQLIAGVNSICQEAIARTLLKCPT-ECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLSYFDLKSDMEFYEKLLDEENVQVLPGEIFG--MSGFLRATVSRPSAVLNEAVDRIIEFCERHKK. 438
17 -93.4005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  22  3........................DRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQP---SAGAPEPVRAAAAAALHLNLGYSVALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAE-IDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCAW-QTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRA-----VDCLTGNFTICPPVLSQIAAVSAFTPEAT-AEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDFT---SDSLAFCSKLLADTGVAIAPGIDFDTAGGSFVRISFAGPSGDIEEALRRIGSWLPS.... 387
18 -93.2003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  23  4.........................RPSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPTVFNLPTDPEVTQAMKDALDSGNGYAPSIGYLSSREEVASYYHCPE-APLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFNEIRDGLVKLSQRILGPCTIVQGALKSILQRTPQ-EFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEHFEFENDVEFTERLIAEQSVHCLPATCFE--YPNFFRVVITVPEVMMLEACSRIQEFCEQH... 401
19 -90.9004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  19  1....................MAKQLQARRLDGIDYNPWVEFVKLA-----SEHDVVNLGQGFP---DFPPPDFAVEAFQHAVSGDNQYTKTFGYPPLTKILASFFGELLGQEIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKH-----LRTVHQNSVFHCPTQSQAAVAESFEREQLLFRFVQFPQAMQRCRDHMIRSLQSV-GLKPIIPQGSYFLITDISDFKRKMPYDRRFVKWMIKNKGLVAIPVSIFYSVFDHYIRFCFVKDEATLQAMDEKLRKWKVELENL 425
20 -90.5002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  21  1..........MGSSSSGLVPRGSHMISNKLANIPDSYFGKTMGRK--IEHGPLPLINMAVGIP---DGPTPQGIIDHFQKALTIPQKYGAFHGKEAFKQAIVDFYQRQYNVTLDKEEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL-EPPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKNPSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQA-----LKKYQTHTNAGMFGALQDAAIYALNHYDDFLE--EQSNVFKTRRDRFEAMLAKA-DLPFVHAKGGIYVWLETPPG-----DSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLALDDQKLDEAAIRLTELAYLYE.. 398
21 -90.1003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  27  1........MGTDDDDKMAATVAVDNLNPKVLKCEYAVRGEIVIHAQRLQEQLKEILYCNIGNPQSFSADSISRAKQILAMIPGRAGAYSHSQGIHGLRDAIASGIASRDGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDKKFHSFKKIVRSPLVSYQSVSKGYYGECGKRGGYFEITGFSAPV---REQIYKIASVNLCSNITGQILASLVMNPPKASAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICAKAANKAPDAFYALRLLESTGIVVVPGSGFGQPGTWHFRCTILPQEDKIPAVISRFTVFHEAFMS. 486
22 -90.1001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  18  2...................TNNPLIPQSKLPQLGTTIFTQMSALA-----QQHQAINLSQGFP---DFDGPRYLQERLAHHVAQGNQYAPMTGVQALREAIAQKTERLYGYQPDADDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQP-PHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISA-----EIRKVHQYLTFSVNTPAQLALADMLRAEPE--HYLALPDFYRQKRDILVNALNES-RLEILPCEGTYFLLVDYSA--VSTLDDVEFCQWLTQEHGVAAIPLSVFCADPHKLIRLCFAKKESTLLAAAERLRQL....... 386
23 -89.9001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  23  1.......................MRLHPRTEAAKESIFPRMSGLA-----QRLGAVNLGQGFP---SNPPPPFLLEAVRRALGRQDQYAPPAGLPALREALAEEFA------VEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDTPEGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGE-RPRRLREFAPE-RTFTVGSAGKRLEATGYRVGWIVGPKEFMP-----RLAGMRQWTSFSAPTPLQAGVAEALKLARREGFYEALREGYRRRRDLLAGGLRAM-GLRVYVPEGTYFLMAELPG---------WDAFRLVEEARVALIPASAFYDPPKDLFRFAFCKTEEELHLALERLGRVVNSPRE. 373
24 -89.7002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  21  3..................AESRPARRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNP---DGPTPPHIVEKLCTVAQREHGYSTSRGIPRLRRAISHWYRDRYDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQVGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSA-----LARIKSYHDYGTFTPLQVAAIAALEGDQQCVR--DIARQYQQRRDVLVKGLREA-GWMVENPKASMYVWAKIPE-PYAHLGSLEFAKKLLQDAKVSVSPGIGFGDYGDDHVRFALIENRDRLRQAVRGIKAMFRADGLL 401
25 -89.6001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  17  2............SSTSNETMHNKFDLPKRYQGSTKSVWVEYIQLA-----AQYKPLNLGQGFP---DYHAPKYALNALAAAANSPNQYTRGFGHPRLVQALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNADWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKN-----LQMVHQNCVYTCATPIQEAIAVGFETELKRLKFNSISGELMAKRDYMASFLAEV-GMNPTVPQGGYFMVADWSSLDSKVDKDYRFTKWMTKSVGLQGIPPSAFYSEGEDFVRYCFFKKDENLQKAAEILRKWKGS.... 428
26 -88.9002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  21  1.......................MATVSRLRPYATTVFAEMSALA-----TRIGAVNLGQGFP---DEDGPPKMLQAAQDAIAGGNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVDGRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFGMAERTITISSAAKMFNCTGWKIGWACGPAELIAG-----VRAAKQYLSYVGGAPFQPAVALALDTEDAW--VAALRNSLRARRDRLAAGLTEI-GFAVHDSYGTYFLCADPRP--LGYDDSTEFCAALPEKVGVAAIPMSAFCDPAAGLVRFTFCKRDDTLDEAIRRLSVLAERPAT. 398
27 -87.8003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  23  2.....SSGVDLGTENLYFQSMTLESMNPQVKAVEYAVRGPIVLKAGEIELEFTEVIRANIGDAQAMSFPEDAKARRILQACGGNSGSYSASQGVNCIREDVAAYIRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPCRFHSFKKVSSNVELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLL----SVRLCPPVSGQAAMDIVVNPPVAREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQEGTYHFRMTILPPVEKLKTVLQKVKDFHINFLE. 489
28 -87.7003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  16  26............QAVAQRAGTIDVQRNENFGKLRAGPEIARRRKAHQEKNPDAKIISLGIGDT---TEPLPKYIADAMAKAAEGYSGYGAEQGQGALREAVASTFYGHAG--RAADEIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYANGHADWNRVMTTCFNGASNIVQAGGLACLQP-EGLKEMNAMIKFYKENAQILKTTFTEM-GFSVYGGDDAPYIWVGFPGK-----PSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFGSRENILEAVRRFKEAYGKRNA. 442
29 -87.7005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  20  1........................ANAKRIEGLDSNVWVEFTKLA-----ADPSVVNLGQGFP---DISPPSYVKEELSKAADNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKSDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKH-----LQTVQQNSFYTCATPLQAALAEAFWIDIKRMDFNSLPKELEVKRDRMVRLLNSV-GLKPIVPDGGYFIIADVSSLGADLSYDYKFVKWMTKHKKLTAIPVSAFCDSFEKLVRFCFIKKDSTLDAAEEIFRAW....... 410
30 -87.4002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  19  3..............................RVPEPSVFLVVDEAKRKARERGVGLIDLSIGST---DLPPPEAPLKALAEALNDPTGYCLKSCTLPFLEEAARWYEGRYGVGLDPREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL--REDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALAR-----LERVKGVIDFNQYAGVLRMGVEALKTPKEVVR--GYARVYRERALGMAEALKGV--LSLLPPRATMYLWGRLPEG-----DDLEFGLRLV-ERGVALAPGRGFGPGGKGFVRIALVRPLEELLEAAKRIREALD..... 376
31 -87.2003ele_A mol:protein length:398 Amino Transferase  ali model follow..  22  1......................GMVVNESMYQLVRSAIRELFEYGKAAIVGKENVYDFSIGNP---SIPAPQIVNDTIKELVTDYHGYTSAQGDVETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADTE-HFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFVTKY--YDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGAGRALVCAPSLFQKMIVKCQGATG-------DINAYKENRDLLYEGLTRI-GYHCFKPDGAFYMFVKALE-----DDSNAFCEKAK-EEDVLIVAADGFG--CPGWVRISYCVDREMIKHSMPAFEKIYKKYNK. 398
32 -86.9006DK6 Entity 1(prereleased)  ali follow..  17  2..................ALINENFLKLKAGYLFPEIARRVKAFTEGNPEAAQRLIRCGIGDV---TEALPEAVRYAMHEAVDE-KGYGPEQGYDFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVPENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEASRRHSTKFNGASYIVQKGAEALYTDEGK-SQTKALIEHYMGNAALLVEACKNA-GLSVFGGVNAPYVWVGCPAG-----TSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFNSRANVEEVCRRIAAL....... 410
33 -85.8002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  16  1MAKRVNTCKCVATPQEKIEYKTKVSRNSNMSKLQAGPEIARRRSAHLLKYPDAQVISLGIGDT---TEPIPEVITSAMAKKAEGYSGYGAEQGAKPLRAAIAKTFYGGLG--IGDDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLYSDGAKDFNRIICTCFNGASNISQAGALACLTP-EGLEAMHKVIGFYKENTNIIIDTFTSL-GYDVYGGKNAPYVWVHFPNQ-----SSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHRENILEACRRFKQLYK..... 426
34 -83.5004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  17  16.SPSKIPKASLDFEMKKLGGSTKLVRNVNLEKLKNNPEINRRELEHIEKHPNVQLISLGTGDT---TEPIPEQITSHMSNFAHG-RGYGLEQGNKTLRKAIAETFYRDLH--VKSNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELLYSNGINDFHRIVTTSFNGASNIAQAGGLACLSSGGL-KEIRSVNNYYKENRKILMDTLVSL-GLKVYGGVNAPYLWVHFKGS-----KSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTK. 444
35 -83.4003jtx_A mol:protein length:396 aminotransferase  ali model follow..  19  1........................GMNTLLKQLKPYPFARLHEAMQGISPEGMEAVPLHIGEP---KHPTPKVITDALTASLHELEKYPLTAGLPELRQACANWLKRRDGLTVDADEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-PAPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQAAAQQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKN-----FLLYRTYHGSAMSIPVQRASIAAWDDEQ---HVIDNRRLYQEKFERVIPILQQV--FDVKLPDASFYIWLKVPD-----GDDLAFARNLWQKAAIQVLPGRFLGNPGEGYVRIALVADVATCVKAAEDIVSLYR..... 396
36 -83.0003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  19  1.......................MKRNPHFVSLTKNADLQKRVAQFRLENPQHTVINLSIGDT---TQPLNASVAEAFASSIARLRGYGPDFGLPALRQKLSEDFYRGF---VDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIILPCLQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYADGIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ----LEAIHYYRENSDLLRKALLAT-GFEVFGGEHAPYLWVKPTQANI---SDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPALQS.. 394
37 -82.3003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  16  8.................EKLIREKQNELHIKDLGMASIRDLVALVTNLKATGTKFCRMEMGVP---GLPAPQIGIETEIQKLREGSIYPNLDGLPELKQEASRFAKLFVNIDIPARACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDEPLYQPSVANTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREGEALSSSALYALSSGATHSAQWGMAAMLKACNDGENFRDSVIEYGRKARIMKKMFLDVYDKDGNEPLADGFYFTVGYK-----MDSSKLIEKFVRYGMCAITLKT-TGSKRNEAMRICTSLLPESFPDLEKRLQMLNAE.... 436
38 -82.1003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  16  2..............................MTFEPYPFERLRALLKEI-TPKKRGLDLGIGEP---QFETPKFIQDALKNHTHSLNIYPKSAFEESLRAAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPS---LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENT-PPPSLLEACMFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEK-----YKAFRAYLGYTSANAIQKASEAAWLDDR---HAEFFRNIYANNLKLARKIFKNTL-----IYPYSFYVYLPVQ-------NGENFAKTLYQNEGIITLPALYLGRNGADYVRLALVYDTPLLEKPLEIIETYRENH... 375
39 -79.6003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  14  61..........GVTESKLTINNGIMAGYINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTEL---GLNRDKVVAEWVNGAVANN-YPVPDRCLVNTEKIINYFLQEKDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHEKNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFKSIYSVVP----YNTMLVYSYSKLFGCTGWRLGVIALNEKN-----VFDDNIAHLDKVELRQLHKRYSSVVLDPDKMKFIDIGLYHTAGLSTPQQIMEALFSMTHLLTTDTNTHYYSLIDIYRYLTNNFEQVDFLLKLAEKNGVVLVDGVGFG-AKPGELRVSQANLPTEYALIGKQVLELLKEYYE. 527
40 -79.3004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  17  1..........MGSSSSGLVPRGSHMSSLRPRREDPPVLEEWYRRH--LGPDIHDISSSGVHPY---SFAEIRDVCRIPAADLDAVMDDSVSQGGEGVRRAIADRYAG-----GDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADPGADG--GDTVSYGTLSKTFGLPGLRVGWAVAPKELLT-----ATFPLRDRTTLFLSPLVELVAERAVRHADEL--IGARAAEARHNLAHLTGWMAAHEEVRWTPPEGGVCALPVFREAAAGPQEVERFCLELLERHRTLLVPGTAFG--APHGARLGFGGPQEDFRAGLDGLSRFLRERAA. 398
41 -78.7003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  26  1..........................GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEEL----FALSGTNPEDFYKKLQGTLNYGWIEGSPAFKKSVSQLYTG-----VKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEENGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELDVP----SIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTD-----ILRDYRDYTMICAGVFDDLVAQLALAHYQEI--LERNRHILEENLAILDQWIEEEPLVSYIRPAVVSTSFVKIAVD----MPMEDFCLQLLQEHGVLLVPGNRFE--RDGYVRLGFACEQETLIKGLEKLSQFLRRFDK. 373
42 -75.4001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  13  4.........................LSRNATFNSHGQDSSYFLGWQEYEKNPYHIIQMGLAENQLLAKNPEAAAFKKNGESIFAEALFQDYHGLPAFKKAMVDFMAEGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWTGVEIVPIHCTSSNGFQITETALEEAYNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVLKDQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVA---AATKMSSFGLVSSQTQHLLSAMLSDKKLTKNY--IAENHKRLKQRQKKLVSGLQKS-GISCLNGNAGLFCWVDMRHRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERLDLAMQRLKAFVGEYYNV 435
43 -73.2006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  10  2............GSSSSGLVPRGSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQR---QSASQQSIVSRLPQLWYEAEEGLQATYEKRFTEAFFQLHRQPTA--LVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLY--PIDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELARFDMYESGVRYLAIEDTGKTWPVQDAKCALITASDDIWE-----TVYNLHTSVLLNVSPFVLNMLTQYVRDSAA-DRLASVREVLTRNRECARKTLDGS-ILEYQEPVVKSVAWFRVDHPE----LTATDVHRLLSADGVYVLPGRYFPSKGDAYVRMALAREPEMFADAMALTRQVLDRHGR. 407
44 -73.1001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  19  2.........................LSKLATNEEHGENSPYFDGWKAYLKNPNGVIQMGLAENDWIKRNPKGSICSEGIKSFKAIANFQDYHGLPEFRKAIAKFMEKTRGVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGQLIPIHCESSNNFKITSKAVKEAYNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILDKDLVHIVYSLSKDMGLPGFRVGIIYSFND-----DVVNCARKMSSFGL-VSTQTQYFLAAMLSDEKFVDNLRESAMRLGKRHKHFTNGLEVV-GIKCLKNNAGLFCWMDLRPRESTFDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGVDIALARIRRFVGVEK.. 428
45 -72.1002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  12  58.............AAAESELSYSYMTVGVGGLAKLDGIEGAEHRDQEGVKFLGKSLSYVRDQL---GLDPAAFLHEMVDGIL--GCNYPVPPRMLTVSEQIVRQYIVREAVPPESVDLFAVEGGTAAMALRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIDPDNGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADEFQSLFSVCP----RNTLLVYSFSKYFGATGWRLGVIAAHKDN-----------VFDHALSQLPESAKKALDHRYRSLLP--DVRSLKFIDRLVADSRVVALNHTAGLSTPQQVQNYYTLIDLQNVTCRLSSTGDMLFRVADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRALRRLAD.... 519
46 -70.8002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  12  60..AESELSYSYMTTVGVGGLAKIDGIEGRFERY------IAENRDQEGVRFLGKSLSYVRDQL---GLDPAAFLHEMVDGILGC-NYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMALKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIDPSLNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQSLFAICP----ENTLLVYSFSKYFGATGWRLGVVAAHQQN-----VFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDYKHTLKQLIRRRETTLYRELGMPPLRD-ENAVDYYTLIDLQDWAVKQSSTGDMLFRIADETGIVLLPGRGFG-SNRPSGRASLANLNEYEYAAIGRALRKMAD.... 520
47 -70.7005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  12  6..........................................QLKENLTQWAYLALNSELNIA---DGHARQALSPGQQKIVNELVLWAESEQRPEAHQAYFTLLGQ-HGYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGA-----DLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAHYDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGL-----PVEKIYSDILLGVSPLILALIREFSRDAAD-GGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVER----VAFAGRTGTEVW-EELQRHHVFALPCRQFHSDGDHMVRIALSRSTEPLEKSVQVLRTVLET.... 375
48 -69.7003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  11  62..........SELSYSYMNTVGVGGLAKIEGIEGRFERYIAENRDQEGVRFLGKSLSYVRDQL---GLDPAAFLHEMVDGILGC-NYPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMAMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIDPALNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQSLFAICP----ANTLLVYSFSKYFGATGWRLGVVAAHKEN-----IFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDYKHTLKQLIRRREATLYRELGT-PPQRDENAVDYYTLIDLQKWAVKQSSTGDMLFRIADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRLRQMADELYA. 524
49 -69.4003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  17  2.......................MTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPA-HIPAMQDYFQTLLTDMVESGCNYDGPQGKTALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFIELLPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVP-FPGIIFSEARPLWNP-NIILCMSLSK-LGLPGSRCGIIIANDKTIT-----AIANMNGIISLAPGGMGPAMMCEMIKRNDLLRLSETIKPFYYQRVQQTIAIIRRYERCLIHKPEGAIFLWLWFK----DLPITTELLYQRLKARGVLMVPGHYFFPHTHQCMRMNYVPEPDKIEAGVKILAEEIERAWR. 415
50 -68.6003if2_A mol:protein length:444 Aminotransferase  ali model follow..  15  2.......................MKFSKFGQKFQPTGISQLMDDLGDALKSDQPVNMLGGGNPATYKALGNDNDTGKANSSAIISANYSNPQGDSAFIDALVGFFNRHYDWNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEVTHDGELENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNII--YSDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIE-----AVSAMNAVVNLAPTRFGAAIATPLVANDRIKQLSDNIKPFYQKQATLAVKLLKQA-PLMIHKPEGAIFLWLWFKDLPI---STLDLYERLKAK-GTLIVPSEYFFQHAHECIRMSIAADEQTLIDGIKVIGEVVRELYD. 442
51 -63.6002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  15  1..................GAMNPLSLNEQLQQSNATAFAMLSDLGQNMAEAKSTTYNATIGMA---TNKDGKMFASSLDAMFND-FPYAPPQGIEELRDLWQQKMLRDNP---NMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSLFTASNAILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKEVLKVKGLIRSNISSGPLPTQSAVKHVLKNNKQFQNIQTLKERYEVTKEVVYADQYH-SHWQAYDFNSGYFMAIKVHDV-----DPEALRKHLIDKYSIGVIALNATD------IRIAFSCEKDDIPHVFDSIAKAIDDLR.. 430
52 -61.6003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  14  2................................VKLENSRKPEKISNKNIPMSDFVVNLDHGDP---TAYEEYWRKMGDRCTVTIRMSYFSDMTNPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEG-----------DAWGFDKKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYTP--------TRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEV----AKKMVEYIIVNSIGVSKESQVRTAKILNVLKETCKFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKSLESYPATKEETDLVSELRRHKVMSRAGERCG-SDKKHVRVSMLSREDVFNVFLERLANMKLIKSI. 389
53 -59.8004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  12  1.......................MAMFEHIDAYPGDPILTLNENFQKDPRD--QKVNLSIGIYF--DAEGRIPVMGAVREAESGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLAAIPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAVRERRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKQW--EEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKQRGMFTYTGLTESQVDALREVHGVYILRSGRMCVAGLNDSNVGIVA--DAIGKVLKSGA......... 402
54 -59.4001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  12  6MKAAEEAEAVANINCSEHGRA--FLDGIISEGSPKCECNTCYTGPDCSEKIQGCSADVASGDG---LFLEEYWKQHKEASAVLHRMSYFFNPVSFELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNAANYVNVSNPEQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYTPIK-------YKADEDILLFTMSKFTGHSGSRFGWALIKDESV----YNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKTQKGFKKLRERWVNITALLDQSDRFSYQELPQSEYCNYFRRMRPPS-WEEDKDCYQTFQNGRINTQNGVGFE-ASSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRK. 427
55 -58.6003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  12  1.................SNAMTSVAAKHAKGKKLKDVIFVTAGQAQAKENGRENVVNGTLGAIHD-NLVFLKTVKEEYLSLSDSEVGYAPIAGIPDFLCAAEKECFGNFRPE-GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSL--DEHNNFNHEAFQNRVNQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFNKSTSRATWSNICRPAMRTMANIVADPAKFAERNCYYQLIRDRADIFKQEAAQV-GLPMLPYRGGFFITIPTD-------SANAICEELKKEHIYVIALANGIRIAACGIPKCQMTGLAEKIYNAMKSLGKL....... 418
56 -58.6005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  12  2........................SWWTHVEMGPPDPILGVTEAFKRDTNS--KKMNLGVGAYNGKPYVLPSVRKAEAQIAAKNLKEYLPIGGLAEFCKASAELALGENSEVLKSGQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKDAWA-IEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQ---LQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLA--HAIHQVTK............ 401
57 -58.5001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  1.........................MFENITATTADPILGLADLFRADERPGK--IDLGIG--VYKDETGKTPVLTSVKKAEQYLKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFALYNERVGACTLVAADSETVDRAQMKAAIRDNYSSPPAHGASVVATILSNDALRAIW--EQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL...... 396
58 -58.4003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  12  1.........................MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLGII---PQLQAVAEAEARLNAQPHGSLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASW--LKEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVDRLREEFGVYLIASG----------RMCVAGNTANVQRVAKAFAAVM...... 397
59 -58.4001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  11  1.........................MLGNLKPQAPDKILALMGEFRADPRQGK--IDLGVGVYK--DATGHTPIMRAVHAAEQRTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLTVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRAD---MAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDS----------RINIAGNDNTIPILARAIIEVG...... 393
60 -58.1004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  15  1..................SNAMPMTIKRATWNNGPDLAFDINNKANAAIEKREAVINAALGTLL--KIIALPSVYDRLDEMDRSHASYAPIEGEKDYRKIVIDTLFGPYKPE-GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDNIDVYKEAIDEGIRDSDRASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFSNLPRNLFVVVAFSMSKSHTAYGLRSGAAVGISSSKEIIE--EFEASLAHSARCNWSNGTHAAQNILIELERAEELVDLRNMLKSRADVFVTAAKEN-KLTMIPYFGGFFTFIPT--------DKAFDIVKDLEKENIFTIPSAKGI-------RVAICGGEEKIPKLVQRLAFYTNK.... 412
61 -57.9002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  1.........................MFENITTAPADPILGLADLLRADERPGK--IDLGMGVY---NDETGKTPVLTSVKKAEQTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAQMKAAIRVNYSSPPAHGASVVATILSNDALRAIW--EQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLC--EAIVAVL............. 396
62 -57.7004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  11  1........MAMGTLEAQTQGPGSMSLFSAVELAPRDPILGLNEAFNA--DTRPTKVNLGVGVY---TNEDGKIPLLRAVRDAEKPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVLGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRLAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASW--VQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTG----------RICVALNTRNLDVVANAIAAVLK..... 414
63 -57.7003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  12  2........................SWWTHVEMGPPDPILGVTEAFKRDTNS--KKMNLGVGAY---RDDNGKPYVLPSVRKAEADKEYLPIGGLAEFCKASAELALGENNEVLKSGQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWA-IEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVQLKILIRPLYSNPPLNGARIAATILTSPDLRKQW--LQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLA--HAIHQVTK............ 401
64 -57.6004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  11  1.....................MAVGTFENITAAPADPILGLADLFRADERPGK--INLGIGVYK--DETGKTPVLTSVKKAEQYTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAQMKAAIRANYSNPPAHGASVVATILSNDALRAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL------TKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL...... 400
65 -57.4004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  1................MAMGTLEAQTQGPGSMGKPDPILGLGQDFRMDPAK--RKVNLSIGVYR--DDADQPFVLECVKQATLGTMDYAPVTGIASFVEEAQKLCFGPTCAALRDGQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFVPVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLQLALLIRPMYNNPPLYGAWVVSSILKDPQLTALW--KKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMMAYTGLTREQVELLRSEYHIYMTLNGRAAVSGLNSTNVEYVS--QAIHNVTK............ 403
66 -56.6001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  11  1.........................MFENITAAPADPILGLADLFRADERP--GKINLGIGLY---YDETGKIPVLTSVKKAEQTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAQMKAAIRANYSSPPAHGASVVATILSNDALRAIW--EQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL............. 396
67 -56.6004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  1.............................MAMGKPDPILGLGQDFRM--DPAKRKVNLSIGVYR--DDADQPFVLECVKQATLGTMDYAPVTGIASFVEEAQKLCFGPTCAALRDGQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFV-VDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLQLALLIRPMYSNPPLYGAWVVSSILKDPQLTALW--KKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMMAYTGLTREQVELLRSEYHIYMTLNG----------RAAVSLNSTNVEYVSQAIHNVTK..... 390
68 -56.5003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  11  1.........................MFENITAAPADPILGLADLFRADERP--GKINLGQGVYK--KTPVLTSVKKAEQYLLENEKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAQMKAAIYANYSNPPAHGASVVATILSNDALRAELTDMRQRIQRMRQLFVNTLQEKG------ANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL...... 396
69 -56.5002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  11  1.........................MFENITTAPADPILGLADLLRADERP--GKIDLGMGVYN--DETGKTPVLTSVKKAEQYTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAQMKAAIRVNYSSPPAHGASVVATILSNDALRAELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGL------TKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL...... 396
70 -55.7003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  10  1................................MQPVLVFKLTADFREDPDPRKVNLGVGACHP---WVLPVVKKVEQKIANDNSLHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKR-GFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVQMEKIVRITWSNPPAQGARIVASTLSNPELFEEW--TGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATVTKIAENLYFQSDYKDDDDK. 416
71 -54.6001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  10  1.........................MFENITAAPADPILGLADLFRADERPGK--INLGIGVYK--DETGKTPVLTSVKKAEQYTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAQMKAAILANYSNPPAHGASVVATILSNDALRAIW--EQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASG----------LVNVAGTPDNMAPLCEAIVAVL...... 396
72 -53.8002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  20  7.........................LAGRANWIKGSALADVMKKASELQKKGVKLISLAAGDPDPELIPRAGEIAKEVLEKEPKSVMYTPANGIPELREELAAFLKKYDHLEVSPENIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDG---MRVDLLEEKIKELKAKLIYTIPTNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKALDNEGRVIVAGTLSKVLG-TGFRIGWIIAEGEILK-----KVLMQKQPIDFCAPAISQYIALEYLRGYFEKYHLEGALLGYKEKRDIMLKALENLPNAEFTKPIAGMFVMFFLPEG-----DGISFANELMEREGVVVVPGKPFDESGKNAIRLNFSPSKEEIPIGIKKLAKLYKEK... 404
73 -53.6004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  11  1.....................MAVGTFENITAAPADPILGLADLFRADERPGK--VDLGIG--VYKDETGKTPVMTSVKKAEQYTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAQMKAAIRANYSSPPAHGASVVATILSNDALRAIW--EQELTDMRQRIQRLRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASG----------RVNVAMTPDNMAPLCEAIVAVL...... 400
74 -52.8003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  18  13..........................................RNTMKWTRYGQGVLPLWVAE---SDFSTCPAVLQAITDAVQREAGYQPDG--SLLSQATAEFYADRYGYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGI----FIDATGGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDG-QHTVAAGVSDTSVCITITAPSKAWNIAGLKCAQIIFSNPSDAE----HWQQLSPVIKDGASTLGLIAAEAAYRYGTD---LNQEVAYLKNNHDFLLHEIPKIPGAKITPMQATYLMWIDFRDTTI----EGSPSEFFIEKAKVAMNDGAWFGEDGTGFCRLNFATSREVLEEAIDRMAKAVSHHT.. 377
75 -52.3001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  11  1.........................MFENITTAPADPILGLADLLRADERPGK--IDLGMGVYN--KTPVLTSVKKAEQYLLENEKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAAMHKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAQMKAAIRVNYSSPPAHGASVVATILGNDALRAIWEQELTDM--RQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASG----------RLNVAMTPDNLAPLCEAIVAVL...... 396

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.