current user: public

If you have questions about the server, please let us know.

Query: 4iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390
# Score Template Links and tools%idFirst MSSGVDLGTENLYFQSNAMLNLQDKYTQYQRDNLLRELTPFIKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYDGKSFITTEGVFSTSGSITQLDKLAKITPEKLIVDEAHSFGVLGKNGRGAINSFRISYKNCLICVFPLGKAFGGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELVSKDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEYIRSNLast
1 -116.0004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model  100  1MSSGVDLGTENLYFQSNAMLNLQDKYTQYQRDNLLRELTPFIKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYDGKSFITTEGVFSTSGSITQLDKLAKITPEKLIVDEAHSFGVLGKNGRGAINSFRISYKNCLICVFPLGKAFGGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELVSKDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEYIRSN 393
2 -103.0003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  26  20.............AGLSPLAWLADIEQRRRAEGLRRELRVRPPVAAELDLASNDYLGLSQHPDVLDGGVEALRTWGGGAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDACRLSRARVVVSPHRDVDAVDAALAARAVVVTESVFSADGDLAPLRDLHAVCRRHLLVDEAHGLGVRGTRGQGLLHEVGLAGAPDIVMTTTLSKALGSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALRVLDAEPQRARAVLDRAAELATIAGVTE-----APVSAVVSVILGDPEIAVGAAAACLDRGVRVGCFRPPTVPAGTSRLRLAARASLTDDEMALARQVLTDVLATAR.... 397
3 -103.0003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  26  10....................SQFKIVEELKAKGLYAYFRVKIDGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRAKLICTDGIFSMEGDIVNLPELTSIANEFVMVDDAHSLGVIGHKGAGTASHFGLN-DDVDLIMGTFSKSLASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLGATE-SPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAEVE.. 395
4 -103.0001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  31  2................SWQEKINAALDARRAADALRRRYLVADDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASQQMVVTEGVFSMDGDSAPLAEIQQVTQQHLMVDDAHGTGVIGEQGRGSCWLQKV---KPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEARREKLAALITRFRAGVQDLPFTLADSC-SAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGN......... 383
5 -101.0002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  25  5................SKFDPLIAEREALLATGVRDPYEAMINGRKTILLGTYNYMGMTFDPDVIAAGKQALDEFGSGTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRGKLVVLEGVYSMMGDIAPLQEMVAVSKKHILVDEAHGMGFFGEHGRGVFEEAGVE-ADVDFVVGTFSKSVGTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHAGDKRAHLWKNSRRLHQGLRDMGYKLGETAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATGVIPK 400
6 -100.0001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  29  4.............MRGEFYQQLTNDLETARAEGLFKEERIIADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKRHVLIATDGVFSMDGVIANLKGVCDLADKYVMVDDSHAVGFVGENGRGSHEYCDVM-GRVDIITGTLGKALGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAGAD-HAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVIA. 401
7 -100.0005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  30  1.............MAMHLLDTLAEGLKEIDARGLRRRRRMTVDGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDTDALSAMLEAVKVIVSDTVFSMDGDIAPLPRLLELAEQHLIVDDAHGFGVLGPQGRGAIAQAALR-SPNLISIGTLDKAAGVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEARRAHLQQLIGRTRAMLKATPWLPVDSH-TAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA.... 396
8 -99.1005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  32  2................NLLDTLQRGLADLDAQGLRRVRRMTVNGREIVGFASNDYLGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHADTATLGALLEATKLIVTDTVFSMDGDIAPLAELLALAERHLVVDDAHGFGVLGPQGRGALAAAALR-SPHLVYVGTLGXAAGVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEARRAHLAALIERTRALLRRTRWQPVDSH-TAVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA..... 393
9 -97.9003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  27  5...............QEILSQLNKEIEGLKKAGLYKSERIKVGEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKRFKLIATDGVFSMDGIIADLKSICDLADKYVMVDDSHAVGFIGENGRGTPEYCGVA-DRVDILTGTLGKALGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEPQLRKQLQENSRYFRAGMEKLGFQLVPGN-HPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGAI.. 399
10 -97.5002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  25  25................SKFDGLIAERQKLLDSGVTDPFEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRAKLVVLEGVYSMLGDIAPLKEMVAVAKKHVLVDEAHSMGFFGPNGRGVYEAQGLE-GQIDFVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIG. 419
11 -96.0004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  25  41................SKFDGLIAERQKLLDSGVTDPFEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRAKLVVLEGVYSMLGDIAPLKEMVAVAKKHVLVDEAHSMGFFGPNGRGVYEAQGLE-GQIDFVVGTFSASVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGETCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIG. 435
12 -93.4002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  22  2................DYNLALDKAIQKLHDEGRYRTFIDIGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAAPKLIAFESVYSMDGDFGPIKEICDIAEEFTYIDEVHAVGMYGPRGAGVAERDGLM-HRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQRDAQQMHAKVLKMRLKALGMPIIDHG-SHIVPVVIGDPVHTKAVSDMLLDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA.... 401
13 -93.3002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  21  33......................................LGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRPGIIVVDSIYSTLGTIAPLAELVNISKEFLLVDESHSLGTHGPNGAGLLAELGLT-REVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTI--RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF... 386
14 -93.2005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  25  15................DYEGLIDSELQKKRLDKSYRYFNNIREADKVTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSPKLIAFESVYSMAGSVADIEKICDLADKYTFLDEVHAVGLYGPHGAGVAEHCDFESDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNP-SHIVPVLIGNADLAKQASDILIKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQLP.. 433
15 -91.2003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  21  47......................................LGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRPGIIVVDSIYSTLGTIAPLAELVNISKEFLLVDESHSLGTHGPNGAGLLAELGLT-REVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTI--RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF... 400
16 -26.8002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  12  1..............................................MFKRETKDFINIQTGGKLTEEARQALLEWGDGYSVCDFCT-TPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTTPENFAQTIEETVLALITYPDGNYGNLPDVKKIAKVCSEYLLVNGAYAIGRMPVSLKEI---------GADFIVGSGHKSMAASGGVMGMKEEWAEIVLRRSEKYLLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHNLYEISKKAKGGRFFLYRELKSRKIHG------IKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIEKYS.... 371
17 -20.8003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  13  1..............................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPTKLLSLENVLPRE-YLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKE-----TQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALK---NNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRV--GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSREQLAEVAAHWRAFLAR...... 333
18 -20.8004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  13  1..............................................MIDLRSDTVTR---SRAMLEAMMAA--------PVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPTKLLSLEN--THNGKVLPREYLKEAWE-ALHVDGARIFNAVVAYGCELKE-----TQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALK---NNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRV--GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR...... 333
19 -20.7002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  14  3..........................................SDKIMIDLRSDTVTK---TEEMRKAMAQA--------EVGDDVYGEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVAVLSGVMPHPVPGKNPDDVRKAIRPSLIAIENTHNRSGGRVVPLENIKEICT-NVHIDGARIFNASIASGVPVKE-----AGYADSVMFCLSKGLCAVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALT---KMVDRLKEDHENARFLALKLKEIGVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLA-------NAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS.... 349
20 -19.9005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  10  27.......................EVITLDINLDKYKNLTRSLTREFIN------LNPIQRGGILPKEAKKAVYEYWDGYSVCRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYENLEGYKEVIDNVGLILLTHVDGEYGNLNDAKKVGKIAKEKFLLNCAYTVGRM----------VNGKEVKADFIVASGHKSMASAPGILAFSEEFSDKITKTSEKFMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFYDELKKRGIAGVTKEIKMSVYGL-EWEQVEYVVNAIKEIVESCK.... 411
21 -19.5003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  13  1......MAMGTLEAQTQGPGSMSAPLAEVDPDIAELLAKELGRQRDTLEMIASE--NFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEVVENLARDRAKALFGAEFANV--SGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYE--DMDAVRATALEFRIIAGWSAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLV------AAGLHPSPVPHADVVSTTVHKTLGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEADRQRRTLSGARIIADRLMAPDVAKAGTDVHLVLVDLRDSPLDGQAAEDLLHEVGITVNRNAVPNDPRPTSGLRIGTPAL-GDTEFTEVADIIATALAT...... 407
22 -19.3003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  13  2..........................................SHMRYIDLRSDTVTQ---TDAMRQCMLHA--------EVGDDVYGEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAAVLGSVALQPVPMQADGSLALADVRTRLVCLEN--THNGKVLPLPYLREMRE-QLHLDGARLFNAVVASGHTVRE-----VAPFDSVSICLSKGLGAVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQ---QHVVRLADDHRRARQLAEGLAALPGIRLDLAQVQTNMVFL-TSGESAPLLAFMKARGILF---------SGYGELRLVTHLQIHDDDIEEVIDAFTEYLGA...... 341
23 -19.2001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  15  22...................................................QHAKIELIASENFVSRAVMEANKYAEGYPGRRYYGGCEIVEELARERAKQLFGAEHANV--SGAQANMAVYFTVLEHGDTVLGMNLSHLTHGSPVNFSGVQYNFVAYGDYDDVREKARLHRIVAAASAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLV------AAGLHPNPVPYAHFVTTTTHKTLGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDKAYAKRVVDNAKRLASALQNEGFTLVGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESTSGIRIGTAAV-GLEEMDEIAAIIGLVLKN...... 386
24 -19.0001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  10  11..........................................AKPKPYSFVNDYSVG---HPKILDLMARD-------NMTQHAGYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHEAIEATGHKVVTAPCPDVADIESALHENKLVYISTQYTKQ-ELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLA----ARLTDMFYIGATKAGGMGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMK------ELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPIL-ENTMIAELNNDFDMYTVEP-------LKDGTCIMRLCTSWATEEKECHRFVEVLKRLVASTA.... 359
25 -18.9003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  11  8..........................QNIASMKGYIPGYQPPDIASWIKLNTNE---YPPSPEVVKAILEELGP-----DGAALRIYPSASSQKLREVAGELYGFDSWIIMANGSDEVLNNLRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTG--AGFPERYEGKVFFLTTPNAPLGPSFPLEYIDELARRCLVLDETY-AEFAESNALELVRRHE-------VVTRTLSKSYSLAGGLAIARPEVIAALDKIRDHY----NLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYL--FATPPDRDGKRVYDGLYARKVLVRHFSDPLLAH----MRISIG---TREEMEQTLAALKEIGE....... 353
26 -18.7003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  12  16............................................DNPIRINFNE---LGMSPKAQAAARDAVVKANRYAKNEI---------LMLGNKLAAHHQVEPSILLTAGSSEGIRAAEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKAFDIEGLKAAVAAYSIVYLVNPNNPTGTITPADVIEPWIAS-FIVDEAYAEFVNDPRFRSISPMITQGAENI-ILLKTFSKIHAMAGGYAVAHPTVIALMGRYVAGE----KINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGN----VFHQLVVPLKDYQTHMADAGVLIGRAFPPA----DNWCRISLG---TPQEMQWVADTMREFRKKSWI... 354
27 -18.6004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  14  2...............ASMFDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASE--NYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEVVEQLAIDRVKQLFGAEAANV--SGSQANQGVFFAMLKPGDTIMGAHGGHLTHGSPVNMSGKWFNVVSYGDYDAAEKLANEHKIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLI------AAGVYPNPVPHADFVTTTTHKSLGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEKEYQQKVVENARVLAETLVKRGLRIVSTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKTSGIRLGSPAM-GPAEAEQVGNLIADVLEN...... 393
28 -18.6003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  10  9.......................NNLSNYEPGKDIEVIAKEYGVKEVIKLASNE---FGTPPKAIECLRQNANKAHLYPDDSM---------IELKSTLAQKYKVQENIIIGAGSDQVIEFAHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSIEFKKLYETHDEIKLIFLCLPNNPLGECLDASEATEFIKGVVVIDAAYNEFASFKDSKKHLEPCELIKEFDNVLY-TFSKLYGLGGGYGIANANIISAFYKLRAPF----NVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFI--TYFFDEKNSTDLSEKLLKKGIIIRNLK----SYGLNAIRITIG---TSYENEKFFTEFDKILR....... 365
29 -18.5003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  14  25...................................................QNSNIELIASENFVSEAVMEANKYAEGYPGRRYYGGCEVTESIAIDRAKALFGAEHVNV--SGPQANMAVYLVALEMGDTVLGMNLSHLTHGAPVNFSGKFYNFVEYGNYDEVRKLALEHKIVAGASAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLV------AAGLHPNPVEYADFVTTTTHKTLGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNKTYQQQVVKNAKVLAEALINEGFRIVSGGTLVAVDVKGSIGLTGKEAEETLDSVGITCNKNTIPFDQEKTSGIRLGTPAA-DEKAFEEVAKIISLALKN...... 390
30 -18.4001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  15  19......................................................YFNFGGQGILPTVALEAITAMENGPFSIAANQHIQQLIAQLRQALAETFNVDPTITDNVTTGCDIVLWGLDWHQGDEILLTDCEHPGIIFGITYRFFPVAATLNQAAAVLANHLGPKRLVILSHLLWNTGQVLPLAEIMAVCRRHVLVDGAQSAGSL---------PLDFSRLEVDYYAFTGHKWFGPAGGGLYIHGDCLGEIAEGGKRFEVATSAYPQYAGAALQLHQRQGTAEERYQAICQRSEFLWRGLNQLPCLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYLRTIADPDC------IRACCHYITDEEEINHLLARLADF......... 388
31 -18.3004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  14  21...................................................MRESIKLIASENITSLAVREAHRYAEGLPGKRLYQGCKEVETLCIELSKELFKAEHANV--SGVVANLAVFFAETKPGDKLMALSVPHISHWKVSAAGIRGLKVINHPDADAMVKKILEEKILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLI---AGKQFQD----REGAEYLMGSTHKTFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHKDFTESHQVDIEFSASELAKMYEEANIILNKNLLPNNSDNPSGIRLGTQEC-KEKEMEEIAEFMKRIAID...... 392
32 -18.1003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  12  14.......................................................GQISGHGKRNVGVLKTAFAAVADEMASDQY-GTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQKELHPIETILVGAADLDEIKALPDIACLLLELPQREIGGVAPAFSELETISR-RLHLDGARLFEMLPYYEKTAAE-----AGLFDSIYISFYKGLGGAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDGQAADISPLEQVQEETGLGFVG------YLVDKDGYCSTEISVGDAYGELDQQTRDAGFARL..... 352
33 -18.1001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  14  26...................................................QEEHIELIASENYTSPRVMQANKYAEGYPGKRYYGGCEIVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLEPGDTVLGMNLAHLTHGSPVNFSGKLYNIVPYGDYADLEKQAKEHKIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLV------AAGVYPNPVPHAHVVTTTTHKTLGPRGGLILAKGGSEELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMKTYQQQVAKNAKAMVEVFLERGYKVVSGGTHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRVGTPAI-KEAEAKELAGWMCDVLDS...... 392
34 -18.1006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  11  48..........................................SGAYLTDPDGRRWIDFDGDEEVAEAIARAARG------RSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVDARDRSIVLSSGYHGYHCDEPFTPNQHGIVEFLFDLDVLAEWLSRPAAVVISPDHMHLGEYTEFTRLTKEADVPVIADEV----------VGLRYRAGLSTPLLDPAVWIVAKCLAN-GAAVGGDAHLLAALEDVSFTSYFE----PTAMAAATTTLRRMATGQAIRAAGDRFIAHTRAAFANAGVPIDLAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFE-------------NQTPSAAFTDEVVEDACGRIDRVSAAL..... 388
35 -18.0003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  11  16............................................AQAVCLAFNE---EAVEPRVQAAIAAAAARINRYPFDAE---------PRVMRKLAEHFSCPDNLMLVRGIDECFDRISAEFSSMRFVTAWGYRARIAVSGLRHFEIGLTDDLLLDPNDLAQV-SRDDCVVLANPSNPTGQALSAGELDQLRQR-LLIDETY-VDYSSFRARGLAYGENE------LVFRSFSKSYGLAGGALFGPSELIAAMKRKQWFC----NVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEAN----FVLVENAAGERTLRFLRERGIQVKDAGQFGLHH----IRISIG---REEDNDRLLAALAEYSDH...... 336
36 -18.0004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  13  32...................................................QQNNIELIASENVVSKAVMAANKYAEGYPGKRYYGGTAVVETLAIERAKKLFGAKFANV--SGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYN--DYDAILAQAKEVRIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLV------ASGHHPSPVPYAHVTTTTTHKTLGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPKEYGENVIKNAAAMADVFNQHPDFRVISGGTNNHLFLVKVVENGKVAQNVLEEVNITLNKNSIPYEQLSTSGIRVGSPAI-GEAESRQIAEWMVEALEN...... 398
37 -18.0003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  15  1...............SNAMLKREMNIADYDAELWQAMEQEKVRQEEHIELIASE--NYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEVVEQLAIDRAKELFGADYANV--SGSQANFAVYTALLQPGDTVLGMNLAHLTHGSPVNFSGKLYNIVPYGDYDEMAKLAKEHKIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLI------AAGVYPNPVPHAHVVTTTTHKTLGPRGGLILAKGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEKVYQQQVAKNAKAMVEVFLNRGYKVVSGENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSTSGIRIGSPAV-KEAEVKELAGWMCDVLDN...... 395
38 -17.9004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  12  1..................MNIFNNNLHETDKEINEIIKHEKLRQSSVIELIASE--NFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEKAENLAIERVKKLFNCKYANV--SGSQANQAVYLALLQPGDTVLGMSLDHLTHGAAPNMSGKWFNAVSYSDYDEIERLADLHKLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLV------ATGEHQSPIPYAHAVTSTTHKTLGPRGGLILSNDEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEKSYIQQVISNAKALASSLQERGYDILTTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSTSGIRLGTPAC-KEKDFVLVGHMVADILDG...... 391
39 -17.9005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  14  3.....................MAYFLEQTDSEIFELIFEEYKRQNEHLEMIASE--NYTFPSVMEAMGSILTNKYAEGYPNKRYYGGCEKIESLAIERAKKLFNCQFANV--SGSQANNAVYHALLKPYDKILGSCGGHLTHGAKVSLTGKHYQSFSYGDYEEALKIAQSVKIVCGFSAYPREIDFKKFREIADEVGALLLGDIAHVAGLV------VTNEHAHPFPHCHVVSSTTHKTLGPRGGIILTNEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEKAYAKLVKSNMQVLAKALKEKNHKLVGTSNHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSTSGIRIGSAAL-GAKEFEIIGNKISDILND...... 389
40 -17.8001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  10  25............................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKAYICLAVTVNLAGSMANMRAVRELTAAHVFYDATRCVENAGFENKSIAEIVHEMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLT-QDEFPAQSLAASIYVETGVRPKLETVRLTIPRRYTYAHMDVVADGIIKLYQHKEDIRG 436
41 -17.8004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  10  23............................................PGAIKLASNE---FGPLPSVRAAIDRATDTVNRYPDNGC---------VQLKAALARHLGPDEHVAVGCGSVSLCQQLQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVIAIDEAYVEYIRDGMRPDSLG---VRAHNNVVVLRTFSKAYGLAGGYAIGHPDVITALDKVYVPF----TVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQAN----VWLPLGSRTQDFVEQAADARIVVRPYGT-------DGVRVTVA---APEENDAFLRFARRWRSD...... 353
42 -17.7002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  11  13.TPQEKIEYKTKVSRNSNMSKLQAGYLFPEIARRRSAHLLKYPDAQVISLGIGD--TEPIPEVITSAMAKKAHELSTIEGYSGY-QGAKPLRAAIAKTFYGGLGIGDDVFVSDGAKCDISRLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATLTQLVEFAKKNIVYDSAYAMYMSDDNPRSIFEIPGA--EEVAMETASFSKYAGFTGGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPEGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFPNQSSWDVFAEILEKTHVVTTP------PGGEGFVRVSAFG--HRENILEACRRFKQLYK....... 426
43 -17.7003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  11  38....................QRNENFGKLRAGYLFKAHQEKNPDAKIISLGIGD--TEPLPKYIADAMAKAAAGLATREGYSGYEQGQGALREAVASTFYGHAGRADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGDNHFFPDLSKAKRTDIIFFCSPNNPTGAAATLTELVNFARKNLVYDAAYALYISNPDCPKTIYEIP-GADEVAIETCSFSKYAGFTGGWTVVPKALKYANGEPVHADWCFNGASNIVQAGGLACLQ-LKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGKPSWDVFAEILERCNIVTTP------PAGEGFVRASAFG--SRENILEAVRRFKEAYGKRN.... 441
44 -17.6004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  15.......................QSLPASVPFVGPEALERQHGRKIAARIGANE---FGPAPSVLLAIRQAAGDTWKYADPE---------NHDLKQALARHLGTSANIAIGEGIDGLLGQIRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPREDLEGLLAAVENAPLVYLANPDNPMGSWWPAERVVAFAQALLVLDEAYCETAPRDALPPIE----LIDKPNVIRARTFSKAYGLAGGYTLSTPGTAQAFDKIRNHF----GMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVVDCGKDASYARAIVDRLMSDHGIFIRMPGVAPLNR----IRISTA---PDAEMDLLAAALPEVIRSLA.... 374
45 -17.6006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  11  29..........................................SGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLVREATGRPLLLSAGYHGYYPSEAPLENADGVVDFFFDLGLLRELLRAPAAVVVSPDHM-PGWYRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPD-----VWVVAKGMAN-GSAVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVATGRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL..... 371
46 -17.6001v72_A mol:protein length:356 Aldolase  ali model follow..  12  5..........................................SRPPALGFSSDNIAG---SPEVAQALVKH-------SSGQAGPYGTDELTAQVKRKFCEIFERDVEVFLPTGTAANALCLSAMTPPWGNIYCHPASHINNDECEFFSNGAKLMTVDGDIVRLRERTREKCVSITQAIYTLD-EIEAIGDVCKSSSLGLHMDGSRFANALVSLGCSPAEM----KAGVDALSFGATKNGVLAEAIVLFNTSLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTD-DLWLRNARKANAAAQRLAQGLEGLGVEVLGGTEANILFCRLDSA-----MIDALLKAGFGFY-----HDRWGPNVVRFVTSFATTAEDVDHLLNQVRLAADRTQ.... 354
47 -17.5002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  14  22...................................................QREGLELIASENFVSKQVREANKYAEGYPGARYYGGCERVESLAIERAKALFGAAWANV--SGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYK--DLEEVRRLALEHRIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVA------AGLHPNPLPYAHVVTSTTHKTLGPRGGLILSDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEKEYSRLVVENAKRLAEELARRGYRIVTGDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPTSGIRIGTPAI-TPEEMPLVAELIDRALLE...... 387
48 -17.5003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  16  3...............SNANPFFSQSLAERDASVRGAILKELERQQSQVELIASE--NIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEEVEALAIERVKRLFNAGHANV--SGAQANGAVMLALAKPGDTVLGMSLDHLTHGAKPALSGKWFNALQYGDYDQVEALAQQHKIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIA------AGRHANPVEHAHVVTSTTHKTLGPRGGFVLTNEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDKTYIDRVLANAQALGDVLKAGGVDLVTTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKTSGIRLGTPAG-GAAEFREVGRLILEVFEA...... 396
49 -17.4006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  11  3SSSSENLYFQGGGHMTKNSSLLAEFPTCPRDEKDRPRVFTAASGAWLTDESGFRWIDFDGDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLVREATGRPLLLSAGYHGYYPSEAPLENADGVVDFFFDLGLLRELLRAPAAVVVSPDHM-PGWYRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPD-----VWVVAKGMAN-GSAVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVATGRAVREAGDRFLRHARKALDDASLPVEIAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERL..... 387
50 -17.4002f8j_A mol:protein length:347 Histidinol-phosphate aminotransferase  ali model follow..  11  25....................................................RDKTYLALNENPFPFPEDLVDEVFRRLNSDALRIYYDSPDEELIEKILSYLDTDFLVSVGNG---ADEIIYVMMLMFDRSVFFPPTYSCYRIFAKAVGAKFLEVPTKDLRIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERILKTFVALDEAY-YEFHGESYVDFLKKYE-------AVIRTFSKAFSLAAGYVVASEKFIDAYNRVRLPF----NVSYVSQMFAKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFV--FVFMEKEEKERLLEHLRTKNVAVRSF--------REGVRITIGKREENDMILRELEVFK........... 341
51 -17.4002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  10  1......MGSSSSGLVPRGSHMISNKLANIPDSYFGKGRKIEHGPLPLINMAVGI--DGPTPQGIIDHFQKALTIPENQKYGA--FHGKEAFKQAIVDFYQRQYNVTEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEDWSKVDSQIDKTKLIYLTYPNNPTGSTATFDEAIAKFKGTIVHDFAYGAFGFDAKNPSILASENG--KDVAIEIYSLSKGYNMSGGFAVGNKDMIQALKK-YQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPPGYDSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLAL--DDQKLDEAAIRLTELAYLYE.... 398
52 -17.3005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  11  3............................................DKSQQFASDNYSG---CPEAWAAMEKA-------NHGHDRAYGDDQWTERASEYFRNLFETDCEVFFFNGTAANSLALASLCQSYHSVICSETAHVETDECEFFSNGSKLLTAASTPQSIREVALKKPRVVTITQATEVGTVYRPDELKAISA-NLHMDGARFTNACAFLGCSPAEL----KAGVDVLCFGGTKNGMAGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLE------RHGNHANHCAQLLALLVSDLGVELMFPVEANGVFLQMPEH-----AIEALRAKGWRFYT-------IGSGGARFMCSWDTEEERVRELAADIRSIIT....... 345
53 -17.3003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  13  3......................AMSLEMFDKEIFDLTNKELERQCEGLEMIASE--NFTLPEVMEVMGSILTNKYAEGYPGKRYYGGCEEIETLAIERCKKLFNCKFANV--SGSQANQGVYAALINPGDKILGMDLSHGGHLTHGAKVSSSGKMYES-DYEKVREIAKKEKIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVV------AGEHPSPFPYAHVVSSTTHKTLGPRGGIIMTNEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEKVYAKQVRTNAQVLANVLMDRKFKLVSDGTHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSTSGLRLGTPAL-KEKEMEIVSNYIADILDD...... 388
54 -17.1005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  13  5.....................ANISISEFDPELAQAIASEDERQEAHIELIASE--NYCSPAVMEAQGSKLTNKYAEGYPGKRYYGGCEVIEQMAIDRAKELFGADYANV--AGSQANSAVYLALLNPGDTVLGMSLAHLTHGAKVSFSGKTYNAVQYGDYEEVERLALEHKIVAGFSAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLV------AAGVYPNPVQIADVTTTTTHKTLGPRSGLILAKANIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDKAYQQQVVKNAQAMAEVFIARGYDVVSGGTHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSTSGIRIGTPAV-GEAEVRELAGWIADVIDS...... 393
55 -17.1003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  11  27............................................NVDIRLNTNE---YPPSEALVADLVATVDK-----IATELNRYPERDAVELRDELAAYITKQTGLWAANGSNEILQQLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGDMDVALEEIRQPDIVFVTTPNNPTGDVTSLDDVERIINVAVIVDEAYAEFSPSPSATTLLEKY----PTKLVVSRTMSKAFDFAGGYFVANPAFIDAVMLVRLPY----HLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESN----VFFGDFSDQHAAWQAFLDRGVLIRDVGIAG-------LRTTIG---VPEENDAFLDAAAEIIKL...... 364
56 -16.9004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  11  32............................................AVPVRLNTNE---HPPTRALVDDVVRSVRE-----AAIDLHRYPDRDAVALRADLAGYLTAQTGIWAANGSNEILQQLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRADVDVAVAAVRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAAIVDEAYGEFSSQPSAVSLVEEY----PSKLVVTRTMSKAFAFAGGYLIATPAVIDAMLLVRLPY----HLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDAN----VLFGEFADAPAAWRRYLEAGILIRDVGIPG-------LRATTG---LAEENDAFLRASARIATDL..... 370
57 -16.8001eji_A mol:protein length:478 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  12  1......MADRDATLWASHEKMLSQPLKDSDAEVYSIIKKESNRQRVGLELIASE--NFASRAVLEALGSSLNNKYSEGYPGQRYYGGTEELEMLCQKRALQAYHLDPQCWGVSGSPANFAVYTALVEPHGRIMGLDLPHLTHGFMTDKKKISATSIFFENYDQLEENASLFHIIAGTSCYSRNLDYARLRKIADDNGAYLMADMAHISGLVAAG------VVPSPFEHCHVVTTTTHKTLGCRAGMIFYRKELESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEKIYQLQVLANCRALSDALTELGYKIVGSDNHLILMDLRSKGTDGGRAEKVLEACSIACNKNTCPGDKSRPSGLRLGTPALTSEEDFQKVAHFIHRGIEL...... 425
58 -16.7006DK6 Entity 1(prereleased)  ali follow..  13  34..........................................AAQRLIRCGIGD--TEALPEAVRYAMHEAVDELGNRSTFKGYEQGYDFLRNAIADNDYKARGLPDEIFISDGSKCDTGNILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLDIPQEKADLIYLCYPNNPTGAVATLEAWVKYARENLLYDAAYEAFIQPTIPHSIFEIEGA--RDCAIEFRSFSKNGGFTGAYVVIPKSLMGRKKNGEAQALHPNGASYIVQKGAEALYT--SQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPAGLTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFN--SRANVEEVCRRIAAL......... 410
59 -16.7002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  10  16...................................AKRKARERGVGLIDLSIGS--DLPPPEAPLKALAEALND---TTYGYCLKSCTLPFLEEAARWYEGRYGVGEALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLRDLKAVPEGVREAKVLLLNYPNNPTGAVADFEEALGLARKHLIHDNPYVDQVYEGEAPSPLALPGA--KERVVELFSLSKSYNLAGGFALGSEEALARLERVKGVI--DFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEGVDDLEFGLRLVERGVALAP------PGGKGFVRIALVR--PLEELLEAAKRIREALD....... 376
60 -16.5006MME Entity 1(prereleased)  ali follow..  10  25............................................LKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDSENFYHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKAYICLAVTVNLAGSMANMRAVRELTEAHVFYDATRCVENAGFENKSIAEIVHEMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLT-QDEFPAQSLAASIYVETGVRPKLETVRLTIPRRYTYAHMDVVADGIIKLYQHKEDIRG 436
61 -16.5003ffh_A mol:protein length:363 Histidinol-phosphate aminotransferase  ali model follow..  11  11.......................AGLSSYKPGKREEEVMAELGLTKITKLSSNE---LGTSKKVAAIQANSSVETEIYPDGWA---------SSLRKEVADFYQLEEELIFTAGVDELIELLRVLLDTTTNTVMATPTFVQYRQNALIEGAEVREGEHDLEGMLNAIDEKTTIVWICNPNNPTGNYIELADIQAFLDRVVVLDEAYIEYVTPQPEKHEK----VRTYKNLIITRTFSKIYGLASGYGIADKEIIRQLNIVRPPF----NTTSIGQKLAIEAIKDQAFIGECRTSNANGIKQYEAFAKRFKVKLYPANGN----VLIDLGIEAGTIFSYLEKNGYITRSGAALGFPT----VRITIG---KEEDNSAVIALLEKLL........ 363
62 -16.4005z0y_A mol:protein length:470 Serine hydroxymethyltransferase  ali model follow..  14  2.........SHYALSPEHKQMVEGHLAETDPEVNQIIKDEVDRQKHSIVLIASE--NFTSTSVFDALGTPMCNKYSEGYPGARYYGGNERMEILCQQRALKAFHLDGSRWGVSGSPANLQVYQAIMKPHDRLMGGHLSHGYQTDTRKISAVETMPYRVDDYDMLEKTAVLYRLVAGTSAYCRLIDYKRMREIADKVGAYLVVDMAHISGLI------AAGVIPSPFEYADIVTTTTHKSLGPRGAMIFFRKDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEKQYQEQVLKNAKALENEFKRLGYKLVSTDSHMVLVSLKDKDIDGARIETVCENINIALNKNSIPG-ALVPGGVRIGAPAMTTEEDFVKIANYIDKSVQY...... 423
63 -16.4004p3m_A mol:protein length:429 Serine hydroxymethyltransferase  ali model follow..  14  1..................MFNRDMNIADYDPELWQSITDEVQRQEDHIELIASE--NYTSPRVMEAQGSQLTNKYAEGYPGKRYYGGCEVAESLAIERAKSLFGADYANV--SGSQANAAVYQALCAPGDTILGMSLAHGGHLTHGSHVSFSGKMYN--DYAEIERLAVEHKIIAGFSAYSGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAG-----LYPNPVPFADVVTTTTHKTLGGPRGGLILAKANIEKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEAVYQQQVLDNAKAMVKSFLARGYKIVSTENHLFLVDLIAQDITGKEADAALGNAHITVNKNSVPNDPRSTSGLRIGTPAL-NAQQSAELALWMCDVLDA...... 392
64 -16.3003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  12  24...................................AQFRLENPQHTVINLSIGD--TQPLNASVAEAFASSIARLSSPTTCRGYDFGLPALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIAQENAFFPEFPEDTHIDILCLCSPNNPTGTVLNLRAIVHYAIEHILFDAAYSTFISDPSLPKSIFEIP-DARFCAIEINSFSKPLGFAGGWTVIPQELTYADGHFVIQDWTFNGASIPAQEAGVAGLS--LPQLEAIHYYRENSDLLRKALLATGFEVFGGEHA-LWVKPTQANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLG--KREDILAACERLQMAPALQS.... 394
65 -16.3004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  11  40.....................RNVNLEKLKNNYLFPEINRREPNVQLISLGTGD--TEPIPEQITSHMSNFAHGLSTVEGYRGY-QGNKTLRKAIAETFYRDLHVKNEVFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHPNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASLHQLVDFAKTNIIFDSAYAAFIEDGSPRSIYEIPGA--REVAIEVSSFSKFAGFTGGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSSGGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGSKSWDVFNEILENTHIITVP------PGGEEYLRISGFG--RRDHIVEASKRLQNFFNTR..... 442
66 -16.2001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  13  4......................RNDCLALDAQDSLAPLRQQFALPEGVIYLDGNSLGARPVAALARAQAVIAEEWGNGLIRSWNSAGWRDLSERLGNRLATLIGARDGVVVTDTTSINLFKVLSAAPERRVIVTETSNFPTDL--ADMLQQGYTLRLVDSPEELPQAIDQDAVVMLTHVNYKTGYMHDMQALTALSHECAIWDLAHSAGAV---------PVDLHQAGADYAIGCTYKYLGPGSAFVWVSPQLCDLVPQPLSGW-YLCGTQPITLAMVECGLDVFAQ-ASLRRKSLALTDLFIELVEQRCAAHELTLVTPREHHVSFEHPEGYAVIQALIDRGVIGDY-------REPRIMRFGFTPLYTFTEVWDAVQILGEILDR...... 401
67 -16.2003f0h_A mol:protein length:376 Aminotransferase  ali model follow..  11  12...................................................QGMLNFTVGPVMSSEEVRAIGAEQVPYFRTTEFSSTMLENEKFMLEYAKAPEGSKAVFMTCSSTGSMEAVVMNCFTKKDKVLVHRFVQLCEIHEIPYVALKLEHGKKLTKEKLYEYDNQNTGLLVNVDETSTAVLYDTMMIGEFCKKNFVCDCVSAFL---------ADPFNMNECGADVMITGSQKVLACPPGVIVLAPRGVERVEKSKVRTMYPFTPAVGILLQINERLKEIKKHDAEVARIASQAADFRAKIKDLPFELVSESPANVTSVHPTTANAYDIFLKLKDEYGIWICP------EMKDTIFRVGHIGALTHEDNTTLVNAFKDLQKRNLL... 370
68 -16.2004oyt_A mol:protein length:442 Serine hydroxymethyltransferase, putative  ali model follow..  10  2.............FNNEPLEQIDKELHDILADEEKRQ-------RETINLIASE--NLTNGAVRECLGNRVSNKYSEGYPKKRYYGGNDKIEELCQKRALEAFNVSDEEWGVSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITS-DLDAVREMALSFKIICGYTSYPRDIDYQQFRQICDEVNAYLFADISHISSFVA------CNILNNPFLHADVVTTTTHKILGPRSALIFFNKKRNPGIEQKINSAVFPSFQGGPHNNKIAAVACQLKEVKEYTQQVLLNSKALAKALISKQIDLNGTDNHLIVVDLRKFSITGSKLQETCNAINVSLNKNTIPSDVDSPSGVRIGTPAM-KEKDMEFIADVLARAIK....... 399
69 -16.1005i90_A mol:protein length:427 PvdN  ali model follow..  13  55......................................................HFANFLLTSHPRPVREAIERLNPGEAVDWHREEIWKYEDEARAWAGRYFAVQPALTGSTTDGLAAIYGGLLVQPGKEILTSSHEHYSTYMGTQVREFPLFK-ADEILSSIAAQIRQTRVLGMTWVQSGSGVKLPIREIGKLVRELYVVDGVHGFGVE---------DVSFADFDCDYFIAGTHKWL-GTGVIIARSEQLQEHLVPSIPTFSRADNFGTEHRLALGTAFELHLQKAEVQARIHQLNAYLKQRLGEHP-PTSPELSSGFTFFRV-EGRDCEAVAKHLMAHRVISDAVDRDVGP-----VRLAPSLLNDEAEIDRVLEILAPQLA....... 427
70 -16.1004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  12  57...................................................QIETINLIASENLTNTAVRECNKYSEGYPHKRYYGGNDKIEELCYKRALEAFNVSEEEWGVSGSAANVQALYALVGVKGKIMGMHLCHLTHGFFDEKKKVSITSDLFEDMESVRNLALSFQIICGYTSYPRDIDYKGFREICDEVNAYLFADISHISSFV------ACNLLNNPFTYADVVTTTTHKILGPRSALIFFNKKRNPGIDQKINSSVFPSFQGGPHNNKIAAVACQLKEVKEYTKQVLLNSKALAECLLKRNLDLVGTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDVDSPSGIRIGTPAL-KEKDMEFIADMLLKAIL....... 431
71 -16.1005vpr_A mol:protein length:414 Cysteine desulfurase  ali model follow..  15  2.......................AMFDIQEIRSQFPILQEKVNGKDLV------YLDNAATSQKPKMVLDAINNYNVHRGIHTLSQVATEMMEDARKKVQRFINAKHDVLFTKGTTEGINLVAY-IKKDDEIIISYLEHHSNITGAKLRVIPMNEDGTLQIDVLDEWLSEKKLVSVNQVSNALGIVNPIDEIIRKVRAKIFIDGAQAAPHF---------EIDVQTMDCDFFAFSGHKMYGPTGGILYGKASVLEQLTYAGLPFRFEAGTPNAGNIAIGTAVDFMEK-AAHEHALLEYAQRKLLEIEGLKVYGEKANRAGVVSFNLSGIGIASDVGMILDKLGIAVRTGHHCTQP--AGTVRASFAVYNTFEEIDILTEGVKKAQKMLA.... 408
72 -16.1003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  13  26.................................................................GVLTEALQNIDDNLESD--IYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADENRRVAYHPLSHLEIHEQKELQQITPLLLGTANIDDIKSLREPVSSVLIELPQRIGGQLPAFEELEKISE-SLHLDGARLWEITPFYQKSAEE-----CALFDSVYVSFYKGIGGAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFE---KRIGKMAEYFEAAKGLAERFNSCS--VPEVPVSNMFHVYFENSADEIGLTKIQDETGVGISGYLQEKS-ADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL..... 359
73 -16.0006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  14  51...................................................QCRGLELIASENFCSRAALEANKYSEGYPGKRYYGGAEEIELLCQRRALEAFDLDPAQWGVSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIDYNQLALTARLFRIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLV------AAKVIPSPFKHADIVTTTTHKTLGTRSGLIFYRKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMREYSLQVLKNARAMADALLERGYSLVGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSTPGGLRLGAPALTSEDDFRRVVDFIDEGVNI...... 438
74 -15.9002hzp_A mol:protein length:501 Kynureninase  ali model follow..  11  65..............EEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIYFLGNSLGLQPK-MVKTYLEEELDKWAKIAGHEVGKRPWITGDESIVGLMKDIVGANKEIALMNALTVNLHLLMLSFPKRYKILLEAKAFPSDHHGLNIEESMRMIKPREDILEVIEKEGDSAVILFSGVHFYTGQHFNIPAITKAGQAKVGFDLAHAVGNV---------ELYLHDWGVDFACWCSYKYLAGAGAGAFIHEKHAHTIKPALVGW-FRISNPPILVCSLHASLEIFKQ-KALRKKSVLLTGYLEYLIKHNYGKDKAATKKPVVNIIITFSVPNKDVFQELEKRGVVCDK-------RNPNGIRVAVPLYNSFHDVYKFTNLLTSILDS...... 490
75 -15.7005x3v_A mol:protein length:496 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  13  25...............QESLSDSDPEMWELLQREKDRQ-------CRGLELIASE--NFCSRAALEALGSCLNNRYSEGYPGKRYYGGAEEIELLCQRRALEAFDLDPAVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIDYNQLALTARLFRIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLV------AAKVIPSPFKHADIVTTTTHKTLGARSGLIFYRKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMREYSLQVLKNARAMADALLERGYSLVGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSTPGGLRLGAPALTSEDDFRRVVDFIDEGVN....... 432

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24