current user: public

If you have questions about the server, please let us know.

Query: 4huq_T mol:protein length:280 Energy-coupling factor transporter transmembrane protein EcfT, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MGSSSQDPMSNFIFGRYLPLDSVVHRLDPRAKLMLSFCYIIVVFLANNIWSYAILIAFTVGAILSSKISLGFFLKGIRPLLWLIVFTVVLQLLFSPAGGHTYFHWAFINVTQDGLINAGYIFVRFLLIIMMSTLLTLSTQPLDIATGLASLMKPLRWVKVPVDTLAMMLSIALRFVPTLMDEATKIMNAQRARGVDFGEGGLFKQAKSLIPLMVPLFMSAFNRAEDLSTAMEARGYQDSEHRSQYRILTWQRRDTVTWLLFLLGFVAILIFRHWLast
1 -101.0004huq_T mol:protein length:280 Energy-coupling factor transporter transmembrane protein EcfT  ali model  100  1MGSSSQDPMSNFIFGRYLPLDSVVHRLDPRAKLMLSFCYIIVVFLANNIWSYAILIAFTVGAILSSKISLGFFLKGIRPLLWLIVFTVVLQLLFSPAGGHTYFHWAFINVTQDGLINAGYIFVRFLLIIMMSTLLTLSTQPLDIATGLASLMKPLRWVKVPVDTLAMMLSIALRFVPTLMDEATKIMNAQRARGVDFGEGGLFKQAKSLIPLMVPLFMSAFNRAEDLSTAMEARGYQDSEHRSQYRILTWQRRDTVTWLLFLLGFVAILIFRHW 274
2 -93.0005d3m_D mol:protein length:265 Energy-coupling factor transporter transmembrane protein EcfT  ali model follow..  46  1........MSKIIIGRYLPGTTFVYRVDPRAKLLTTFYFIIMIFLANNWVSYLVISIFGLAYVFATGLKARVFWDGVKPMIWMIVFTSLLQTFFMA-GGKVYWHWWIFTLSSEGLINGLYVFIRFAMIILVSTVMTVTTKPLEIADAMEWMLTPLKLFKVNVGMISLVISIALRFVPTLFDQTVKIMNAQRSRGADFNDGGLVKRAKSVVPMLVPLFIDSLEVALDLSTAMESRGYKGSEGRTRYRILEWSKVDLIPVAYCLLLTILMITTRKH 265
3 -60.1005x41_Q mol:protein length:256 Uncharacterized protein CbiQ  ali model follow..  21  1MGSS--GSMSIASIDRVAAQGHWRSRPLAEKSLIGLGFLALAVTVPPFPGAVLVTVAILAFTFLGARVPLRFWASVAVLPLGFLTTGAAVLLIQ--------IGPEGIGLAPDGPAKAAALVMRATAATCCLLFLATTTPAADLLSGLRRWRVP--------AELIEIALLTYRFVFILAEEAAAMTTAQRARLGH---ATRRRWLRSTAQVIAALLPRALTRARRLETGLGARNWQGEMRVLSTRPPASARVLGLILTLQAAILAAGVLL... 250
4 -7.9705oql_B mol:protein length:907 Utp2  ali model follow..  11  590......DLVILTAIGTTFPTSDHFHQVTPAMLAIARYLGQKVPAALSDFAVGIYLSILALQYQDFAKRYVPEMMNFLLNTLCALAPERAKSKLGNFPVHEPPAGIRIKDLRKDELSPAETSSLQIAILSTATAILKSAADTWHKLPAFIESFQPALSVAQHLLTKPNASHLPSSLTSKLNDLASHLSRLLQLSRLSRRPLELHHHRPLAIKTYIPKFEDDFKHYDPNRERAELAKLKAEHKRERKGALRELRKDAQFIR............... 860
5 -6.4405wx9_A mol:protein length:131 Ethylene-responsive transcription factor ERF096  ali model follow..  13  1.................................................................................................................................................................................MDQGGRGVGAEHGKYRGVRRRPGKYAAEIRDSRKHGERVWLGTFDTAEEAARAYDQAAYSMRGQAAILN............................ 70
6 -6.1002gcc_A mol:protein length:70 ATERF1  ali model follow..  16  1..........................................................................................................................................................................................AKGKHYRGVRQRPGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRMRGSRALLN............................ 61
7 -5.8505mke_A mol:protein length:968 Polycystin-2  ali model follow..  10  400..EETAAQVASLKKNVWLDRGT-FSVYNANINLFCVVRLLVFFLAACEIIFCFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGI-EDQNTFPNFEHLAYWQIQFNNIAAVTV-FFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGFAI----MFFIIFLAYAQLAYLVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIYFTTFVFF-NMFLAIINDTYSEVKSDLAQQKAEMELSDLIR................. 705
8 -5.7706du8_A mol:protein length:805 Polycystic kidney disease 2-like 1 protein  ali model follow..  12  279..QGSAEALRALQEGLWLDRGT-FSVYNANINLFCVLRLVVFFIVGCEVIFCVFIFYYVVEEILELHIHRLRYLSSIWNILDLVVILLSIVAVGFLQQPNTYADFEFLAFWQTQYNNMNAVNL-FFAWIKIFKYISFNKTMTQLSSTLARCAKDILGFAV----MFFIVFFAYAQLGYLLENFSTFIKCIFTQFRIILGDFDYNAIDNANRILGPAYFVTYVFF-NMFLAIINDTYSEVKEELAGQKDELQLSDLL.................. 584
9 -5.6904chu_A mol:protein length:163 HTH-TYPE TRANSCRIPTIONAL REGULATOR ISCR  ali model follow..  17  1.....................................................................................................................................MGRLTSKGRYAVTAMLDVALNSEAGPVPLADISERQGISLSYLEQLFSRLRKNGLVSSVRG----PGGGYLLGKDASSIAVGEVISAVDESVDATRSQG.......................................... 95
10 -5.6104r3q_A mol:protein length:88 Synaptonemal complex central element protein 3  ali model follow..  19  14........................................................................................................................................MLKMLSDLNKDLEKLLEEMEKISVQATWMAYDM-VVMRTNPTLAESMRRLEDA..................................................................................... 65

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 8 0 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sasin JM, Godzik A, Bujnicki JM. SURF'S UP! - protein classification by surface comparisons. J Biosci. 2007 Jan;32(1):97-100.