current user: public

If you have questions about the server, please let us know.

Query: 4eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410
# Score Template Links and tools%idFirst MAMGTLEAQTQGPGSMSLFSAVELAPRDPILGLNEAFNADTRPTKVNLGVGVYTNEDGKIPLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTAQALGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNGYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTGRICVAALNTRNLDVVANAIAAVLKLast
1 -129.0004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model  100  1MAMGTLEAQTQGPGSMSLFSAVELAPRDPILGLNEAFNADTRPTKVNLGVGVYTNEDGKIPLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVTAQALGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYYDAKTNGVNFDGMLAALNGYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVERLKAAGIERDFSFINAQRGMFSYSGLTSAQVDRLREEFGIYAVSTGRICVAALNTRNLDVVANAIAAVLK 414
2 -122.0001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  45  1.................MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL. 396
3 -122.0004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  51  1...............MAMFEHIDAYPGDPILTLNENFQKDPRDQKVNLSIGIYFDAEGRIPVMGAVREAETALQRDSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIATLQTLGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYYDEATGGLKFDAMLAAIDALPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHDGLRDHVSGEALTRYVKQRGMFTYTGLTESQVDALREVHGVYILRSGRMCVAGLNDSNVGIVADAIGKVLK 399
4 -121.0004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  46  2..............AVGTFENITAAPADPILGLADLFRADERPGKVDLGIGVYKDETGKTPVMTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL. 400
5 -121.0001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  46  1.................MFENITAAPADPILGLADLFRADERPGKINLGIGLYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL. 396
6 -121.0001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  46  1.................MFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGLVNVAGMTPDNMAPLCEAIVAVL. 396
7 -121.0001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  45  1.................MFENITATTADPILGLADLFRADERPGKIDLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFALYNERVGACTLVAADSETVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL. 396
8 -120.0002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  45  1.................MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL. 396
9 -119.0001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  38  1.................MLGNLKPQAPDKILALMGEFRADPRQGKIDLGVGVYKDATGHTPIMRAVHAAEQRMLETETTKTYAGLSGEPEFQKAMGELILGDGLK---SETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYFDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASRIPEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMAFLNRQTYSFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAGELRDLSGSDRFGFVAEHRGMFSRLGATPEQVKRIKEEFGIYMVGDSRINIAGLNDNTIPILARAIIEVG. 393
10 -119.0002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  46  1.................MFENITTAPADPILGLADLLRADERPGKIDLGMGVYNDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL. 396
11 -119.0003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  44  1...............SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRFVTVQTISGTGALRVGASFLRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTVVCKDAEEAKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK 401
12 -119.0003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  54  1.................MFQKVDAYAGDPILTLMERFKEDPRSDKVNLSIGLYYNEDGIIPQLQAVAEAEARLAQPHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRVATIQTLGGSGALKVGADFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWYDEATNGVRFNDLLATLKTLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASAGLPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQLKATVRRNYSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVKVLSTEMPERNFDYLLNQRGMFSYTGLSAAQVDRLREEFGVYLIASGRMCVAGLNTANVQRVAKAFAAVM. 397
13 -118.0005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  44  1...............SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGASFLQRFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQVTK 401
14 -118.0004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  47  2..............AVGTFENITAAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL. 400
15 -116.0003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  46  1.................MFENITAAPADPILGLADLFRADERPGKINLGQGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIYANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL. 396
16 -116.0004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  42  1.....................MAMGKPDPILGLGQDFRMDPAKRKVNLSIGVYRDDADQPFVLECVKQAT-----LGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGRIASCQTLGGTGALRIGGDLLRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLDKAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQDYDAFVPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLALLIRPMYSNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMMAYTGLTREQVELLRSEYHIYMTLNGRAAVSGLNSTNVEYVSQAIHNVTK 390
17 -114.0003wzf_A mol:protein length:412 Aspartate aminotransferase, cytoplasmic  ali model follow..  42  1.............APPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNSNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWNKNTPVYVSSPTWENHNAVFSAAGFKDISYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVT 409
18 -113.0004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  42  1MAMGTL--------EAQTQGPGSMGKPDPILGLGQDFRMDPAKRKVNLSIGVYRDDADQPFVLECVKQAT-----LGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGRIASCQTLGGTGALRIGGDLLNRVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYYDPATKGLNLAGMLECLDKAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQDYDAFVPRHLVDMVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLALLIRPMYNNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVSELKACGSVHDWSHIERQVGMMAYTGLTREQVELLRSEYHIYMTLNGRAAVSGLNSTNVEYVSQAIHNVTK 403
19 -111.0001yaa_A mol:protein length:412 ASPARTATE AMINOTRANSFERASE  ali model follow..  38  1..............SATLFNNIELLPPDALFGIKQRYGQDQRATKVDLGIGAYRDDNGKPWVLPSVKAAEKLIHNDSSNHEYLGITGLPSLTSNAAKIIFGTQSDALQEDRVISVQSLSGTGALHISAKFFSKFFPDKLVYLSKPTWANHMAIFENQGLKTATYPYWANETKSLDLNGFLNAIQKAPEGSIFVLHSCAHNPTGLDPTSEQWVQIVDAIASKNHIALFDTAYQGFATGDDKDAYAVRLGVETVSPVFVCQSFAKNAGMYGERVGCFHLALTKQAQNKTVTSQLAKIIRSEVSNPPAYGAKIVAKLLETPELTEQWHKDMVTMSSRITKMRHALRDHLVKLGTPGNWDHIVNQCGMFSFTGLTPQMVKRLEETHAVYLVASGRASIAGLNQGNVEYVAKAIDEVVR 409
20 -110.0003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  43  1........................MQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKINDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLGTNNKNTPVYVSSPTWENHNAVFSAAGFKDISYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNERDAWAIRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVT 398
21 -109.0004rkc_A mol:protein length:398 Aromatic amino acid aminotransferase  ali model follow..  47  1.................MFERIDYYAGDPILGLVEKFAADNNPDKVNLGIGIYYDESGVMPVLDCVKIAEQRIADPISPRPYLPMAGLPGHRKGCQELLFGKDAPVLKDGLVATIATIGGSGALKVGAEFIHEWFPQSKCYVSDPTWGNHIAIFEGCDIEVGKYPYYDTATGGIKFDEMIAFFETLNKDDVLLLHPCCHNPTGVDLTREQWDTVLNVIQERELIPFMDIAYQGFGEDMDSDAYAIRKAVDMGLPLFVSNSFSKNLSLYGERVGGLSVVCPTVDETERVFGQLNSTVRRIYSSPPSHGGRVVDIVMNDAALHEQWVGEVYAMRDRIKSMRTKLKSVLEAKISGRNFDYLTAQNGMFSFTGLTPEQVERLQSEFGIYMISNSRMCVAGLNSSNIDYVANAMVDVLK 397
22 -108.0001aat_A mol:protein length:411 CYTOSOLIC ASPARTATE AMINOTRANSFERASE  ali model follow..  43  1..............AASIFAAVPRAPPVAVFKLTADFREDGDSRKVNLGVGAYRTDEGQPWVLPVVRKVEQLIAGNGSNHEYLPILGLPEFRANASRIALGDDSPAIAQKRVGSVQGLGGTGALRIGAEFLRRWNTATPVYVSSPTWENHNSVFMDAGFKDIRTYYWDAAKRGLDLQGLLSDMEKAPEFSIFILHACAHNPTGTDPTPDEWKQIAAVMKRRCLFPFFDSAYQGFASGNEKDAWAVRYFVSEGFELFCAQSFSKNFGLYNERVGNLSVVGKDEDNVQRVLSQMEKIVRTTWSNPPSQGARIVATTLTSPQLFAEWKDNVKTMADRVLLMRSELRSRLESLGTPGTWNHITDQIGMFSFTGLNPKQVEYMIKEKHIYLMASGRINMCGLTTKNLDYVAKSIHEAVT 408
23 -107.0004f5g_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  46  2..............AVGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVLTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDIAYQGFGRGLEEDAEGLRAFAAMHKELIVASSCSKNFGLYNERVGACTLVAADSETVDRAFGQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFVIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL. 400
24 -107.0002d5y_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  46  1.................MFENITTAPADPILGLADLFRADERPGKINLGIGVYKDETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFTIKQNGMFFFGGLTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLCEAIVAVL. 396
25 -106.0003meb_A mol:protein length:448 Aspartate aminotransferase  ali model follow..  37  1MAMGTLEAQTQGPGSMSVFSGFPASPPDAILNLTVLYNADTNPKKVNLGVGAYRDESGKPWILPAVKEAEAIISSDLSNKEYPPVAGFPLFLEAAQFLMFGKDSKAAQEGRIASCQSLSGTGSLHIGFEFLHLWMPKAEFYMPSTTWPNHYGIYDKVFNKLKVTYLRKDGELEIDFSNTKKDIQSAPEKSIFLFHACAHNPSGIDFTEAQWKELLPIMKEKKHIAFFDSAYQGFATGSEADAFAVRMFVDAGVEVLVAQSFSKNFGLYGERIGCLHVVHAGVEGSVEKVSGMTLQIRKTWSMSAIHGAYIVQVIVHDKRLLQMFYDNVKEMSARIHRMRSLLHASLAKRKTPGTWDHILTAIGMFTFTGLTPEHVDYLKEKWSIYLVKGGRMSMCGLTESNCDYVAEAIHDAVT 436
26 -106.0003uak_A mol:protein length:406 De Novo designed cysteine esterase ECH14  ali model follow..  44  1.................MFENITAAPADPIYGLADLFRADERPGKINLGLALYYDETGKIPVLTSVKKAEQYLLENETTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGHGALRVAADFLAKNTSVKRVWVYNPSSNCSKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFTGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFTFFYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNESVGACTLVAADSETVDRAFSQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVLG 397
27 -106.0004f5f_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  47  2..............AVGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVLTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVGADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL. 400
28 -105.0004f5k_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  47  2..............AVGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVMTSVKKAEQYLLENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPTWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDIAYQGFGRGLEEDAEGLRAFAAMHKELIVASSCSKNFSLYNERVGACTLVAADSETVDRAFGQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL. 400
29 -105.0004f5i_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  47  2..............AVGTFENITAAPADPILGLADLFRADERPGKVDLGVGVYKDETGKTPVMTSVKKAEQYLLENETTKTYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPTWPNHKAIFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLIDIAYQGFGRGLEEDAEGLRAFAAMHKELIVASSCSKNFSLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRINVAGMTPDNMAPLCEAIVAVL. 400
30 -104.0005ton_A mol:protein length:414 Aspartate aminotransferase, cytoplasmic  ali model follow..  41  1...........GMAPPSVFAEVPQAQPVLVFKLIADFREDPDPRKVNLGVGAYRTDDCQPWVLPVVRKVEQRIANNSSNHEYLPILGLAEFRTCASRLALGDDSPALQEKRVGGVQSLGGTGALRIGAEFLARWYNGTPVYVSSPTWENLNGVFTTAGFDIRSYRYWDTEKRGLDLQGFLSDLENAPEFSIFVLHACAHNPTGTDPTPEQWKQIASVMKRRFLFPFFDSAYQGFASGNEKDAWAIRYFVSEGFELFCAQSFSKNFGLYNERVGNLTVVAKEPDSILRVLSQMQKIVRVTWSNPPAQGARIVARTLSDPELFHEWTGNVKTMADRILSMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLINQKHIYLLPSGRINMCGLTTKNLDYVATSIHEAVT 411
31 -103.0001aka_A mol:protein length:401 ASPARTATE AMINOTRANSFERASE  ali model follow..  43  1...............SSWWSHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLNCVRKAEAMIAAKKMDKEYLPIAGLADFTRASAELALGENSEAFKSGRYVTVQGISGTGSLRVGANFLQRFKFSRDVYLPKPSWGNHTPIFRDAGLQLQAYRYYDPKTCSLDFTGAMEDISKIPEKSIILLHACAHNPTGVDPRQEQWKELASVVKKRNLLAYFDMAYQGFASGDNRDAWALRHFIEQGIDVVLSQSYAHNMGLYGERAGAFTVICRDAEEAKRVESQLKILIRPMYSNPPMNGARIASLILNTPELRKEWLVEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPEQVERLTKEFSIYMTKDGRISVAGVASSNVGYLAHAIHQVTK 401
32 -98.8004h51_A mol:protein length:420 Aspartate aminotransferase  ali model follow..  32  2.....AMSTQAAMTTAERWQKIQAQAPDVIFDLAKRAAAAKGP-KANLVIGAYRDEQGRPYPLRVVRKAEQLLLDMNLDYEYLPISGYQPFIDEAVKIIYGNTVE---LENLVAVQTLSGTGAVSLGAKLLTRVFDTTPIYLSDPTWPNHYGVVKAAGWNICTYAYYDPKTVSLNFEGMKKDILAAPDGSVFILHQCAHNPTGVDPSQEQWNEIASLMLAKHHQVFFDSAYQGYASGSDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIREEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRRTVYDELLRLQTPGSWEHVINQIGMFSFLGLSKAQCEYC-QNHNIFITVSGRANMAGLTHETALMLAQTINDAVR 409
33 -97.9003k7y_A mol:protein length:405 Aspartate aminotransferase  ali model follow..  31  3................KLLSSLENIEVDNILKTAREFKEDTCEEKINLSIGVCCNDDGDLHIFDSVLNADKLVTENYKEKPYLLGNGTEDFSTLTQNLIFGNNSKYIEDKKICTIQCIGGTGAIFVLLEFLKML-NVETLYVTNPPYINHVNMIESRGFNLKYINFFDYNLIDINYDLFLNDLRNIPNGSSVILQISCYNPCSVNIEEKYFDEIIEIVLHKKHVIIFDIAYQGFGHTNEEDVLLIRKFEEKNIAFSVCQSFSKNMSLYGERAGALHIVCKNQEEKKIVFNNLCFIVRKFYSSPVIHTNRILCQLLNNQNLKLNWIKELSQLSQRITNNRILFFNKLETYNLNYDWNVYKKQRGLFSFVPLLAKIAEHL-KTHHIYIINNGRINVSGITKNNVDYIADKICLSLS 403
34 -95.7004wb0_A mol:protein length:414 Broad specificity aminotransferase  ali model follow..  33  4.......STQAAMTTTERWQKIQGRAPDPIFELAKRAAAAKGP-KANLVIGAYRDEQGLPYPLRVVRKAEQLLLDMNLNYEYLPISGYQPFIDEAVKMTYGDTV---ELENLVAVQTLSGTGALSLGAKLLTHVFDKTPIYLADPTWPNHYSIVKAAGWKIRTYAYYDHKTLGLDFEGMKKDILAAPDGSVFLLHQCAHNPTGVDPSQEQWNEIASLMLAKHHQVFFDSAYQGYASGSDTDAYAARLFARRGIEVLLAQSFSKNMGLYSERAGTLSLLLKDKTKRADVKSVMDSLIRAEYTCPPAHGARLAHLILSNNELRKEWEAELSAMAERIRTMRRTVYDELLRLQTPGRWEHVINQIGMFSFLGLSKEQCEYC-QNHNIFITLSGRANIAGLTHETALMLAQTINDAVR 409
35 -81.9004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  21  1..........SNAMPMTIKRATWNNGPDLAFDINAAIEKYGREAVINAALGTLLDDKGKIIALPSVYDRLDEMD-RSHIASYAPIEGEKDYRKIVIDTLFGPYKP---EGYISAIATPGGTGAIRSAIFSY--LDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDF-AFNIDVYKEAIDEGSDRIASLINSPGNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEKFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGISSSKEIIEEFEASLAHSARCNWSNGT-HAAQNILIELERAENKKIYEQELVDLRNMLKSRADVFVTAAKENK----LTMIPYFGGFFTFIPTDKFDIVKDLEKENIFTIPGIRVAICGVGEEKIPKLVQRLAFYTN 411
36 -81.0003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  21  1.........SNAMTSVAAKHAKGKKLKDVIFVTAGQAQENGRENVVNGTLGAIHDEEGNLVFLKTVKEEYLSLS-DSEHVGYAPIAGIPDFLCAAEKECFGNFRP---EGHIRSIATAGGTGGIHHLIHNY--TEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLFDEHNN--AFQNRVNELAAKQTNVVVIFNTPGNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKFSHLPKETCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNKSTSRATWSNICRPAMRTMANIVADPAKFKEYEAERNCYYQLIRDRADIFKQEAAQVG----LPMLPYRGGFFITIPTDSANCEELKKEYVIALANGIRIAACGIPKCQMTGLAEKIYNAMK 413
37 -73.0002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  18  1........GAMNPLAQSLNEQLQQSNATAFAMLSDLGQAEAKSTTYNATIGMATNKDGKMFASSLDAMFND--LTPDEIFPYAPPQGIEELRDLWQQKMLRDNPELSIDNMSRPIVTNALTHGLSLVGDLF--VNQDDTILLPEHNWGNYKLVFNTRNGANLQTYPIFDKDGHYTTDSLVEALQSYNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTFTALTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNK---QFDKEIEQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVHEALRKHLIDKYSIGVIADIRIAFSCVEKDDIPHVFDSIAKAID 427
38 -62.8001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  16  1...............MALSDRLELVSASEIRKLFDIAAG--MKDVISLGIGEPDFDTPQHIKEYAKE------ALDKGLTHYGPNIGLLELREAIAEKLKKQNGIEADPKTEI---MVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNVDELKKYVT---DKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHY-SIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAP-------SWIIERMVKFQMYNATCPVTFIQYAAAKALKDERKAVEEMRKEYDRRRKLVWKRLNEM-GLPTVKPKGAFYIFPRIRDTGLT---SKKFSELMLKEARVAVVPGSRISYA-TAYEKLEEAMDRMERVLK 384
39 -61.1004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  14  6..............SKRFNKNLNKIEVSMIRQFDQSISD--IPDVLKLTLGEPDFATPKHIKEAAKR------AIDADESHYTGMAGLLALRQAASAFVKEKYHLTYNPDNEI---LVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDT-RSNDFVLTPEMLEEAILKEGEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEYLPD---QTILISGLSKSHAMTGWRLGLIFAP-------AVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAM-KFKIIKPDGAFYIFAKIPVAQGQD--SFKFLQDFAKEKAVAFIPGVRISYA-ASMETIKEAMKRLKEFME 389
40 -60.6003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  13  5..............EAKFKKLGTDNAPGQEVRQSAAGLEALIRRPVDFSHGDVDAHEPT----PGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGL---IITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLADETRAGLDLTGLEEAFK---AGARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGS-------RAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCEGVFARTPQAGSYLFPRLPKL------PAEFVKILRLQAGVVVTPGTRLNFS-QDHEAAVAAARRIVTLVE 403
41 -60.0001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  16  1...............MKLAARVESVSPSMTLIIDAKAKAAEGIDVCSFSAGEPDFNTPKHIVEAAKA------ALEQGKTRYGPAAGEPRLREAIAQKLQRDNGLCYGADNIL----VTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSPEQIRQAIT---PKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAASPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHST-------SNVCTFAQYGAIAAYENSQDCVQEMLAAFAERRRYMLDALNAMPGLECPKPDGAFYMFPSIAKT---GRSSLDFCSELLDQHQVATVPGARLSYA-TDLDTIKRGMERLEKFLH 385
42 -59.9001xi9_A mol:protein length:406 putative transaminase  ali model follow..  11  1............AGSIRASKRALSVE-YAIRDVVLPAREKKGIKVIRLNIGDPDFQPPEHMKEAYCK------AIKEGHNYYGDSEGLPELRKAIVEREKRKNGVDITPDDVR----VTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTIEEEDWQPDIDDIRKKIT---DRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPG----LTKDVPVIVMNGLSKVYFATGWRLGYMYFVDPENKL--SEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPKIEVGPWKN--DKEFVLDVLHNAHVLFVHGSRAVFL-PPIEILEEAMDRFEKFMK 395
43 -58.8002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  13  1..MGSSSSGLVPRGSHMISNKLANIPDSYFGKTMGRKIEHGPLPLINMAVGIPDGPTPQG-----IIDHFQKALTIPENQKYGAFHGKEAFKQAIVDFYQRQYNVTLDKEDEV---CILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNL-EPPHYLPDWSKVDSQII---DKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDAKN--PSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTN-------AGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKA-DLPFVHAKGGIYVWLETPPGYD----SEQFEQFLVQEKSILVAPGKRISLA-LDDQKLDEAAIRLTELAY 395
44 -58.8005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  13  1................ANAKRIEGLDSNVWVEFTKLAAD---PSVVNLGQGFPDISPPSY-----VKEELSKAAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEEI---LVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKSDWTFDPRELESKFS---SKTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHV-KIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLNSV-GLKPIVPDGGYFIIADVSSLGADLSYDYKFVKWMTKHKKLTAIPVSRFCFI-KKDSTLDAAEEIFRAW.. 410
45 -58.2001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  17  3................GLSRRVQAMKPSATVAVNAKALERQGVDLVALTAGEPDFDTPEHVKEAARR------ALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPEETI----VTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAIT---PRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH----FSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQST-------TSPDTIAQWATLEALTNQEAFVEMAREAYRRRRDLLLEGLTAL-GLKAVRPSGAFYVLMDTSPI---APDEVRAAERLLEA-GVAVVPGTRLSYA-TSEENLRKALERFARVLG 383
46 -58.0001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  19  1..........MGSDKIMVSRRISEIPISKTMELDAKAKAKKGEDVINLTAGEPDFPTPEPVVEEAVR------FLQKGEVKYTDPRGIYELREGIAKRIGERYKKDISPDQVV----VTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSLEEVEGLLV---GKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTDEF--TSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTT-------SCINTVAQYAALKALEVDN---SYMVQTFKERKNFVVERLKKM-GVKFVEPEGAFYLFFKVRG------DDVKFCERLLEEKKVALVPGSRLSFA-TSIERLTEALDRIEDFLN 381
47 -57.7003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  15  4.................KNSSRSAVDPFIVMDVMEAAREEAGRRIIHMEVGQPGTGAPRGAVEALAK------SLETDALGYTVALGLPALRQRIARLYGEWYGVDLDPGRVV----ITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADFAG------LDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVT-----ALELTDECYVINSFSKYFSMTGWRVGWMVVP-------EDQVRVVERIAQNMFICAPHASQVAALAALDCDAELQA-NLDVYKANRKLMLERLPKAGFTRIAPPDGAFYVYADVSDL---TDDSRAFAAEILEKAGVAVTPGLRFSYAR-ATADIEEGLDRLEAFMQ 380
48 -57.7004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  11  9IPTTENLYFEGAMSPIEKSSKLENVCYDIRGPVLKEAKREEGNKVLKLNIGNPGFDAPDEILVDVIRNLPT-------AQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIY----IGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKIT---PRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPL--APDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYI--EGLEMLASMRLCANVPAQHAIQTALGGYQSISEFPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEKVLLVQGTRIVTL-PRVDDIELSLSKFARFLS 420
49 -57.2002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  16  2.........GSDKIMDVFSDRVLLTEESPIRKLVPFAEKKRGVRIHHLNIGQPDLKTPEVFF-------ERIYENKPEVVYYSHSAGIWELREAFASYYKRRQRVDVKPENVL----VTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIP-QNLESFIN---ERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRGEF----ASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQ-------GRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHGLKRFTKPSGAFYITAELPVE------AEEFARWMLTDFNTMVAPLIRIACV-LEKDLLSRAIDVLMEGLK 394
50 -57.2001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  14  2....SSTSNETMHNKFDLPKRYQGSTKSVWVEYIQLAAQ---YKPLNLGQGFPDYHAPKYALNALAAAANS----DPLANQYTRGFGHPRLVQALSKLYSQLVDRTINPMTEV---LVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKDWVLDNNELEALFN---EKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHI-RICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFETELKRLKSPECYFNSISGELMAKRDYMASFLAEV-GMNPTVPQGGYFMVADWSSLDSKVDLDYRFTKWMTKSVGLQGIPPSRYCFF-KKDENLQKAAEILRKWKG 427
51 -56.9003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  14  24..VVQAVAQRAGTIDVQRNENFGKLRAGYLFPEIARRRKNPDAKIISLGIGDTTEPLPKY-IADAMAKAAAGLATREGYSGYGAEQGQGALREAVASTFYGHAGRAADE-------IFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHFFLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPK-TIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYANGEVHADWNRVMTTCFNGASNIVQAGGLACLQEGLKEMNAMIKFYKENAQILKTTFTEM-GFSVYGGDDAPYIWVGFPGK------SWDVFAEILERCNIVTTPGSRASAFG-SRENILEAVRRFKEAYG 438
52 -56.4005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  15  3................DRVALRAGVPPFYVMDVWLAAAERTHGDLVNLSAGQPSAGAPEPVRAAAAA------ALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEPDAVV----ITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQ----MLAEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCA---WQTSRNAVVVNSFSKYYAMTGWRLGWLLVP-------TVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATEADGNLASYAINRSLLLDGLRRIGIDRLAPTDGAFYVYADVSDF---TSDSLAFCSKLLADTGVAIAPGIRISFAG-PSGDIEEALRRIGSWLP 386
53 -56.3005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  13  55MAKPNDAETLSSSVDMSLSPRVQSLKPSKTMVITDLAATQSGVPVIRLAAGEPDFDTPKVVAEAGIN------AIREGFTRYTLNAGITELREAICRKLKEENGLSYAPDQIL----VSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKISNNFLLDPKDLESKLT---EKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHT-SFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVS-------SGASSIAQKAGVAALGAGGETVAEMVKAYRERRDFLVKSLGDIKGVKISEPQGAFYLFIDFSAYYGLINDSSSLALYFLDKFQVAMVPGDRISYA-TSLDVLQAAVEKIRKALE 467
54 -56.3001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  15  9...................SNHAGLVFNPIRTVSDNAKSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEAIDSQE-CNGYFPTVGSPEAREAVATWWRNELKSTIVKDNVV----LCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCRPENDWEADLDEIRRLKD---DKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDPNATFTSVADFEVPRVILGGTAKNLVVPGWRLGWLLYV-DPHGNGPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECIGLAPTMPRGAMYLMSRIDLEYRDIKTDVEFFEKLLEEENVQVLPGTRLTTT-RPVEVYREAVERIKAFCQ 411
55 -56.1003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  13  14.NLMSTSRPKVVANKYFTSNTAKDVWSLTNEAAAKAANKNQGRELINLGQGFFSYSPPQF-----AIKEAQKALDIPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAENVT----VTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPITRGEEWTIDFEQFEKAIT---SKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFT-DSFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNA------ELLSYAAKAHTRICFASPSPLQEACANSINDAL-YFEKMRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKV-LNKGKDFRISHWLINELGVVAIPPTRFAVC-KDDAYLENAVERLKLLKD 445
56 -56.0001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  15  1..........MTNNPLIPQSKLPQLGTTIFTQMSALAQQ---HQAINLSQGFPDFDGPRYLQERLAH------HVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADSDI---TVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMAL-QPPHFRVDWQEFAALLS---ERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHA-SVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAP-------APISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNES-RLEILPCEGTYFLLVDYSAVSTLD--DVEFCQWLTQEHGVAAIPLSRLCFA-KKESTLLAAAERLRQL.. 386
57 -55.1002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  14  12...ATPQEKIEYKTKVSRNSNMSKLQAGYLFPEIARRRKYPDAQVISLGIGDTTEPIPEV-ITSAMAKKAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIGDDD-------VFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMRCTPEN-LSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDDNP--RSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKLLYSDGPVAKDFNRIICTCFNGASNISQAGALACLTEGLEAMHKVIGFYKENTNIIIDTFTSL-GYDVYGGKNAPYVWVHFPNQ------SWDVFAEILEKTHVVTTPGSRVSAFG-HRENILEACRRFKQLYK 426
58 -54.7002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  16  1...............MATVSRLRPYATTVFAEMSALATR---IGAVNLGQGFPDEDGPPKMLQAAQD------AIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPETEV---LVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVDGRGFALDADALRRAVT---PRTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHL-PLAGFDGMAERTITISSAAKMFNCTGWKIGWACGP-------AELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEI-GFAVHDSYGTYFLCADPRPL---YDDSTEFCAALPEKVGVAAIPMSRFTFC-KRDDTLDEAIRRLSVLAE 394
59 -54.7002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  12  2.................LSKRLLNFESFEVMDILALAQESEGKKVIHLEIGEPDFNTPKPIVDEGIK------SLKEGKTHYTDSRGILELREKISELYKDKYKADIIPDNII----ITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCD--------FTVESLEEALS---DKTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEGKC--YSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISN-------DEIIEAILKLQQNLFISAPTISQYAALKAFEKEEREINSMIKEFDRRRRLVLKYVKDF-GWEVNNPIGAYYVFPNIGE------DGREFAYKLLKEKFVALTPGIRISYA-NSYENIKEGLERIKEFLN 369
60 -54.4004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  12  1............MAKQLQARRLDGIDYNPWVEFVKLASE---HDVVNLGQGFPDFPPPDFAV----EAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNV---LVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSL-SSSNWQLDPMELAGKFT---SRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHI-SIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSV-GLKPIIPQGSYFLITDISDFKRKMPYDRRFVKWMIKNKGLVAIPVSRFCFV-KDEATLQAMDEKLRKWKV 420
61 -54.0003jtx_A mol:protein length:396 aminotransferase  ali model follow..  12  1................GMNTLLKQLKPYPFARLHEAMQGPEGMEAVPLHIGEPKHPTPKVITDALTASL-------HELEKYPLTAGLPELRQACANWLKRRDGLTVDADNEI---LPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANC-PAPSFNPDWRSISEEVW---KRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQALGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHG-------SAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIP---ILQQVFDVKLPDASFYIWLKVPD-----GDDLAFARNLWQKAAIQVLPGRRIALV-ADVATCVKAAEDIVSLYR 396
62 -53.9002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  13  2.........MAESRPARRFARIDRLPPYVFNITAELKMARRGEDIIDLSMGNPDGPTPPH-----IVEKLCTVAQREDTHGYSTSRGIPRLRRAISHWYRDRYDVQIDPESEA---IVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLVPGIDFFNELERAIRESI---PKPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAP-SIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHD-------YGTFTPLQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREA-GWMVENPKASMYVWAKIPEPYAHLG-SLEFAKKLLQDAKVSVSPGIRFALI-ENRDRLRQAVRGIKAMFR 396
63 -53.7003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  13  2MNFPIDEKLIREKQNELHIKDLGMASIRDLVALVTNLEKATGTKFCRMEMGVPGLPAPQI-----GIETEIQKLREGVASIYPNLDGLPELKQEASRFAKLFVNIDIPARACVPTVGSMQGCFVSFLVANRTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLREKLESYLQT---GQFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDYEPLYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDLEESSSALYALSSGATHSAQWGMAAMLKACDSVIEYGRKARIMKKMFLDNGFNIVYDKDGNEPLADGFYFTVGYKGMD----SSKLIEKFVRYGMCAITLKTRICTSLLPESQFPDLEKRLQMLNA 435
64 -53.2001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  18  1...............MRLHPRTEAAKESIFPRMSGLAQR---LGAVNLGQGFPSNPPPPFLLEAVRRAL-------GRQDQYAPPAGLPALREALAEEF------AVEPESVV----VTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLLTPEGFRLDLSALEKALT---PRTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGERP----RRLREFAPERTFTVGSAGKRLEATGYRVGWIVGP-------KEFMPRLAGMRQWTSFSAPTPLQAGVAEALKRREGFYEALREGYRRRRDLLAGGLRAM-GLRVYVPEGTYFLMAE---------LPGWDAFRLVEEARVALIPASRFAFC-KTEEELHLALERLGRVVN 369
65 -52.5003ele_A mol:protein length:398 Amino Transferase  ali model follow..  14  1..............GMVVNESMYQLVRSAIRELFEYGKKRAKENVYDFSIGNPSIPAPQIVNDTIKELVTDY--DSVALHGYTSAQGDVETRAAIAEFLNNTHGTHFNADNLY----MTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPA-DTEHFQIDFDALEERIN---AHTRGVIINSPNNPSGTVYSEETIKKLSDLLEKRPIFIIADEPYREIVYDGIK----VPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGAGRALGYVCAPSLFQKMIVKCQGATG-----DINAYKENRDLLYEGLTRI-GYHCFKPDGAFYMFVKALED------DSNAFCEKAKEEDVLIVAADRISYC-VDREMIKHSMPAFEKIYK 394
66 -52.2004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  15  24.SLDFEMKKLGGSTKLVRNVNLEKLKNNYLFPEINRREKHPNVQLISLGTGDTTEPIPEQ-ITSHMSNFAHGLSTVEGYRGYGLEQGNKTLRKAIAETFYRDLHVKSNE-------VFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPCGPNN-LAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDGSP--RSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELLYSNGPIINDFHRIVTTSFNGASNIAQAGGLACLSGGLKEIRSVNNYYKENRKILMDTLVSL-GLKVYGGVNAPYLWVHFKGS------SWDVFNEILENTHIITVPGSRISGFG-RRDHIVEASKRLQNFFN 440
67 -51.8002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  14  3......................RVPEPSVFLVVDEAKRKERGVGLIDLSIGSTDLPPPEA-----PLKALAEALNDPTTYGYCLKSCTLPFLEEAARWYEGRYGVGLDPRREA---LALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL--REDGLADLKAVPEGVW---REAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEA--PSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVID-------FNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALK--GVLSLLPPRATMYLWGRLPEGVD----DLEFGLRLVER-GVALAPGRRIALV-RPLEELLEAAKRIREALD 376
68 -51.8006DK6 Entity 1(prereleased)  ali follow..  13  1.........MALINENFLKLKAGYLFPEIARRVKAFTEGEAAQRLIRCGIGDVTEALPEA-VRYAMHEAVDELGNRSTFKGYGPEQGYDFLRNAIADNDYKARGLPIEADEIFIS-----DGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYENGFVPDIPQ---EKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPH-SIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQWSRRHSTKFNGASYIVQKGAEALYTDGKSQTKALIEHYMGNAALLVEACKNA-GLSVFGGVNAPYVWVGCPAGLT----SWQMFDKMLNEANVVITPGSRISAFN-SRANVEEVCRRIAAL.. 410
69 -51.6003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  13  1MSSGVDLGTENLYFQSMRPSDMAKKTFNPIRAIVDNMKPNPNKTMISLSIGDPT---GNLPTDPEVTQAMKDALDSGKYNGYAPSIGFLSSREEIASYY-HCPEAPLEAKDVI----LTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLID---EKTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLAT--LSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQ-RILGPCTIVQGALKSILRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEFPEFENDVEFTERLVAEQSVHCLPATRVVIT-VPEVMMLEACSRIQEFCE 416
70 -51.1004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  13  1..MGSSSSGLVPRGSHMSSLRPRREDPPVLEEWYRRHLGPDIHDISSSGVHPYSFAEIRDVCRIPAA------DLDAVVMDDSVSQGGEGVRRAIADRYAGGDADRV---------LVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRAVRDGEIDPDVLAGLVT---PGTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEV----LADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTT-------LFLSPLVELVAERAVRHADELIGARAAEARHNLAHLTGWMAAHEEVRWTPPEGGVCALPVFRELERAAA-VERFCLELLERHRTLLVPGTRLGFGG-PQEDFRAGLDGLSRFLR 394
71 -50.9003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  14  4.................RPSDMSNKTFNPIRAIVDNMKPNPNKTVISLSIGDPT---GNLPTDPEVTQAMKDALDSGKYNGYAPSIGYLSSREEVASYY-HCPEAPLEAKDVI----LTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLLPEKSWEIDLKQLESLID---EKTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMAT--LSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLVKLSQ-RILGPCTIVQGALKSILRTPQEFYQDTLSFLKSNADLCYGALSAIPGLQPVRPSGAMYLMVGIEMEFPEFENDVEFTERLIAEQSVHCLPATRVVIT-VPEVMMLEACSRIQEFCE 399
72 -50.9004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  13  37...................SKHAQRTLQPLNNLTDNMKSRSTKSNLRLSIGDPTVD-GNLKTPDIVTEAMVDVVRSGKFNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEALKWENVITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDPSKSWECDLRAAAGMVD---SHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADF--DTNVPRLILGGTAKYQVCPGWRVGWSILI-DPMNVAGDWAVGMERLTQLIAGVNSICQEAIARTLLKCPTECTEHIVTQLEAGAKVYARLLEHDIGISMEAPQASMFVMLKLNLYFQDLKSDMEFYEKLLDEENVQVLPGERATVS-RPSAVLNEAVDRIIEFCE 434
73 -50.5003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  13  35IHAQRLQEQLKTQPGSLPFDEIQSLGQQPVTFFREVLALCDHPDLLQREEIKTLFSADS----ISRAKQILAMIPGRATGAYSHSQGIHGLRDAIASGIASRDGFPANADDIF----LTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESTGWGLETSDVKKQLEDARSNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDNKKFHSFKKIVEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVITGQILASLVMNPPKASDESYASYKAEKDGILASLARRAKALEHAFNKLEGITCNEAEGAMYVFPQICLPQKAIEADAFYALRLLESTGIVVVPGSRCTIL-PQEDKIPAVISRFTVFHE 482
74 -50.2003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  13  2......................MTFEPYPFERLRALLKETPKKRGLDLGIGEPQFETPKFIQDALKNHT-------HSLNIYPKSAFEESLRAAQRGFFKRRFKIELKENEL--ISTLGSREVLFNFPSFVLFDYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPSLN------EKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENTPPPSACMLAGNEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLG-------YTSANAIQKASEAAWLDDR-HAEFFRNIYANNLKLARKIFK-----NTLIYPYSFYVYLPVQN-------GENFAKTLYQNEGIITLPALRLALV-YDTPLLEKPLEIIETYRE 373
75 -49.8003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  15  1...............MKRNPHFVSLTKNYLFADLQKRVENPQHTVINLSIGDTTQPLNAS-VAEAFASSIARLSSPTTCRGYGPDFGLPALRQKLSEDFYRGF--------VDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKIIALPCLQENAFFPEFP--------EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPK-SIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELTYADGHVIQDWERFLSTTFNGASIPAQEAGVAGLSILPQLE--AIHYYRENSDLLRKALLAT-GFEVFGGEHAPYLWVKPTQANIS---DRDLFDFFLREYHIAITPGIRFSSLG-KREDILAACERLQMAPA 391

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 3 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Luz JG, Hassig CA, Pickle C, Godzik A., Meyer BJ, Wilson IA. XOL-1, primary determinant of sexual fate in C. elegans, is a GHMP kinase family member and a structural prototype for a class of developmental regulators. Genes Dev. 2003 Apr 15;17(8):977-90. Epub 2003 Apr 02.