current user: public

If you have questions about the server, please let us know.

Query: 4j5u_A mol:protein length:420 Serine hydroxymethyltransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420
# Score Template Links and tools%idFirst MNIFNNNLHETDKEINEIIKHEKLRQSSVIELIASENFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAHAVTSTTHKTLRGPRGGLILSNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNNEDNSALEQQVLNEVTKLIELFPFYGLast
1 -126.0004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model  100  1MNIFNNNLHETDKEINEIIKHEKLRQSSVIELIASENFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNKETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAHAVTSTTHKTLRGPRGGLILSNDEEIGHKINSALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNNEDNSALEQQVLNEVTKLIELFPFYG 420
2 -119.0005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  55  2AMFANISISEFDPELAQAIASEDERQEAHIELIASENYCSPAVMEAQGSKLTNKYAEGYPGKRYYGGCEFVDVIEQMAIDRAKELFGADYANVQPHAGSQANSAVYLALLNPGDTVLGMSLAHGGHLTHGAKVSFSGKTYNAVQYGLNAETGEIDYEEVERLALEHKPRMIVAGFSAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAGVYPNPVQIADVTTTTTHKTLRGPRSGLILAKANEIEKKLQSAVFPGNQGGPLMHAIAAKAICFKEAMSDDFKAYQQQVVKNAQAMAEVFIARGYDVVSGGTDNHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSPFVTSGIRIGTPAVTTRGFGEAEVRELAGWIADVIDSKGDE----KVIADVKAKVEAVCAKFPVYA 418
3 -119.0004p3m_A mol:protein length:429 Serine hydroxymethyltransferase  ali model follow..  56  1MFNRDMNIADYDPELWQSITDEVQRQEDHIELIASENYTSPRVMEAQGSQLTNKYAEGYPGKRYYGGCEYVDVAESLAIERAKSLFGADYANVQPHSGSQANAAVYQALCAPGDTILGMSLAHGGHLTHGSHVSFSGKMYNAVQYGITPETGILDYAEIERLAVEHKPTMIIAGFSAYSGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLGGPRGGLILAKNEAIEKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEFAVYQQQVLDNAKAMVKSFLARGYKIVSGGTENHLFLVDLIAQDITGKEADAALGNAHITVNKNSVPNDPRSPFVTSGLRIGTPALARRGVNAQQSAELALWMCDVLDAIKDEAKLATTITAVKVKVAALCKACPVYG 421
4 -119.0003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  61  7.PFFSQSLAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQYGVSRDTMLIDYDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINSAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTNPEDHATEQRVRREIFALCERFPIY. 425
5 -118.0002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  58  2.....VSTLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRPDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDKLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPS--------EALREEVRRLALAHPMP. 407
6 -117.0005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  55  3...MAYFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTFPSVMEAMGSILTNKYAEGYPNKRYYGGCEVVDKIESLAIERAKKLFNCQFANVQAHSGSQANNAVYHALLKPYDKILGMDLSCGGHLTHGAKVSLTGKHYQSFSYGVN-LDGYIDYEEALKIAQSVKPEIIVCGFSAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTNEHAHPFPHCHVVSSTTHKTLRGPRGGIILTNDEEIAAKIDKAIFPGTQGGPLMHVIAAKAVGFKENLKPEFKAYAKLVKSNMQVLAKALKEKNHKLVSGGTSNHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSPFVTSGIRIGSAALSARGMGAKEFEIIGNKISDILNDINN----VSLQLHVKEELKAMANQFPVYQ 414
7 -117.0001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  55  1MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGID-ATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDE----AVIERIKGKVLDICARYPVYA 417
8 -117.0004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  55  7MIFDKEDYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDKESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNSAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVSGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDK----PEVLERIRGDVKVLTDAFPLY. 422
9 -116.0003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  57  3....AMSLEMFDKEIFDLTNKELERQCEGLEMIASENFTLPEVMEVMGSILTNKYAEGYPGKRYYGGCEFVDEIETLAIERCKKLFNCKFANVQPNSGSQANQGVYAALINPGDKILGMDLSHGGHLTHGAKVSSSGKMYESCFY-GVELDGRIDYEKVREIAKKEKPKLIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAGEHPSPFPYAHVVSSTTHKTLRGPRGGIIMTNDEELAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEWKVYAKQVRTNAQVLANVLMDRKFKLVSDGTDNHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSPFITSGLRLGTPALTARGFKEKEMEIVSNYIADILDDVNN----EKLQENIKQELKKLASNFIIYE 413
10 -115.0003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  47  14.GSMSAPLAEVDPDIAELLAKELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEHVDVVENLARDRAKALFGAEFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYENGFYGVDPATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQ-QYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAPDVAKVSGGTDVHLVLVDLRDSPLDGQAAEDLLHEVGITVNRNAVPNDPRPPMVTSGLRIGTPALATRGFGDTEFTEVADIIATALATGSS-----VDVSALKDRATRLARAFPLY. 430
11 -115.0003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  58  5.....SYITKQDKVIAEAIEREFQRQNSNIELIASENFVSEAVMEAQGSVLTNKYAEGYPGRRYYGGCEFVDVTESIAIDRAKALFGAEHVNVQPHSGPQANMAVYLVALEMGDTVLGMNLSHGGHLTHGAPVNFSGKFYNFVEYGVDKDTERINYDEVRKLALEHKPKLIVAGASAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAGLHPNPVEYADFVTTTTHKTLRGPRGGMILCKEEYK-KDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNFKTYQQQVVKNAKVLAEALINEGFRIVSGGTDNHLVAVDVKGSILTGKEAEETLDSVGITCNKNTIPFDQEKPFVTSGIRLGTPAATTRGFDEKAFEEVAKIISLALKNSKD----EEKLQQAKERVAKLTAEYPLY. 414
12 -113.0001eji_A mol:protein length:478 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  46  14.KMLSQPLKDSDAEVYSIIKKESNRQRVGLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYGGTEFIDELEMLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKIFFESMPYKVYPETGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGELESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEFKIYQLQVLANCRALSDALTELGYKIVTGGSDNHLILMDLRSKGTDGGRAEKVLEACSIACNKNTCPGDK-SALRPSGLRLGTPALTSRGLLEEDFQKVAHFIHRGIELTLQIQSHMSAVATLREEVENFASNFSLPG 474
13 -112.0001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  56  2.....KYLPQQDPQVFAAIEQERKRQHAKIELIASENFVSRAVMEAQGSVLTNKYAEGYPGRRYYGGCEYVDIVEELARERAKQLFGAEHANVQPHSGAQANMAVYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFSGVQYNFVAYGVDPETHVIDYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFA-KQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESPFVTSGIRIGTAAVTTRGFGLEEMDEIAAIIGLVLKNVGS----EQALEEARQRVAALTDPTSRSA 411
14 -112.0006fl5_A mol:protein length:471 Serine hydroxymethyltransferase, cytosolic  ali model follow..  47  10.KMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPNGAIMGLDLPDGGHLTHGFMTSATSIFFNSMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDR-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGAVQALREEVESFASLFPLPG 469
15 -112.0001bj4_A mol:protein length:470 PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)  ali model follow..  47  10.AMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMPYKVNPDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDR-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSDTGAVQALREEVESFASLFPLPG 469
16 -112.0005x3v_A mol:protein length:496 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  45  24...GQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNRYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSSATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDR-SAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTQRLANLRQRVEQFARAFPMPG 479
17 -111.0005z0y_A mol:protein length:470 Serine hydroxymethyltransferase  ali model follow..  44  12.QMVEGHLAETDPEVNQIIKDEVDRQKHSIVLIASENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHLDGVNVQTLSGSPANLQVYQAIMKPHDRLMGLDLPHGGHLSHGYQTSAVSTYFETMPYRVDLETGIIDYDMLEKTAVLYRPKVLVAGTSAYCRLIDYKRMREIADKVGAYLVVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKGDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKQYQEQVLKNAKALENEFKRLGYKLVSDGTDSHMVLVSLKDKDIDGARIETVCENINIALNKNSIPGDR-SALVPGGVRIGAPAMTTRGASEEDFVKIANYIDKSVQYAKKVQSESDEITQLKNEISAWAGEFPLS. 469
18 -111.0003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  55  4MLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGID-ESGKIDYDEMAKLAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGELYKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNIND----EATIERVKAKVLDICARFPVYA 420
19 -111.0004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  56  5FDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLN-ENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPIN-SAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDA----ATIERVRAQVAELTKRFPVY. 417
20 -107.0006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  46  29...GQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSSATSIFFESMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGTRSGLIFYRKYTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDR-SAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSKTQRLANLRQRVEQFARAFPMPG 484
21 -107.0006ccz_A mol:protein length:455 Serine hydroxymethyltransferase  ali model follow..  44  3.AFLDYGLSEADPDVHAIINKEKDRQFRSLELIASENFTSKAVMEAVGSCLTNKYSEGLPGKRYYGGNEHIDELEILCQQRALAAFDKWGVNVQPLSGSPANFAVYTAILKPHDRIMGLDLPHGGHLSHGFMTSGTSIYFESMPYRLDESTGVIDYDMLEKTAALFRPKLIIAGASAYPRDIDYARFRKIADSVGAFLMMDMAHVSGLIAASVLADPFEFVDIVTTTTHKSLRGPRGGMIFFKKDAVESAINNAVFPGLQGGPHNHTIGGLAVCLKYAQSPDFKNYQNQVVANCRALANRLVEHEYKLVSGGSDNHLVLVDLRPSGIDGARVEKILDMASITLNKNSVPGDK-SALVPGGIRIGSPAMTTRGLGEKEFELIADLIHEGVRISLEAKSLGDKVSNLRRKVEALATQYPIPG 454
22 -106.0004oyt_A mol:protein length:442 Serine hydroxymethyltransferase, putative  ali model follow..  41  2..FNNEPLEQIDKELHDILADEEKRQRETINLIASENLTNGAVRECLGNRVSNKYSEGYPKKRYYGGNDFIDKIEELCQKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDMFESCNSQGYVDLDAVREMALSFKPKVIICGYTSYPRDIDYQQFRQICDEVNAYLFADISHISSFVACNILNNPFLHADVVTTTTHKILRGPRSALIFFNKKGIEQKINSAVFPSFQGGPHNNKIAAVACQLKEVHSPAFKEYTQQVLLNSKALAKALISKQIDLVTNGTDNHLIVVDLRKFSITGSKLQETCNAINVSLNKNTIPSDV-DCVSPSGVRIGTPAMTTRGAKEKDMEFIADVLARAIKITVDLQEQYGKLQQLKQEVVTWAGALPFP. 442
23 -105.0004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  42  34..FNNDPLQKYDKELFDLLEKEKNRQIETINLIASENLTNTAVRECLGDRISNKYSEGYPHKRYYGGNDYVDKIEELCYKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSITSDLFESCNSEGYVDMESVRNLALSFQPKVIICGYTSYPRDIDYKGFREICDEVNAYLFADISHISSFVACNLLNNPFTYADVVTTTTHKILRGPRSALIFFNKKGIDQKINSSVFPSFQGGPHNNKIAAVACQLKEVNTPEFKEYTKQVLLNSKALAECLLKRNLDLVTNGTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDV-DCVSPSGIRIGTPALTTRGCKEKDMEFIADMLLKAILLTDELQQKNPKIDELKKEVVQWAKNLPF.. 473
24 -105.0001ls3_A mol:protein length:483 Serine Hydroxymethyltransferase  ali model follow..  47  19.QMLAQPLKDSDAEVYDIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEHIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMAYKVNPDTGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRYNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDK-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTVQIQDDTRAVRALRQEVESFAALFPLPG 479
25 -102.0004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  33  2......EYSDVPKFIRDVSIKQHEWMRESIKLIASENITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVETLCIELSKELFKAEHANVQPTSGVVANLAVFFAETKPGDKLMALSVPDGGHISHWKVSAAGIRGLKVINHPFDPEEMNIDADAMVKKILEEKPKLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAGKQFQDPLEGAEYLMGSTHKTFFGPQGGVILTTK-ENADKIDSHVFPGVVSNHHLHHKAGLAIALAE-MLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHKDFTESHQVIIDIEFSASELAKMYEEANIILNKNLLPWDDNNSDNPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDKEK-------PEKVREDVKEFAKEYSTIH 414
26 -21.3005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  16  38...............YKNLTRSLTREFINLNPIQRGGILPKEAKKAVYEYWDGYSVCDYCHGRL---DEVTCPPIKDFLEDIAKFLNMDCARP-THGAREGKFIVMHAICKEGDYVVLDKNA---HYTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNKNVGLILLTDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKE----KADFIVASGHKSMAASAPCGILAFSEEFSDKITKTSEKFLGCTSRGLPIVTLMASFPHVVE---VKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIK----------ETPVLDEIAKKDKRRGFFFYDELKKRGIGGIRAGVTKMSVYGLEWEQVEYVVNAIKEIVE.............................. 408
27 -20.2003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  10  4....CEARRAHEHLIRLLLEQGKCPEDG------DESTLELFLHELAVMDSNNFLGNCGVGER--AGSSLLNKITNSLVLKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENVLEGDELRTDLKAVEAKIQELGPECLHSTTACFA---RLEELAVICANYDIPHVVNNAY--GLQSSKCMHLIVGRIDAFVQSLDKNFMVPGGAIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLNA----AAAIGMKMQDVDLFIKRLDKCLNIVRKEQTRA..................... 450
28 -19.6002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  14  54........................................................................PIHDFIHNQLPKFLGCDVARV---GAREAKFAVMHSLAKKDAWVV---MDENCHYSSYVAAERAGLNIALVPKTDYPD-YAITPENFAQTIEETKKRLITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKE----GADFIVGSGHKSMAASGPIGVMGMKEEWAEIVKNKEVELLGCTARGATIITLMASF-PHVRERIKRWDEE-VEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEV-GGRFFLYRELKSRKIHGIKPGLT--------------RYFKLSTYGLSDEEVDYVLNAFKEIIEK............................. 369
29 -19.5002hzp_A mol:protein length:501 Kynureninase  ali model follow..  12  82............QDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESI-VGLMKDIVGANEKEIALMNALTVNLHLLMLSFPKRYKILLEAKAFSDHYAIESQLQLHGLNIEESMRMIEETLRIEDILEVIEKEGD-SIAVILFSGVHFYQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHD----GVDFACWCSYKYLNAGAGGIGAFIHEKHAHTIKPALV---ISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHPVVNIITPSHVEERGCQLTITFSVPNKDVFQELEKRGVVCDKR----------NPNGIRVAPVPLYN---SFHDVYKFTNLLTSILDSAE........................... 492
30 -19.4003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  17  20....KAGLYKSERIITSPQNAEIKVGEKEVLNFCANNYLGPALIKTAQTVV-EQYGFGMASVRFICGTQ---TIHKELEKDISEFLGTDDTIL---SCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYK-----------NNAMGDLEAKLKEARFKLIATDGSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENEYCGVADRVDILTGTLGKALGGASGGYT-SGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHP---IIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMG---KARIRVQMSA----VHTQQQLDRAIEAFGQVGKK............................. 395
31 -19.3001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  12  46..........DELTLVRHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAARLFADLHPYQDPRTAQGALRLMWEL-GEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHED--VVLVPDSAHGSNPATASMAGYQVREIPS---GPEGEVDLEALKRELGPHVAALMLTNPNTLLFERRILEISRLCKEAGVQLYYDGANLNAIMG---WARPGDGFDVVHLNLHKTF-GPGSGPVGVKAHLADFDRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGLKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEFVAQPPEGFRALDLAKGLLELG-------HPPTVYFPLIVKEALMVEPTETEA----KETLEAFAEAMGALLKKPKEWLENAPYSTPVRRLDELRANKHPK.. 467
32 -19.0001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  14  46.........................SNDYLGLSHHPQIIRAWQQGA------EQFGIGSGGSGHVSGYS---VVHQALEEELAEWLGYSRALL---SGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFA-------------DVTHLARLLASPCPGQMVVTEGVFSMD-PLAEIQQVTQQHNGWLMVDDAHGTGVIGRGSCWLQKVKPELLVVTFGKGF-GVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEGDARREKLAALITRFRAGVQDLPFTLADSCSA---IQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAG---TARLRLTLTA----AHEMQDIDRLLEVLHGN................................ 383
33 -19.0002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  17  10................................LRSDTVTKPT------EEMRKAMAQAEVGDDVYGEDPTINELE----RLAAETFGKEAA-LFVPSGTMGNQVSIMAHTQRGDEVIL---EADSHIFWYEVGAMAVLS--VMPHPVPGKNGAMDPDDVRKAIRPPRTSLIAIENTRVVPLENIKEICTIAKEHGINVHIDGARIFNASIA-PVKEYAGYADSVMFCLSKGLCAPVGSVVVGDR----DFIERARKARKMLGGGMRQAGVLAAAGIIALTKMVDRLKED--ENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANA----------VSDTEIRL----VTHKDVSRNDIEEALNIFEKLFRK............................. 347
34 -18.9002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  14  59...........DEKIKLFLKFLSMMDTDKDPKSVRIGEREARTYSKIHEELSSGFCHGVDPQPKASGASIMYALTNKILESFFKQLGVHAIATPISTGMSISLCLSAARKKYGSNVVIYPYA--SHKSPIKAVSFVGMNMRLVETVLDGDRVYVPVEDIENAIKKEIELCVLSTLTFFPP--DIVEIAKICENYDIPHIINGAY--AIQNNYYLEK-KYRVDAVVSSSDKNLLTPIGGLVYSTDAEFIKEISLS----YPGRASATPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDTGGKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHDYI---VMNAAIGVRTEDIVNSVSKLEKIL............................... 449
35 -18.6005i90_A mol:protein length:427 PvdN  ali model follow..  14  29....AEGVPSDAGNKWKALRQQFDLDPQYLHFANFLLTSHPRPVREAIERLRVRFDRNPGEAVDWHREEIWKYEDE-ARAWAGRYFAVQPGQV---STTDGLAAIYGGLVQPGKEILTSSHEHYSTYTLEYRHKRMGTQVREFPLFKDPHRVSADLSSIAAQIRP-QTRVLGMTWVQSGVKLPIREIGKLVRELNQIYVVDGVHGFGVEDVSFAD----DCDYFIAGTHKWLFGPRGGVIIARSEQLQEHLVPSIPTFSRGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGEHKVRLVTTSPELSSGFTFFRVEGRDCEAVAKHLMAHRVISDAVD---------VGPVVRLAPSLLND----EAEIDRVLEILAPQL............................... 426
36 -18.5001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  16  52.........................ANNYLGLANHPDLIAAAKAGM------DSHGFGMASVRFICGTQ---DSHKELEQKLAAFLGMEDAIL---SCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYA-----------NNDMQELEARLKEAREHVLIATDGVFSMD-NLKGVCDLADKYDALVMVDDSHAVGFVGENEYCDVMGRVDIITGTLGKALGGASGGYT-AARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAG-SELRDRLWANARQFREQMSAAGFTLAGADHA---IIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKG---QARIRTQMSA----AHTPEQITRAVEAFTRIGKQ............................. 396
37 -18.5001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  14  1..MAKRIVEPFRIKMVEKIRVPSREERNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLK----DKAKELFNYDYI-IPAHQGRGAENILFPVLLKYKQKEGKFDTTAAHVELNGCKAINIVTEKAFDSETYDDWKGDFDIKKLKENIAQHGADNIVAAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCNATIKEVIFDMYKYADALTMSAKKDPLLNIGGLVAIRDNEEIFTLARQRCVPMEGFVTYGGLAGMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYP-TGGHAVFVDCKKLVPQIPGDQALYLESGVRAVEIGSFLLGRDPATGE-MRLTIAR-----YTNDHMDYIADALIGLKEKFATLKGLEFEYEP--PVLRHFTARLPI.. 466
38 -18.4001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  13  97.TAVNNYEDSILPPFFKSLKEYVSRYLIQFDC-PGHQGGQYYRKHPAGREFYDFFGETVFRADLCNADVALGDLLI-AEKHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVL---FDRNNHKSVYNSALAMAGGRPVYLQTNRNPYGFIDSDFDEKKIRELAAKAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRN--DPGIIVVQSVHKQQAGSQTSQIHKKDSHIKKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKGSMFRPFVPPVVNGKKWEDGDTEDMANNIDYWRFEKGAKWHAYEGYGDNQYYVDPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDHGTPAETPAKMNNLITQLLQLQRLI.... 566
39 -18.4005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  11  7....................................QFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERAS----EYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVIC---SETAHVETDECGAPEFFSNGSKLLTAASVNGKLTPQSIREVALKRKPRVVTITQATVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLEDGAWLRHGNHANHC---AQLLALLVSDLPGVELMFPVEANGVFLQM------PEHAIEALRAKGWRFYTFI---------GSGGARF----MCSWDTEEERVRELAADIRSIITA............................. 346
40 -18.3002vyc_A mol:protein length:755 BIODEGRADATIVE ARGININE DECARBOXYLASE  ali model follow..  13  128VAAMTRYRQQLLPPLFSALMKYSDIHEYSWAA-PGHQGGVGFTKTPAGRFYHDYYGENLFRTDMGIERTSLGSLLD-SEKYAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---VDRNCHKSIEQGLMLTGAKPVYMVPSRNRYPQEMQPETLQKKISESKPSYCVVTNCTY---YNAKEAQDLLEKTSDRLHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGRGFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR..................................................................................................................... 463
41 -18.3002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  15  46.........................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN--------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNN-EVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTIRSE----SQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY............................. 383
42 -18.2003isl_A mol:protein length:416 Purine catabolism protein pucG  ali model follow..  15  1.................MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFD------------PAFTGIMNETMEMLRELFQTKNRWAYPITSRAGIEAVLASVIEPEDDVLIPI---YGRFGYLLTEIAERYGANVHMLECEWGT-VFDPEDIIREIKKVKPKIVAMGETSTGRIHPLKAIGEACRTEDALFIVDAVATIG---GCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVERG-TEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSKMPVVTCVEIPGGIDGESVRDMLLA-----QFGIEIASSFGPLAGKIWRIGTMGYS---CRKENVLFVLAGLEAVLLRHNAGIEAGKALQAALDVYENAGRQAAV.. 416
43 -18.2001v72_A mol:protein length:356 Aldolase  ali model follow..  12  11....................................GFSSDNIAGASPEVAQALVKHSSGQAGPYGTDELTAQVK----RKFCEIFERDVEVFLVPTGTAANALCLSAMTPPWGNIYC---HPASHINNDECGAPEFFSNGAKLMTVDGPAAKLDIVRLRERTREKQPACVSITQASIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCS--KAGVDALSFGATKNGVLAAEAIVLFNT----SLATEMSYRRKRAGHLSSKMRFLSAQIDAYLTDLWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRLDSAMIDALLKAGF-----------------HDRWGPNVVRF----VTSFATTAEDVDHLLNQVRLAADRTQE.......................... 355
44 -18.2003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  16  4................................LRSDTVTRPS------RAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTHNGKVYLKEAWEFTRERNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNR----DYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQED--DNAAWMAEQLREAGADVMRQDTN----MLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSREQLAEVAAHWRAFLAR............................. 333
45 -18.2003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  18VRQGCEARRSHEHLIRLLLEKGKCPENHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGGSSLLNKITNSLVLKLAGVHTVANCFVVPMATGMSLTLCFLTLRPKAKYII---WPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCIHSTTSCFA---RLEELAVICANYDIPHIVNNAY--GVQSSKCMHLIQQRIDAFVQSLDKNFMVPVGGIIAGFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYLSNQIKKLSEAYNERLLHTPHNPISLAMTLKTLDEHRTQLGSMLFTRQVSGARVVPLGSMQTVSGYTFRGFMSHAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKESDDN................. 472
46 -18.1001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  16  17....................................SFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAA----RLIGELLERPDADV-ISGGTQTNLIACSLALRPWEAVIA---TQLGHISTHETGAIEATGHKVVTAP--CPDGKLRVADIESALHENIPKLVYISNTTQYTKQELEDISASCKEHGLYLFLDGARLASALSS-TLADIARLTDMFYIGATKAGGMFGEALIILND----ALKPNARHLIKQRGALMAKGWLLGIQFEVLMKDNFFELGAHSNKMAAILKAGLEACGIRLAWP-SASNQLFPILENTMI--AELNNDFDMYTVEPLKD----------GTCIMRL----CTSWATEEKECHRFVEVLKRLVASTA........................... 359
47 -18.1001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  15  1MNYPAEPFRIKSVETVSMIPRDERLKKNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTAAHGIKVFYDATRCVENAYAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYSYGGLAGRDMEAMAIGLREAMQ---YEYIEHRVKQVRYLGDKLKAAGVPIVEP-VGGHAVFLDARRFCEHLTQDERSMERGIISAGRNNVTGEHHRPKLE--VRLTIPR-----YTYAHMDVVADGIIKLYQHKEDIRGLKFIYEP--KQLRFFTARFYI.. 456
48 -18.0003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  15  60.........................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN--------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNN-EVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTIRSE----SQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY............................. 397
49 -18.0003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  16  20....AKGLYAYFRPIQSKQDTEVKIDGRRVLMFGSNSYLGTRIIKAAQDAL-EKYGTGCAGSRFLNGTL---DIHVELEEKLSAYVGKEAAIL---TGFQSNLGPLSCLMGRNDYILL---DERDHASIIDGSRLSFSKVIKYGHN--------NMEDLRAKLSRLPEKLICTDGSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKSHFGLNDDVDLIMGTFSKSL-ASLGGFV-AGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNE-PEHIEKLWKNTDYAKAQLLDHGFDLGATESP---ILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAE---ESLIRFSLMAT-----TYDQIDEAIEKMVKVFKQ............................. 391
50 -18.0001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  14  1MTTRNDCLALDAQDSLAPLRQQFALPEGVIYL-NSLGARPVAALARAQAVIAEEWGNGLIR--SWNSAGWRDLSERL-GNRLATLIGARDGEVVVTDTTSINLFKVLSAAPERRVIVTETSNPTDLYIAEGLADMLQQGYTLRLV--------DSPEELPQAIDQ-DTAVVMLTHVNYKYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQ----GADYAIGCTYKYL-GPGSQAFVWVSPQLCDLVPQPLSGWFCGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRELTLVTPREHAKRGSH-VSFEHPEGYAVIQALIDRGVIGDYR----------EPRIMRFGFTPLYT---TFTEVWDAVQILGEILDRKTWAQAQFQVRHSVT.............. 416
51 -17.9005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  14  48.........................SNDYLGLAAHPQLIAAIAEGA------QRYGAGSGGSHLLGGHS---RAHAQLEDDLAEFVGGFVENARALTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYP-------------DTDALSAMLEASDADKVIVSDTVFSMD-PLPRLLELAEQHGAWLIVDDAHGFGVLGPQAQAALRSPNLISIGTLDKAA-GVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEGDARRAHLQQLIGRTRAMLKATPWLPVDSHTA---VQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTG---TSRLRISLSA----AHSQADLDRLEAGLQQLGAK............................. 394
52 -17.9004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  14  59LPSQGLSSSAVLEKLKEYSSMDAFWQEGRATVYSGEEKLTELLVKAYGDFAWSNPLH-------PDIFPGLRKIEAEIVRIACSLFNGDSCGCVTSGGTESILMACKAYFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPL---TKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDVPEVAKLAVKYKIPLHVDAC-LGGFLI--PFDFRVKGVTSISADTHKYGYAPKGSLVLYSDKKYRNY-GIYASPTIAGSRPGGISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIGIFVFG---NPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP---------PSIHF-TLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMRNMVAELSSVF.... 488
53 -17.9005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  13  26..........................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMS------------KDMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVNSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALPTVTTVAVPAGYDWRDIVSYVID-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH............................. 391
54 -17.9004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  12  19MLNLQDKYTQYQRDNLLRELTPFIKDDSIIDFTTSDNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYT---DETQQFEHEFAKFINYPRAIF---SGFMANLAIYSTLFSKHDSIFADKYI---HASIIDGIKLSQAKLRRYKHQ--------QLSQLQDIYDGKS---FITTEGVFSTSGSITQLDKLAKITPEKLIVDEAHSFGVLAINSFRISYKNCLICVFPLGKAF-GGVGAVVCTTE-AIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENV-NDNRARLQQNITFFNELCDAKDLELVS--KDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKD---QAILRFSLHSN-----TFDQIQQALEIISKEVKY............................. 387
55 -17.8002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  15  51.........................TYNYMGMTFDPDVIAAGKQAL------DEFGSGTTGSRVLNGTY---QGHKACEDALKEFYGTEHAIV---TGYQANLGMISTLAGKGDYIIL---DADSHASIYDGCWLGDAEIVRFRHN--------SVEDLDKRLGRLPAKLVVLEGSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHEEAGVEADVDFVVGTFSKSV-GTVGGFC-VSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHA-GDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVILTD-MAQAVALWQGLLEAGLYVNTARPPATPAG---MFLLRCSLCAE-----SDEQVEQILGMFESAGRATGVIPKLAAALE................. 406
56 -17.8005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  12  23....AAQTVTGPLPFGNSLLKEFVLDPAYRNL----NHGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLDESRAAVANLLKVPVETVNATMGVNTVLRNIVWSADGKDEILYFDTIYGACIDYVIEDKRGIVSSRCIPLIYPAEDDDV-VAAFRDAIKKSRPRLAVIDSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDLKITE----DPDFLISNCHKWLFTPRGCAVFYVPVRNQHLIRSTLPTS-VGTVDNSPFFCVAIKWREEVLGGEERIMEYMTKLAREGGQKVAEIGTRVLENSTGTLNIALPFVVGEDPKAPVKLTEKEEKDVEGLYEIPHEEANMAFKW-ARLSAQVYL----EMSDFEWAGKTLKELCERVAKGEYKESALEDLQGDHGLSAWSHP... 497
57 -17.7003hbx_A mol:protein length:502 Glutamate decarboxylase 1  ali model follow..  11  40............EAAYQIINDELMLDGN--LASFVTTWMEPECDKLIMSSINKNYVD-------MDEYPVTTELQNRCVNMIAHLFNAPLEEAETAVGVGSSEAIMLAGLAFKRKWQNKRKAEGVQVCWEKFARYFE--VELKEVKLSEGYYVMDPQQAVDMVDENTICVAAILGSTLNGEFEVKLLNDLLVEKNKETGWDT-HVDAASGGFIAP--LPLVKSINVSGHKYGLVYAGGWVIWRNKEDLPE-ADQPTFTLNFSKGSSQVIAQYYQLIRLGHEGYRNVMENCRENMIVLREGLEKTEFNIVSKDEGVPLVAFSLKSSCHTEFEISDMLRRYGWIVPAYTMPPNAQHITV---LRVVIREDFSRTLAERLVIDIEKVMRELDELPSRVIHKISLGQEKSESNSD......... 467
58 -17.7005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  14  46.........................SNDYLGLAAHPKLVAAFAEGA------QRYGSGSGGSHLLGGHS---RAHAKLEDELAGFAGGFSDAPRALTGYMANLAAVTALAGKDATIFSDAL---NHASLIDGTRLSRATVQVYPHA--------DTATLGALLEACTSQKLIVTDTVFSMD-PLAELLALAERHGAWLVVDDAHGFGVLGPQAAAALRSPHLVYVGTLGXAA-GVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEGDARRAHLAALIERTRALLRRTRWQPVDSHTA---VQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAG---TSRLRISLSA----AHSFDDLARLETALLRASEE............................. 392
59 -17.7002ch1_A mol:protein length:396 3-HYDROXYKYNURENINE TRANSAMINASE  ali model follow..  14  17..........................PEKIMMGPGPSNCSKRVLTAMTNTVLSNFH------------AELFRTMDEVKDGLRYIFQTENRATMCVSAHAGMEAMLSNLLEEGDRVLIAV---NGIWAERAVEMSERYGADVRTIEGPPDR-PFSLETLARAIELHQPKCLFLGDSSSGLLQPLEGVGQICHQHDCLLIVDAVASLC---GVPFYMDKWEIDAVYTGAQKVLGAPPGITPISISPKALDVIRNRRTKRYHHTVASNLIFALREALAQIAEEGLENQIKRRIECAQILYEGLGKMGLDIFVKDPRLPTVTGIMIPKGVDWWKVSQYAMN-----NFSLEVQGGLGPTFGKAWRVGIMGECS---TVQKIQFYLYGFKESLKATHPDYIFEESNGF................ 395
60 -17.7005xx1_A mol:protein length:756 Arginine decarboxylase  ali model follow..  13  129VAAMTRYRQQLLPPLFNALMKYSDIHEYSWAA-PGHQGGVGFTKTPSGRFYHDYYGENLFRSDMGIERTTLGSLLD-SEKNAARVFGADRSWSVVVGTSGSNRTIMQACMTDNDVVV---LDRNCHKSIEQGLILTGAKPVYMVPSRNRYPQEMQPETLQKKISASKPSYSVVTNCTY---YNAKEAQDLLAKTSDRIHFDEAWYGYAAMRGEPGDHNGPTVFATHSTHKLLNASQASYIHVREGRGFSRFNQAYMMHATTSPLYAICASNDVAVSMMDGNSGLSLTQEVIDEAVDFRQAMAR..................................................................................................................... 464
61 -17.7002aeu_A mol:protein length:374 Hypothetical protein MJ0158  ali model follow..  12  61..........................................................................EKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKPKKVIHYL-PELPGHPSIERSCKIVNAKYFESD----------KVGEILNKIDKDTLVIITGSTMDLIELENFKKVINTAKNKEAIVFVDDASGARVRLLFNQPPALKGADLVVTSTDKLMEGPRGGLLAGKKELVDKIYIEGTKFGLEAQPP--LLAGIYRALKNFNLERIRKAFERAKNFDLSKIEKLNKELINIVYERTPTGFVIKRVYKDDTINIKKLIEIGFNLLKNYGIITITVAGMPGASKSLRIDLTSRDAERIDDNYIKAIVESIKMAFKS............................. 374
62 -17.6003nnk_A mol:protein length:411 Ureidoglycine-glyoxylate aminotransferase  ali model follow..  15  1...............MDITQFSQLNPPSRLLMGPGPINADPRVLRAMSSQLIGQYD------------PAMTHYMNEVMALYRGVFRTENRWTMLVTSRAGIEAILVSAIRPGDKVLVPV---FGRFGHLLCEIARRCRAEVHTIEVPWGE-VFTPDQVEDAVKRIRPRLLLTGDTSTTMLQPLAELGEICRRYDALFYTDATASLG---GNPLETDVWGLDAVSAGMQKCLGGPSGTSPITLSARMEEAIRRRKCVEEG-TEATTALFGARECARLILQEGLDYGIARHKLHGDALVKGIQAMGLETFGDLKKMNNVLGVVIPQGINGDQARKLMLE-----DFGIEIGTSFGPLHGKVWRIGTMGYNA---RKDCVMTTLSALEAVLNYLKFPTTQGAAMQAAWDHYRS......... 409
63 -17.6004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  16  4................................LRSDTVTRPS------RAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNR----DYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQED--DNTAWMAEQLREAGADVMRQDTN----MLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSRAQLAEVAAHWRAFLAR............................. 333
64 -17.6002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  14  21..........................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMS------------KDMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALPTVTTVAVPAGYDWRDIVSYVMD-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALVA............................. 386
65 -17.6004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  14  21..........................PNQLLLGPGPSNLPPRIMAAGGLQMIGHMS------------KEMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALPTVTTVAVPAGYDWRDIVSYVMD-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH............................. 386
66 -17.6003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  14  3.....RNMQEKGVSEKEILEELKKYRSLDLKYEDGNGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTK---LLEEKAVALLGSLLNNKDAGHIVSGGTEANLMALRCIKNSKNEHPKIIVPITAHFSFEKGREMMDLEYIYAPI---KEDYTIDEKFVKDAVEDYDVDGIIAGTTELGTIDNIEELSKIAKENNIYIHVDAA-FGGLVIPFLDDKYKLGVDSITIDPHKMGHCPIPGGILFKDIGYKRYLTETRQATILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPI-----LNIVAIEDEDYKEVCKKLRDRGIYVSVCN---------CVKALRIVVMPHIKREHIDNFIEILNSIKRD................................. 397
67 -17.6003kgw_A mol:protein length:393 Alanine-glyoxylate aminotransferase  ali model follow..  13  22..........................PTRLLLGPGPSNLAPRVLAAGSLRMIGHMQ------------KEMLQIMEEIKQGIQYVFQTRNPLTLVVSGHCAMETALFNLLEPGDSFLTGT---NGIWGMRAAEIADRIGARVHQMIKKPGE-HYTLQEVEEGLAQHKPVLLFLGESSTGVVQPLDGFGELCHRYQCLLLVDSVASLG---GVPIYMDQQGIDIMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTKVIHHTTPVTSLYCLRESLALIAEQGLENCWRRHREATAHLHKHLQEMGLKFFVKDPELPTITTVTVPAGYNWRDIVSYVLD-----HFSIEISGGLGPTEERVLRIGLLGYN---ATTENVDRVAEALREALQH............................. 387
68 -17.6004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  14  23..........................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMS------------KDMYQIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGG-HYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVAFLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKMYHHTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALPTVTTVAVPAGYDWRDIVSYVID-----HFDIEIMGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH............................. 388
69 -17.5003n75_A mol:protein length:715 Lysine decarboxylase, inducible  ali model follow..  12  118KQTTDEYINTILPPLTKALFKYVREGKYTFCT-PGHMGGTAFQKSPVGSLFYDFFGPNTMKSDISISVSELGSLLD-AEQYIARVFNADRSYMVTNGTSTANKIVGMYSAPAGSTIL---IDRNCHKSLTHLMMMSDVTPIYFRPTRNAYQSEFQHATIAKRVKETPNAAVITNSTYDGLLYNTDFIKKTLDVKS--IHFDSAWVPYTNFSPIYEGKCGKVIYETQSTHKLLAASQASMIHVKGDVNEETFNEAYMMHTTTSPHYGIVASTETAAAMMKGNAGKRLINGSIERAIKFRKEIKRHGFKNIDNEHDPIKVTLLTPGMEKDGTMSDFGISIVAKYLDEHGIVVEKTGPYN-------LLFLFSIGIDKTKALSLLRALTDFKRAFDLNLRVKNMLPSLYREDPEFYENMRI.. 586
70 -17.5006MME Entity 1(prereleased)  ali follow..  15  1...MNYPAEPFRIKSVETVSMIPRDERNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLNKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTEAHGIKVFYDATRCVNKSIAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYSYGGLAGRDMEAMAIGLREAMQ---YEYIEHRVKQVRYLGDKLKAAGVPIVEP-VGGHAVFLDARRFCEHLTQDERSMERGIISAGRNNVTGEHHRPKLE--VRL---TIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLKFIYEP--KQLRFFTARFYI.. 456
71 -17.5002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  18  62.........................RGKDTILLGTYNYMGPDVIAAGKEAL-EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN--------SVEDLDKRLGRLPAKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSKSV-GTVGGFV-VSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLED-QEQAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICA----EHTPAQIQTVLGMFQAAGRA............................. 414
72 -17.4003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  16  9................................LRSDTVTQPT------DAMRQCMLHAEVGDDVYGEDPGVNALE----AYGADLLGKEAA-LFVPSGTMSNLLAVMSHCQRGEGAVL---GSAAHIYRYEAQGSAVLGSVALQPVPMQADGSLALADVRAAIAPDTPTRLVCLENTVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVA-TVRELVAPFDSVSICLSKGLGAPVGSLLVGSH----AFIARARRLRKMVGGGMRQAGILAQAGLFALQQHVVRLADD--RRARQLAEGLAALGIRLDLAQVQTNMVFLQLTSGES--APLLAFMKARGILFS------------GYGELRL----VTHLQIHDDDIEEVIDAFTEYLGA............................. 341
73 -17.3002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  14  18..........................PNKLLMGPGPSNAPQRVLDAMSRPILGHLH------------PETLKIMDDIKEGVRYLFQTNNIATFCLSGHGGMEATLCNLLEDGDVILIGH---TGHWGDRSADMATRYGADVRVVKSKVGQ-SLSLDEIRDALLIHKPSVLFLGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLG---GAPMFMDRWEIDAMYTGSQKVLGAPPGITPVSFSHRAVERYKRRNTKIYHHTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYADKDRLSTVTTIKVPQGVDWLKAAQYAMK-----TYLVEISGGLGPTAGQVFRIGLMGQN---ATTERVDRVLQVFQEAVAAVKPDVQVKGKM.................. 393
74 -17.3002z9u_A mol:protein length:392 Aspartate aminotransferase  ali model follow..  13  2....................RYPEHADPVITLTAGPVNAYPEVLRGLGRTVLY-----------DYDPAFQLLYEKVVDKAQKAMRLSNKPVILHGEPVLGLEAAAASLISPDDVVLNLA---SGVYGKGFGYWAKRYSPHLLEIEVPYNE-AIDPQAVADMLKAHPE-SVCHHDTPSGTINPIDAIGALVSAHGAYLIVDAVSSFG---GMKTHPEDCKADIYVTGPNKCLGAPPGLTMMGVSERAWAKMKANPLAPFPFTPSVSEINGLDVALDLYLNEGPEAVWARHALTAKAMRAGVTAMGLSVWAASDSSPTTTAVRTPDGVDEKALRQAARA-----RYGVVFSSGRGETLGKLTRIGHMGPTA---QPIYAIAALTALGGAMNAAGRKLAIGKGIEAALAVIDA......... 390
75 -17.3005k8b_A mol:protein length:403 8-amino-3,8-dideoxy-alpha-D-manno-octulosonate transaminase  ali model follow..  12  1................................MPGFELFGPEEKQEVADVMEHGFTFRYNFDHMRNDRWKTRDME----QLLCEKMNVKHA-HLLSSGTAALQTAMMAAIGAGDEVIVPPFTFVASVEAIFMAGAVPIFAEI------DETLCLSPEGIEAVITPRTKAINLV--HMCGSMAKMDEIKAICKKHNLVLLEDACQAIGGSYKGQALGTIGDVGCYSFDSVKTITCGEGGAVITNNTEIYDNAHMFSDHGHDHIGLNFRISEMNAALGLAQLRKLDTIIDIQRKNKKAIKDAMASIP-EIPDPEGDSAGFLSFMLPTEARTQEISKKLAANGVDGCFYWYVNNWHYLKNWKHIQELKAPAARPDYTQISVPKSDAIMSRTISMLIKLSWTDAQIAERIENIKKAFAQL.... 396

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.