current user: public

If you have questions about the server, please let us know.

Query: 4did_B mol:protein length:152 Inositol phosphate phosphatase sopB, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst QILSGQGKAPAKAPDARPEIIVLREPGATWGNYLQHQKASNHSLHNLYNLQRDLLTVAATVLGKQDPVLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAAVAFRDAQVKQLNNQPWQTIKNTLTHNLast
1 -89.4004did_B mol:protein length:152 Inositol phosphate phosphatase sopB  ali model  100  1QILSGQGKAPAKAPDARPEIIVLREPGATWGNYLQHQKASNHSLHNLYNLQRDLLTVAATVLGKQDPVLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAAVAFRDAQVKQLNNQPWQTIKNTLTHN 152
2 -6.1604hr1_A mol:protein length:126 Putative uncharacterized protein  ali model follow..  23  2.....................................................AFNGAQTVIQKISWLRTAIAFLKGYMETTG---ATKKELEQVEKLKERVDEIATA-------VNWDVYAQYARGDFN-----LLSDDEYKEIQKAL... 82
3 -5.7002v1n_A mol:protein length:111 PROTEIN KIN HOMOLOG  ali model follow..  2........................................................................................QRQLLLASENPQQFMDYFSEEFRND-RRRFGTKRVHNNIVYNEYISHHMNATQWETLTDFTKW. 72
4 -5.3402fre_A mol:protein length:200 NAD(P)H-flavin oxidoreductase  ali model follow..  13  4............................................................................................SNNRQSEYPVDPLFLDRWSPRAFDGSPMPKEHLLTILDAAH-SASNHQPWRFV....... 58
5 -5.2903ady_A mol:protein length:148 DotD  ali model follow..  3.HMAGTMKFKKPSDDATIKLAEAAVSVSDSMLEMAKVEKVITPPSKDNTLTIPNAYNLQARAGPIEELTARIAKAAHRFRVLGKSPSVP-SISTKDESLAEILRDIDYQAGKKASIHVYPNSQVVELRYAKIYS.................. 148
6 -5.2603anw_A mol:protein length:188 Putative uncharacterized protein  ali model follow..  11  4...............................VKLRELLEAELSSTDLNELDEDFYVEFDSLIKALKLSAESSRERGEDVEER----LYLAQLKIAESLMKEIIKLRLHKIVDLAVEGKIAEMTAEEKRLFNVIRAFIEREELPEISEEVQ.. 118
7 -5.2105lsi_E mol:protein length:76 Kinetochore-associated protein NSL1 homolog  ali model follow..  19  16....................................................................................RCTSKRAVTEMLQLCGRFVQKLGDALPEE---IREPALRDAQWTFESAVQESINGQAWQEAS...... 76
8 -5.1102mr3_A mol:protein length:393 26S proteasome regulatory subunit RPN9  ali model follow..  13  259.......................................TVGDFDKFDSLIKVQISKIPILAQHESFLRQKICTLIETVFVKNIRMLSFEDISKATHLPKDNVEHLVMRAISLGLLKGSIDQVNELVTISWVQPRIISGDQITKMKDRLV.. 371
9 -5.0805a5t_M mol:protein length:374 EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT M  ali model follow..  10  253...................................................VKFYQNNKDFIDSLGLLHEQNMAKMRLLTFVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLN.. 355
10 -5.0504p8i_A mol:protein length:260 Protein-glutamine gamma-glutamyltransferase  ali model follow..  11  1.....................................................MIIVSGQLLRPQDIENWQIDQDLNPLLKEMIETPVQFDYHSIAELMFEL---------RMNIVAAAKTLHKSGAKFATFLKTYGNTTYWRVSPEG.... 88

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.