current user: public

If you have questions about the server, please let us know.

Query: 4hrr_A mol:protein length:150 Globin-2 A chain, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst XVDAAVAKVCGSEAIKANLRRSWGVLSADIEATGLMLMSNLFTLRPDTKTYFTRLGDVQKGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDVAGAWAALVGVVQAALLast
1 -67.5004hrr_A mol:protein length:150 Globin-2 A chain  ali model  100  1XVDAAVAKVCGSEAIKANLRRSWGVLSADIEATGLMLMSNLFTLRPDTKTYFTRLGDVQKGKANSKLRGHAITLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDVAGAWAALVGVVQAAL 150
2 -66.2004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  65  3RVAELANAVVSNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKTSPSAKGKFARLGDVSAGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDTVAAWASLVAVVQAAL 152
3 -62.1003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  19  1.MSSSEVNKVFTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEIAPSAKNLFSYLKDSVPLEQNPKLKPHATTVFVMTCESAVQLRKAGKKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAWGVAYDQLVAAI 153
4 -61.8002r4x_A mol:protein length:146 Globin-1  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGVSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKMNGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
5 -61.8003uh6_A mol:protein length:146 Globin-1  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSIALMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
6 -61.7003uhd_A mol:protein length:146 Globin-1  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVAHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
7 -61.7003ugz_A mol:protein length:146 Globin-1  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
8 -61.7003uhb_A mol:protein length:146 Globin-1  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITKKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
9 -61.6003ugy_A mol:protein length:146 Globin-1  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNYIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
10 -61.6002auo_A mol:protein length:146 Globin I  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKYAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
11 -61.6003uhi_A mol:protein length:146 Globin-1  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVERFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
12 -61.5004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  13  2...ATLEAMQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMEENPETFQIFPWADASKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSEAWSEEKKEAWLKAYGIITVMV 152
13 -61.5001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGNVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
14 -61.5003uhc_A mol:protein length:146 Globin-1  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQAFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
15 -61.5002grf_A mol:protein length:146 Globin-1  ali model follow..  51  2..SVYDAAAQLTADVKKDLRDSWKVIGSDKKGNGVALVTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
16 -61.5002r4z_A mol:protein length:146 Globin-1  ali model follow..  52  2..SVYDAAAQLTADVKKDLRDSWKVWGSDKKGNGVALMTTLFADNQETIGYFKRLGDVSQGMANDKLRGHSITLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEFGKINGPIKKVLA---SKNFGDKYANAWAKLVAVVQAAL 146
17 -61.4003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  20  1.MSSSEVDKVFTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEIAPSAKNLFSYLKDSIPLEQNPKLKPHAMTVFVMTCESAVQLRKAGVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAWGEAYDQLVAAI 153
18 -61.3002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  20  1.......GSHMERPESELIRQSWRVVSRSPLEHGTVLFARLFALEPSLLPLFQYNGSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRTAWSRLYGAVVQAM 147
19 -60.9001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  17  3ATQSFQSVGDLTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHNDPTAQRKFPQMAGLAELRTSRQMHAHAIRVSALMTTYIDEMDT-EVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTKQVHDAWAKTFAIVQGVL 153
20 -60.9004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  20  1..........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAM 144
21 -60.8001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  20  1..........MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNGSPEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTPATRAAWSQLYGAVVQAM 144
22 -60.4001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  22  5..LAIQAQGDLTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFAYDPSAQNKFPQMAGMSQLRSSRQMQAHAIRVSSIMSEYVEELDS-DILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKTRDAWAKAFSVVQAVL 153
23 -60.0003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  21  2...ESEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEIAPTTKKMFSFLRDSIPAEQNPKLKPHAMSVFVMCCESAVQLRKTGKRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSPEMKVAWGQAYDHLVAAI 152
24 -59.8002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  20  1.MSAAEGAVVFSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEIAPSARQMFPFLRDSVPLETNPKLKTHAVSVFVMTCEAAAQLRKAGKITTTLKRLGGTHLKYGVADGHFEVTRFALLETIKEALADMWGPEMRNAWGEAYDQLVAAI 154
25 -59.5001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  17  2.........ALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTEVPQNNPELQAHAGKVFKLVYEAAIQLEVTGVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELAIVI 145
26 -59.0002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  22  3LAEADDGAVVFGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEIAPSAKQMFSFLRDSDPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLRYGVADGHFEVTGFALLETIKEALADMWSLEMKKAWAEAYSQLVAAI 157
27 -58.9001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  22  1........VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLAN-GVDPTNPKLTGHAEKLFALVRDSAGQLKASGTV-VADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAWEVAYDELAAAI 140
28 -58.7001umo_A mol:protein length:190 CYTOGLOBIN  ali model follow..  22  9EIERRERSEELSEAERKAVQAMWARLYANSEDVGVAILVRFFVNFPSAKQYFSQFKHMLEMERSPQLRKHASRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHV 162
29 -58.5001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  19  6..DNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVADMWSPAMKSAWSEAYDHLVAAI 158
30 -58.1001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  22  1........XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEKFPDSANFFADFKGKADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAA--PPAGADAAWTKLFGLIIDAL 142
31 -58.0001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  23  1.........SLSAAEADLAGKSWAPVFANKNANGDAFLVALFEKFPDSANFFADFKGKADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAA--PPAGADAAWTKLFGLIIDAL 141
32 -57.7002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  23  1.......XTTLTNPQKAAIRSSWSKFMDNGVSNGQGFYMDLFKAHPETLTPFKSLLTLAQLQDNPKMKAQSLVFCNGMSSFVDHLDDNDMLVVLIQKMAKLHNNRGIRASDLRTAYDILIHYMED--HNHMVGGAKDAWEVFVGFICKTL 144
33 -57.7003pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  20  1.......SSGLTGPQKAALKSSWSRFMNNAVTNGTNFYMDLFKAYPDTLTPFKSLVSFNQMTNHPTMKAQSLVFCNGMSSFVDNLDDHEVLVVLLQKMAKLHFNRGIRIKELRDGYGVLLRYLEDHCH--VEGSTKNAWEDFIAYICRVQ 144
34 -56.5001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  15  2..........LDQQTINIIKATVPVLKEHGVTITTTFYKNLFAKHPEVRPLFD--------MGRQESLEQPKALAMTVLAAAQNIENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATDDILDAWGKAYGVIADVF 133
35 -56.5001v5h_A mol:protein length:193 Cytoglobin  ali model follow..  22  12EIERRERSEELSEAERKAVQAMWARLYANCEDVGVAILVRFFVNFPSAKQYFSQFKHMEEMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHAKHKVEPVYFKILSGVILEVVAEEFASDFPPETQRAWAKLRGLIYSHV 165
36 -56.1003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  20  1........SECGPLQRLKVKRQWAEAGNGREEFGHFIWANVFKVAPSARDMFKRVR--GDNIYTPAFRAHATRVLGGLDMCVALLDDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDK--DAWQACLDVITSGI 141
37 -56.0001x3k_A mol:protein length:152 hemoglobin component V  ali model follow..  15  1......AFVGLSDSEEKLVRDAWAPIHGDLQGTANTVFYNYLKKYPSNQDKFETLKGHDEVKDTANFKLIAGRIFTIFDNCVKNVGNDKGFQKVIADMSGPHVARPITHGSYNDLRGVIYDSMH------LDSTHGAAWNKMMDNFFYVF 140
38 -55.9001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  15  1.........GLSAAQRQVIAATWKDIADNGAGVGKKCLIKFLSAHPQMAAVFGFSG-----ASDPGVAALGAKVLAQIGVAVSHLGDEGKMVAQMKAVGVRHKGYGIKAQYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGAL 141
39 -55.6001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  17  1.......DYVCGPLQRLKVKRQWAEAGNSREEFGHFIWSHVFQHSPAARDMFKRVR--GDNIHTPAFRAHATRVLGGLDMCIALLDDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQ--DAWKPCLNVITNGI 142
40 -55.6005oja_A mol:protein length:163 Myoglobin  ali model follow..  19  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPEILEKFDDLKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDI 143
41 -55.6003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  15  2..........IDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEEPTVSVLF-----------QNPISSQSRKLMQVLGILVQGIDNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAWTKVYGIAAQVM 130
42 -55.6001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  17  1.........GLSAAQRQVVASTWKDIADNGAGVGKECLSKFISAHPEMAAVFGFSG-----ASDPGVAELGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYGDISGAL 141
43 -55.6001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  15  1.........GLSAAQRQVVASTWKDIADNGAGVGKECFTKFLSAHHDMAAVFGFSG-----ASDPGVADLGAKVLAQIGVAVSHLGDEGKMVAEMKAVGVRHKGYGIKAEYFEPLGASLLSAMEHRIGGKMNAAAKDAWAAAYADISGAL 141
44 -55.4002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  13  1..........MNSEEVNDIKRTWEVVAAKMTEAGVEMLKRYFKKYPHNLNHFPWFKEIDDLPENARFKTHGTRILRQVDEGVKALSGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCVK--LNEKQVHAYHKFFDRAYDIA 143
45 -55.2005oj9_A mol:protein length:163 Myoglobin  ali model follow..  21  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDI 143
46 -55.2001obm_A mol:protein length:154 MYOGLOBIN  ali model follow..  20  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLAEMKASEDLKKQGVTFLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDI 143
47 -55.2001jeb_A mol:protein length:142 HEMOGLOBIN ZETA CHAIN  ali model follow..  21  1........XSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHF---DLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYI--LRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVL 137
48 -55.2005ojc_A mol:protein length:163 Myoglobin  ali model follow..  20  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDTLIRLFKSHPEILEKFDGLKHLAEMKASEDLKEHGVTLLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKHLEFFSEAIIHVLHSRHPGDFGADAQGAMNKALELFRTDI 143
49 -55.1005ycg_A mol:protein length:157 Ancestral myoglobin aMbWp of Pakicetus relative  ali model follow..  19  2......SHMGLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFTGHPETLEKFDKFKHLDEMKASEDLKKHGNTVLTALGGILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISDAIIHVLQSKHPGDFGADAQGAMNKALELFRNDI 146
50 -55.1003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  15  1..........MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDVEPKVRPLF-----------KIDIEKQGRKLMDVLNWIVLNLQDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLWTQAYEALAQVM 129
51 -55.0002w6x_A mol:protein length:154 MYOGLOBIN  ali model follow..  19  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLAEMKASEDLKKQGVRVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFFSEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDI 143
52 -55.0001h1x_A mol:protein length:154 MYOGLOBIN  ali model follow..  20  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVRVLTALGAILKKKGH---HEAELKPLAQDHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDI 143
53 -55.0002oha_A mol:protein length:154 Myoglobin  ali model follow..  21  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELWRKDI 143
54 -55.0001xq5_A mol:protein length:143 Hemoglobin alpha-1 chain  ali model follow..  18  1........XSLSSKDKDTVKALWGKIADKAEEIGSDALSRMLAVYPQTKTYFSHWKDLSP--GSAPVNKHGKTIMGGIVDAVASIDDLNAGLLALSELHAFT--LRVDPANFKILSHCILVLLAVKFPKDFTPEVHISYDKFFSALARAL 138
55 -55.000101m_A mol:protein length:154 MYOGLOBIN  ali model follow..  21  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRVKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDI 143
56 -55.0001cik_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  20  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKAPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDI 143
57 -55.0004lpi_A mol:protein length:154 Myoglobin  ali model follow..  20  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIHIRLFKSHPETLEKYDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDI 143
58 -55.0002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  20  2..........CTSLNRLLVKRQWAEAGTNRELLGNRIWEDLFANMPDARGLFSRVN--GNDIDSSEFQAHSLRVLGGLDMCVASLDDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDN--DAWNSCMNQIVSGI 140
59 -54.9001do1_A mol:protein length:154 MYOGLOBIN  ali model follow..  21  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIWIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDI 143
60 -54.9006bmg_A mol:protein length:154 Myoglobin  ali model follow..  21  1........MVLSEGEWQLVLHVWAKVEADIAGHGQDILIRLFKHHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPADFGADAQGAMSKALELFRKDI 143
61 -54.9004u8u_D mol:protein length:141 Globin d Chain  ali model follow..  18  2..........CSILELLKVKNQWREAGHHRVQFGLELWKRFFDTHPEVKGLFKGVN--GDNIYSPEFAAHAERVLSGLDMTIGLLDDTNAFKAQVTHLHSQHVERSINPEFYEHFLGALLHVLPKYLGTKLDQD---AWTKCFHTIADGI 139
62 -54.9001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  26  1.........SLEAAQKSNVTSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGD------EGAWTAVAGALMGEI 138
63 -54.8001lhs_A mol:protein length:153 MYOGLOBIN  ali model follow..  17  1.........GLSDDEWNHVLGIWAKVEPDLSAHGQEVIIRLFQLHPETQERFAKFKNLDALKSSEEVKKHGTTVLTALGRILKQKNNHEQE---LKPLAESHAKHKIPVKYLEFICEIIVKVIAEKHPSDFGADSQAAMKKALELFRNDM 142
64 -54.8001mcy_A mol:protein length:154 MYOGLOBIN (CARBONMONOXY)  ali model follow..  20  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIFIRLFKSHPETLEKFDRFKHLAEMKASEDLKKQGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDI 143
65 -54.8005jgg_A mol:protein length:142 Alpha chain  ali model follow..  17  1.........TLTSADKSHVKSIWSKASGKAEELGAEALGRMLEVFPNTKTYFSHYADLSV--TSGQVHTHGKKILDAITTAVNHIDDITGVLTALSTLH--AKTLRVDPANFKILSHTILVVLALYFPADFTPEVHLACDKFLASVSHTL 137
66 -54.8001mnh_A mol:protein length:153 MYOGLOBIN  ali model follow..  18  1.........GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDKFKHLDEMKASEDLKKVGNRVLTALGGILKKKGH---HEAELTPLAQSHAKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDM 142
67 -54.8001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  26  1.........SLSAAQKDNVTSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLSGFMKSYGGD------EGAWTAVAGALMGEI 138
68 -54.8001myh_A mol:protein length:153 MYOGLOBIN  ali model follow..  20  1.........GLSDGEWQLVLNVWGKVEADVAGHGQEVLIRLFKGHPETLEKFDRFKHLDEMKASEDLKKHGNTVLTALGGILKKKGH---HEAELTPLAQSHATHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMSKALELFRNDM 142
69 -54.8001co8_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  21  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYAEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDI 143
70 -54.8001dxc_A mol:protein length:154 MYOGLOBIN  ali model follow..  19  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIYIRLFKSHPETLEKFDRFKHLAEMKASEDLKKQGVRVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDI 143
71 -54.8001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  26  1.........SLSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGD------EGAWTAVAGALMGMI 138
72 -54.7005utb_A mol:protein length:154 Myoglobin  ali model follow..  20  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTALTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFYSEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDI 143
73 -54.7001ch5_A mol:protein length:154 PROTEIN (MYOGLOBIN)  ali model follow..  21  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKVKIPIKYLEFISEAIIHVLHSRHPGNFGADAQGAMNKALELFRKDI 143
74 -54.7001hbr_A mol:protein length:141 PROTEIN (HEMOGLOBIN D)  ali model follow..  22  2..........LTAEDKKLIQQAWEKAASHQEEFGAEALTRMFTTYPQTKTYFPHF---DLSPGSDQVRGHGKKVLGALGNAVKNVDNLSQAMAELSNLHAYN--LRVDPVNFKLLSQCIQVVLAVHMGKDYTPEVHAAFDKFLSAVSAVL 136
75 -54.7004pqb_A mol:protein length:154 Myoglobin  ali model follow..  20  1........MVLSEGEWQLVLHVWAKVEADVAGHGQDIEIRLFKSHPETLEKHDRFKHLAEMKASEDLKKHGVTVLTALGAILKKKGH---HEAELKPLAQSHAKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDI 143

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.