current user: public

If you have questions about the server, please let us know.

Query: 4my5_A mol:protein length:393 Putative amino acid aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390
# Score Template Links and tools%idFirst GPMDLSKRFNKNLNKIEVSMIRQFDQSISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKEKYHLTYNPDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTRSNDFVLTPEMLEEAILKEGEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEYLPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPVAQGQDSFKFLQDFAKEKAVAFIPGVAFGKYGEGYLRISYAASMETIKEAMKRLKEFMEQYADLast
1 -126.0004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model  100  1GPMDLSKRFNKNLNKIEVSMIRQFDQSISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDADESHYTGMAGLLALRQAASAFVKEKYHLTYNPDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTRSNDFVLTPEMLEEAILKEGEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVISDEVYAELTYTGESHVSIAEYLPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLVTAATTSVQFAAIEALTNGKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAKIPVAQGQDSFKFLQDFAKEKAVAFIPGVAFGKYGEGYLRISYAASMETIKEAMKRLKEFMEQYAD 393
2 -116.0001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  37  2.......ALSDRLELVSASEIRKLFDIAAGMKDVISLGIGEPDFDTPQHIKEYAKEALDKGLTHYGPNIGLLELREAIAEKLKKQNGIEADPKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEDEFRLNVDELKKYVTD---KTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDARHYSIASLMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNATCPVTFIQYAAAKALKDERSAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPRIRD-TGLTSKKFSELMLKEARVAVVPGSAFGKAGEGYVRISYATAYEKLEEAMDRMERVLKERK. 387
3 -107.0003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  20  2..MSIEAKFKKLGTDNAPGQEVRQSAAGLE-GRPVDFSHGDVDAHTPGAFDLFSAGVQSGGVQAYTEYRGDLGIRDLLAPRLAAFTGAPVDARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDETRAGLDLTGLEEAFKA---GARVFLFSNPNNPAGVVYSAEEIGQIAALAARYGATVIADQLYSRLRYAGASYTHLRAEDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQAIVSLRAAGYSQAVLRGWFDEAPGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFPRLPK-LAVAPAEFVKILRLQAGVVVTPGTEFSPHTADSVRLNFSQDHEAAVAAARRIVTLVERYR. 406
4 -107.0001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  32  2......RGLSRRVQAMKPSATVKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYAPPAGIPELREALAEKFRRENGLSVTPE-ETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLEEGFVPDPERVRRAITP---RTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEG-EHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSTTSPDTIAQWATLEALTNQEASVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSP-IAPDEVRAAERLL-EAGVAVVPGTDFA--AFGHVRLSYATSEENLRKALERFARVLGR... 384
5 -105.0001xi9_A mol:protein length:406 putative transaminase  ali model follow..  32  1...AGSIRASKRALSVEYDVVLPARELEKKGIKVIRLNIGDPDFQPPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVEREKRKNGVDITPD-DVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTEEEDWQPDIDDIRKKITD---RTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHISPGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARIRLCPNTPAQFAAIAGLTGPMDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIFPKIEVGPWKNDKEFVLDVLHNAHVLFVHGSGFGEYGAGHFRAVFLPPIEILEEAMDRFEKFMKERLK 399
6 -105.0002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  26  11...RGSHMISNKLANIPDSYFGKTMGIEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPENQYGAFHGKEAFKQAIVDFYQRQYNVTLDKEDEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEPPHYLPDWSKVDSQIID---KTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGTDTKIVHDFAYGAFGFDA-KNPSILASGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTHTNAGMFGALQDAAIYALNHYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPP--GYDSEQFEQFLVQEKSILVAPGKPFGENGNRYVRISLALDDQKLDEAAIRLTELAYLYE. 398
7 -104.0001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  26  5.....PLIPQSKLPQLGTTIFTQMSAL-AQQHQAINLSQGFPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYGYQPDADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQEFAALLSE---RTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHINFSQQGHASVLAHLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQYLTFSVNTPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLVDYSAVSTLDDVEFCQWLTQEHGVAAIPLSVFCPFPHKLIRLCFAKKESTLLAAAERLRQL...... 386
8 -102.0005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  31  1.......ANAKRIEGLDSNVWVEFTKL-AADPSVVNLGQGFPDISPPSYVKEELSKAFIDNMNQYTRGFGHPALVKALSCLYGKIYQRQIDPNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSSDWTFDPRELESKFSS---KTKAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVKIATLMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQNSFYTCATPLQAALAEAFWDPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIADVSSLGADYDYKFVKWMTKHKKLTAIPVSAFCDSFEKLVRFCFIKKDSTLDAAEEIFRAW...... 410
9 -102.0001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  26  9..MHNKFDLPKRYQGSTKSVWVEYIQLAAQ-YKPLNLGQGFPDYHAPKYALNALAAAANSPDNQYTRGFGHPRLVQALSKLYSQLVDRTINPMTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNDWVLDNNELEALFNE---KTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIRICTLMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQNCVYTCATPIQEAIAVGFESPECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVADWSSLDARKDYRFTKWMTKSVGLQGIPPSAFYSEGEDFVRYCFFKKDENLQKAAEILRKWKGS... 428
10 -101.0001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  33  1..MKLAARVESVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGKTRYGPAAGEPRLREAIAQKLQRDNGLCYGAD-NILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTETQFKVSPEQIRQAITP---KTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDAQHLSIGAAAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSTSNVCTFAQYGAIAAYENSQDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFPSIAK-TGRSSLDFCSELLDQHQVATVPGAAFG--ADDCIRLSYATDLDTIKRGMERLEKFLHGI.. 387
11 -101.0001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  34  5.KIMVSRRISEIPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVKYTDPRGIYELREGIAKRIGERYKKDISPD-QVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETFSKNFQPSLEEVEGLLVG---KTKAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYTD-EFTSILDVGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSHTTSCINTVAQYAALKALEVDNS---YMVQTFKERKNFVVERLKKMGVKFVEPEGAFYLFFKVRG----DDVKFCERLLEEKKVALVPGSAFL--KPGFVRLSFATSIERLTEALDRIEDFLNS... 382
12 -101.0002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  28  2.......ATVSRLRPYATTVFAEMSAL-ATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQRRRHFGVDYDPETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLDGRGFALDADALRRAVTP---RTRALIINSPHNPTGAVLSATELAAIAEIAVAANLVVITDEVYEHLVFDHARHLPLAGFMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQYLSYVGGAPFQPAVALALDTEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCADPRPLGYDDSTEFCAALPEKVGVAAIPMSAFCDPAAGLVRFTFCKRDDTLDEAIRRLSVLAERPAT 398
13 -101.0002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  36  2....LSKRLLNFESFEVMDILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGKTHYTDSRGILELREKISELYKDKYKADIIPD-NIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCD-------FTVESLEEALSD---KTKAIIINSPSNPLGEVIDRE----IYEFAYENIPYIISDEIYNGLVYEG-KCYSAIEFNLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLFISAPTISQYAALKAFEKETERINSMIKEFDRRRRLVLKYVKDFGWEVNNPIGAYYVFPNI----GEDGREFAYKLLKEKFVALTPGIGFGSKGKNYIRISYANSYENIKEGLERIKEFLNK... 370
14 -99.9002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  24  5...KIMDVFSDRVLLTEESPIRKLEMAKKRGVRIHHLNIGQPDLKTPEVFFERI-YENKPEVVYYSHSAGIWELREAFASYYKRRQRVDVKPE-NVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIPQNLESFINE---RTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERHGLFLIVDEVYSEIVFRG-EFASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKLAQGRLAPPLLEQIGSVGLLNLDDSFFDFVRETYRERVETVLKKLEEHLKRFTKPSGAFYITAELP---VEDAEEFARWMLTDFNTMVAPLRGFYLTGKKEIRIACVLEKDLLSRAIDVLMEGLKMFCS 398
15 -99.3004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  25  3.....KQLQARRLDGIDYNPWVEFVKL-ASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFNQYTKTFGYPPLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKSSNWQLDPMELAGKFTS---RTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKYDRRFVKWMIKNKGLVAIPVSIFYKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELEN 424
16 -98.4003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  26  4....KNSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETDALGYTVALGLPALRQRIARLYGEWYGVDLDPG-RVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAENRLQPVPADFA------GLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAQGASFISDEIYHGIEYEAKAVTALE--LTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMFICAPHASQVAALAALDCDAE-LQANLDVYKANRKLMLERLPKAGTRIAPPDGAFYVYADVSD-LTDDSRAFAAEILEKAGVAVTPGLDFDPEGAGTLRFSYARATADIEEGLDRLEAFMQARGE 384
17 -97.3003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  22  24..VANKYFTSNTAKDVWSLTNEAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDPMVNQYSPTRGRPSLINSLIKLYSPIYNTELKAE-NVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINGEEWTIDFEQFEKAITS---KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSIGQLTLTVGSAGKSFAATGWRIGWVLSNAELLSYAAKAHTRICFASPSPLQEACANSINDALKIFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSKVKIPKDFRISHWLINELGVVAIPPTEFYKAAENLLRFAVCKDDAYLENAVERLKLLKDYL.. 447
18 -97.1005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  26  3...DRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYSVALGIPELRDAIAADYQRRHGITVEPD-AVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGQTRFQPTAQMLAEI----DPPLRGVVVASPANPTGTVIPPEELAAIASWCDASDVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFTICPPVLSQIAAVSAFTPEATAADGNLASYAINRSLLLDGLRRIGDRLAPTDGAFYVYADVSD-FTSDSLAFCSKLLADTGVAIAPGIDFDTAGGSFVRISFAGPSGDIEEALRRIGSWLPS... 387
19 -97.1005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  32  66..SSVDMSLSPRVQSLKPSKTMLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIREGFTRYTLNAGITELREAICRKLKEENGLSYAPD-QILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTKSNNFLLDPKDLESKLTE---KSRLLILCSPSNPTGSVYPKSLLEEIARIIAKHRLLVLSDEIYEHIIYAPATHTSFASLMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQVSSGASSIAQKAGVAALGAGGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFIDFSAYYGSDSSSLALYFLDKFQVAMVPGDAFG--DDSCIRISYATSLDVLQAAVEKIRKALEPLRA 471
20 -96.9001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  27  2.......RLHPRTEAAKESIFPRMSGL-AQRLGAVNLGQGFPSNPPPPFLLEAVRRAL-GRQDQYAPPAGLPALREALAEEFAVE-------PESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLTPEGFRLDLSALEKALTP---RTRALLLNTPMNPTGLVFGERELEAIARLARAHDLFLISDEVYDELYYGE-RPRRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQWTSFSAPTPLQAGVAEALKRREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLMAELPG-------WDAFRLVEEARVALIPASAFYDPPKDLFRFAFCKTEEELHLALERLGRVVNSPRE 373
21 -96.7002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  25  7.PARRFARIDRLPPYVFNITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDTHYSTSRGIPRLRRAISHWYRDRYDVQIDPESEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLPGIDFFNELERAIRESIP---KPRMMILGFPSNPTAQCVELDFFERVVALAKQYDVMVVHDLAYADIVYDGWKAPSIMQVAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVWAKIPEPYHLGSLEFAKKLLQDAKVSVSPGIGFGDYGDDHVRFALIENRDRLRQAVRGIKAMFRADG. 399
22 -95.3004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  23  23.PIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPGFDAPDEILVDVIRNLPTA-QGYCDSKGLYSARKAIMQHYQARGMRDVTVE-DIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCESSDWFPDLDDIRAKITP---RTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAGLEMLASMRLCANVPAQHAIQTALGGYQSEFITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFPKIDAK--HDDQKMVLDFLLQEKVLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQ 424
23 -95.2003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  21  34...TIDVQRNENFGKLRAGYLRKAHQEKNPDAKIISLGIGDTTEPLPKYIADAMAKATREGYSGYGAEQGQGALREAVASTFYGHAGRAAD---EIFISDGSKCDIA-RIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHFFPDAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCFNGASNIVQAGGLACLQPGLKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFP---GKPSWDVFAEILERCNIVTTPGSGYGPAGEGFVRASAFGSRENILEAVRRFKEAYGKRN. 441
24 -94.4002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  24  12..................VVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTTYYCLKSCTLPFLEEAARWYEGRYGVGLDPRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPL-REDGLADLKAVPEGVWR---EAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEG-EAPSPLALAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGVIDFNQYAGVLRMGVEALKTPKEVVRGYARVYRERALGMAEALKGV-LSLLPPRATMYLWGRLPE--GVDDLEFGLRLV-ERGVALAPGRGFGPGGKGFVRIALVRPLEELLEAAKRIREALD.... 376
25 -93.3003jtx_A mol:protein length:396 aminotransferase  ali model follow..  26  2........MNTLLKQLKPYPFARLHEAMQEGMEAVPLHIGEPKHPTPKVITDALTASLHEL-EKYPLTAGLPELRQACANWLKRRYGLTVDADNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFNPDWRSISEEVWK---RTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDGNKPLGCLQASRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTYHGSAMSIPVQRASIAAWDDEQH-VIDNRRLYQEKFERVIPILQQV-FDVKLPDASFYIWLKVP---DGDDLAFARNLWQKAAIQVLPGRFLGNPGEGYVRIALVADVATCVKAAEDIVSLYR.... 396
26 -91.9003ele_A mol:protein length:398 Amino Transferase  ali model follow..  26  2..MVVNESMYQLGSVRELFEYGKKRAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDALHGYTSAQGDVETRAAIAEFLNNTHGTHFNAD-NLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADTEHFQIDFDALEERINA---HTRGVIINSPNNPSGTVYSEETIKKLSDLLEKKPIFIIADEPYREIVYDGIKVPFVTK-YYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAAVCGACAPSLFQKMIVKCQGATG-----DINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVKAL---EDDSNAFCEKAK-EEDVLIVAADGFG--CPGWVRISYCVDREMIKHSMPAFEKIYKKYNK 398
27 -91.2002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  22  21...KTKVSRNSNMSKLQAGYLRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAHELSTIEGYSGYGAEQGAKPLRAAIAKTFYGGLGIG---DDDVFVSDGAKCDIS-RLQVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYMRCTPENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDD-NPRSIFEIAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCFNGASNISQAGALACLTPGLEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVWVHFP---NQSSWDVFAEILEKTHVVTTPGSGFGPGGEGFVRVSAFGHRENILEACRRFKQLYK.... 426
28 -89.6001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  19  1..MSSWDVSMSNHAGLVFNPIRTVSDPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEACNGYFPTVGSPEAREAVATWWRNSFVHKEELKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCPENDWEADLDEIRRLKDD---KTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVFKGKDFTSVADFETVPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGMLVCGPCTVVQAALGEALLNTPQEHLDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMSRIDLEKYKTDVEFFEKLLEEENVQVLPGTIFH--APGFTRLTTTRPVEVYREAVERIKAFCQRHAA 415
29 -89.1006DK6 Entity 1(prereleased)  ali follow..  21  3..LINENFLKLKAGYLFPEIARRVKAFTEGAQRLIRCGIGDVTEALPEAVRYAMHEAVDETFKGYGPEQGYDFLRNAIADNDYKARGLPIEAD-EIFISDGSKCDTGN-ILDIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENAYAGLVYLKCTPENGFVPDQEKADLIYLCYPNNPTGAVATRPQLEAWVKYARENGSVLLYDAAYEAFIQDPTIPHSIFEIARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKRRHSTKFNGASYIVQKGAEALYTDGKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPA--GLTSWQMFDKMLNEANVVITPGSGFGSAGEGYFRISAFNSRANVEEVCRRIAAL...... 410
30 -87.0003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  21  1..MKRNPHFVSLTKNADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARTCRGYGPDFGLPALRQKLSEDFYRG----FVDAKEIFISDGAKVDLF-RLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIA-LQENAFFPEFPE--------DTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTFNGASIPAQEAGVAGLSILPQ--LEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWVKPTQ-ANISDRDLFDFFLREYHIAITPGIGFGRSGSGFVRFSSLGKREDILAACERLQMAPALQS. 394
31 -86.8004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  22  35...STKLVRNVNLEKLKNNYLELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNSTVEGYRGYGLEQGNKTLRKAIAETFYRDLHVK---SNEVFVSDGAQSDIS-RLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYMPCGPNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTNGSIIIFDSAYAAFIEDG-SPRSIYEIAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSFNGASNIAQAGGLACLSGGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFK---GSKSWDVFNEILENTHIITVPGSGFGPGGEEYLRISGFGRRDHIVEASKRLQNFFNTRTK 444
32 -85.6003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  21  1.........GMTFEPYPFERLRALLKEITPKKRGLDLGIGEPQFETPKFIQDALKNHT-HSLNIYPKSAFEESLRAAQRGFFKRRFKIELKEN-ELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLKENDFTPSLNEKE------LQEVDLVILNSPNNPTGRTLSLEELISWVKLALKHDFILINDECYSEIYENT-PPPSLLEAAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAYLGYTSANAIQKASEAAWLDDRH-AEFFRNIYANNLKLARKIFKNT----LIYPYSFYVYLPVQ-----NGENFAKTLYQNEGIITLPALYLGRNGADYVRLALVYDTPLLEKPLEIIETYRENHA. 376
33 -84.4004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  20  33...RIASSKHAQRTLQPLNNLTDNMKPSRSTKSNLRLSIGDPNLKTPDIVTEAMVDVVRSGKNGYPPTVGADNLRQVVSTYWRRFCQTKSRQEENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLDSKSWECDLRAAAGMVDS---HTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQHQIPLISDEIYAEMVLNNGIFTSVADFDTVPRLILGGTAKYQVCPGWRVGWSILIDPMWAVGMERLTQLIAGVNSICQEAIARTLKCPTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMLKLNLSY-KSDMEFYEKLLDEENVQVLPGEIFG--MSGFLRATVSRPSAVLNEAVDRIIEFCERHKK 438
34 -83.9003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  18  57..LYCNIGNPQSLGQQPVTFFREVLALC-DHPDLLQREEIKTLFSAISRAKQILAMIPGRATGAYSHSQGIHGLRDAIASGIASRDGFPANAD-DIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLESTGWGLETSDVKKQLEDRGINVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLADEVYQENIYVDKKFHSFKKIVRPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNIPKASDESYASYKAEKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFPQICLPQKAPDAFYALRLLESTGIVVVPGSGFGQVGTWHFRCTILPQEDKIPAVISRFTVFHEAFMS 486
35 -83.1003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  20  72GIMAGYINTDGIRERLFAFLDPDKNDEDKFLIDAVNYCHTELGLNRDKVVAEWVNGAVANN--YPVPDRCLVNTEKIINYFLQELKDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLHKNDWEIEPNEIEKLKDP---SIKALIVVNPTNPTSKEFDTNALNAIKQAVEKNKLMIISDEVYGAFVPNFK---SIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLDKVELRQLHKRYSSVDRLCADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLIDIYRLAEKEQVDFLLKLAEKNGVVLVDGVGFG-AKPGELRVSQANLPTEYALIGKQVLELLKEYYE 527
36 -82.6003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  17  10..LIREKQNELHIKDLGMASIRDLVALVATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVASYPNLDGLPELKQEASRFAKLFVNIDIPAR-ACVPTVGSMQGCFVSFLVAKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLEYRGEKLREKLESYLQTG---QFCSIIYSNPNNPTWQCMTDEELRIIGELATKHDVIVIEDLAYFGMDFRKDEPLYQPSVYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPALYALSSGATHSAQWGMAAMLKACNDNFRDSVIEYGRKARIMKKMFLDNGFDGNEPLADGFYFTVGYK--GMDSSKLIEKFVRYGMCAITLK-TTGSKRNEAMRICTSLLPESFPDLEKRLQMLNAE... 436
37 -82.6003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  19  21....RPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDPNLPTDPEVTQAMKDALDSGKNGYAPSIGFLSSREEIASYYHCP-EAPLEAK-DVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLPEKSWEIDLKQLEYLIDE---KTACLIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDMVFSDCKYEPLATLTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDQRILGPCTIVQGALKSILRTPGEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMVGIEMEH-ENDVEFTERLVAEQSVHCLPATCFE--YPNFIRVVITVPEVMMLEACSRIQEFCEQHYH 420
38 -82.3003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  19  51GIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPLDSPSFPEDAKKRRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLEENCWALNVNELRRAVQEAKDDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRHSFKKVLYEELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFAKKAKLTEDLFNQVGIHCNPLQGAMYAFPRIFIPAKAPDMFYCMKLLEETGICVVPGSGFGREGTYHFRMTILPPVEKLKTVLQKVKDFHINFLE 489
39 -81.7004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  20  11...RGSHMSSLRPRREDPPVLEEWYRLGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVVMDDSVSQGGEGVRRAIADRYAG-------DADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRVRDGEIDPDVLAGLVTP---GTAAVIVNFPHNPTGVTLSPQGLRALKERTAATGAVLVWDAATAEIAHRWEVLADPGA-DGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDRTTLFLSPLVELVAERAVRHADELIGARAAEARHNLAHLTGWMAAHEVRWTPPEGGVCALPVFRELERQEVERFCLELLERHRTLLVPGTAFG--APHGARLGFGGPQEDFRAGLDGLSRFLRERAA 398
40 -81.4003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  19  4....RPSDMSNKTFNPIRAIVDNMKVKPNPNKTVISLSIGDPNLPTDPEVTQAMKDALDSGKNGYAPSIGYLSSREEVASYYHCP-EAPLEAK-DVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLPEKSWEIDLKQLESLIDE---KTACLVVNNPSNPCGSVFSKRHLQKILAVAERQCVPILADEIYGDMVFSDCKYEPMATLTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEILSQRILGPCTIVQGALKSILQTPQEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMVGIEMEH-ENDVEFTERLIAEQSVHCLPATCFE--YPNFFRVVITVPEVMMLEACSRIQEFCEQ... 400
41 -80.4001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  21  2......RMLSRNATFNSHGQDSSYFHEVHNTNGIIQMGLAENAKNPEAAAFKKNGESIFAELALFQDYHGLPAFKKAMVDFMAEIRGNKVTFDNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWTGVEIVPIHCTSNGFQITETALEEAYQERNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFISVMEVVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSGLVSSQTQHLLSAMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLREAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERLDLAMQRLKAFVGEYYN 434
42 -78.0003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  22  1.....GMKLPRFGVEEWLNVHENSAIYDIAGVSISSLTLEEL-FALSGTNPEDFYKKLQGTKLNYGWIEGSPAFKKSVSQLYTG-------KPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEENGWLPDLEKLRQLIRP---TTKMICINNANNPTGAVMDRTYLEELVEIASEVGAYILSDEVYRSFSELDVPSII----VYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDYTMICAGVFDDLVAQLALAHYQEILERNRHILEENLAILDQWIEEELVSYIRPAVVSTSFVKIAV--DMPMEDFCLQLLQEHGVLLVPGNRFE--RDGYVRLGFACEQETLIKGLEKLSQFLRRFDK 373
43 -77.0006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  12  9..VPRGSHMHPQATPAPGAPLLDLTQHETMKYNLADAHTHQRQSASQQSIVSRLPQLWYEA-EEGLQATYEKRFTEAFFQLHRQPTAL---VKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPID-ESVFYDVDRIYPELERRV---RTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDHDKLLLIDFCFASFTLFEPELYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSVLLNVSPFVLNMLTQYVRSAADRLASVREVLTRNRECARKTLDGSILEYQEPVVKSVAWFRVDH--PELTATDVHRLLSADGVYVLPGRYFPSKGDAYVRMALAREPEMFADAMALTRQVLDRHGR 407
44 -76.4002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  16  91..................IAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSENLFAVEGGTAAMALKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINSLNWQYPDSELDKLKDP---AIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADDFQ---SLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKVALDHRYRSLLPDVRSLKFIDHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLIDLQDVTAKSTGDMLFRIADETGIVLLPGRGFG-SNRPSGRASLANLNEYEYAAIGRALRKMAD... 520
45 -76.2003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  15  91..................IAENRDQEGVRFLGKSLSYVRDQLGLDPAAFLHEMVDGIL--GCNYPVPPRMLNISEKIVRQYIIREMGADAIPSENLFAVEGGTAAMAMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINALNWQYPDSELDKLKDP---AIKIFFCVNPSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADGFQ---SLFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKTALDDRYRSLLPDVRSLKFLDRLLKQLIRRREATLYRELGTPPQRDENAVDYYTLIDLQDVTSKSTGDMLFRIADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRLRQMADELYA 524
46 -75.1005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  12  6.....................QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELPVLWAESEQRPEAHQAYFTLLGQ-HGYPAEPG-RVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDA----LHGADLSAELLS---SVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEHGTVLALDTSFRGFDAAAHDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDILLGVSPLILALIREFSDAADGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVER---AFAGRTGTEVWE-ELQRHHVFALPCRQFHSDGDHMVRIALSRSTEPLEKSVQVLRTVLET... 375
47 -74.8001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  19  7..TNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLNPKGSICSEGIKSF-KAIANFQDYHGLPEFRKAIAKFMEKTRGGRVRFDERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRTGQLIPIHCESNNFKITSKAVKEAYEKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFVSIAEILKDLVHIVYSLSKDMGLPGFRVGIIYSFDDVVNCARKMSSFGVSTQTQYFLAAMLSDEKFVDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWMDLRPLLRDSEMSLWRVIINDVKLNVSPGSSFECQEPGWFRVCFANMDDGVDIALARIRRFVGVEK. 428
48 -74.7002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  15  64..LSYSYMTVGVGGLAKLDGIERDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILG---CNYPVPPRMLTVSEQIVRQYIVREMAGGAVPVDLFAVEGGTAAMALRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHDNGWQYSDAELDKLKDP---DVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADE---FQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESA------KKALDHRYRSLLPDVRSLKFIDRLVADSRVVALNHTGLSTPQQVQNYYTLIDLQNVTCRSTGDMLFRVADETGIVLLPGRGFG-SDRPSGRASLANLNEYEYAAIGRALRRLAD... 519
49 -72.5003if2_A mol:protein length:444 Aminotransferase  ali model follow..  20  2..MKFSKFGQKFTQPTGISQLMDLGDALKSDQPVNMLGGGNPAKIDADNDTGKANSSAIISMANYSNPQGDSAFIDALVGFFNRHYDWNLTSE-NIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEKYRVDFEALENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRYDIPLIIDNAYGMPFPNIIYSDAHLN-WDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLAPTRFGAAIATPLVANDQLSDNEIKPFYQKQATLAVKLLKQAPLMIHKPEGAIFLWLWFKD-LPISTLDLYERLKAK-GTLIVPSEYFFPGAHECIRMSIAADEQTLIDGIKVIGEVVRELYD 442
50 -72.2003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  17  2..MTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAHIPADYFQTLLTDMVESGKCNYDGPQGKTALLNALAVLLRETLGWDIEPQ-NIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFVSAPEGQFKYHVDFEHLHIGE---ETGMICVSRPTNPTGNVITDEELMKLDRLANQHNIPLVIDNAYGVP-FPGIIFSEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLAPGGMGPAMMCEMIKRNRLSETVIKPFYYQRVQQTIAIIRRYRCLIHKPEGAIFLWLWFKDL--PITTELLYQRLKARGVLMVPGHYFFPGTHQCMRMNYVPEPDKIEAGVKILAEEIERAWR 415
51 -70.2002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  18  1GAMNLAQSLNEQLQQSNATAFAMLSDLAEAKSTTYNATIGMATNKDGKSLDAMFNDLTPDEIFPYAPPQGIEELRDLWQQKMLRDNELSIDNMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLTYPIFDKDGHYTTDSLVEALQSYNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKATKVIAVVDDAYYGLFYEDVYTQSLFTALTNLPIRLDGATKEFFAWGFRVGFMTFGEVLEAKVKGLIRSNISSGPLPTQSAVKHVLKNNKQNIQTLKERYEVTKEVVYADQYHSHWQAYDFNSGYFMAIKVH---DVDPEALRKHLIDKYSIGVIALNATD------IRIAFSCEKDDIPHVFDSIAKAIDDLR. 430
52 -65.7003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  16  7..VAAKHAKGKKLKDFVTAGQAQADAKENGRENVVNGTLGEGNLVFLKTVKEEYLSLSDSEHVGYAPIAGIPDFLCAAEKECFGNFRP--EGHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLFDEHNNFNHEAFQNRVNEAKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNNVIIGIDVAYLDYSGEKDEVRAFFNKFSHLTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVTWSNICRPAMRTMANIVADPEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTD-----SANAICEELKKEHIYVIALANGIRIAACGIPKCQMTGLAEKIYNAMKSLGKL...... 418
53 -64.2001ay4_A mol:protein length:394 AROMATIC AMINO ACID AMINOTRANSFERASE  ali model follow..  14  1........MLGNLKPQAPDKILALMGEFRARQGKIDLGVGVYDATGHTPIMRAVHAAEQETTKTYAGLSGEPEFQKAMGELILGDGLKSETTATLATVGGTGALRQALELARMANPDLRVFVSDPTWPNHVSIMNFMGLPVQTYRYDAETRGVDFEGMKADLAAAKKGDMVLLHGCCHNPTGANLTLDQWAEIASILEKTGALPLIDLAYQGFGDGLEEDAAGTRLIASEVLIAASCSKNFGIYRERTGCLLALCADAATRELAQGAMASFPPFHGAKIVSTVLTTPELRADWMAELEAVRSGMLRLREQLAELRDLSGSDRFGFVAEHRGMFSRLTPEQVKRIKEEFGIYMVGDS----------RINIAGNDNTIPILARAIIEVG..... 393
54 -64.1004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  16  2..NAMPMTIKRATWNNGPDLAFDINNKANAREAVINAALGTLLDDKGKSVYDRLDEMDRSHIASYAPIEGEKDYRKIVIDTLFGPYKPEG--YISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFFTDDFAFNIDVYKEAIDERDSDRIASLINSPNNPTGYSLSDEEWDEVITFLKEKKITLIVDVAYLEFAGDGDQQRKFFEKFSNFVVVAFSMSKSHTAYGLRSGAAVGIKEIIEEFEASLAHSARCNWSNGTHAAQNILIE-EQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPT------DKAFDIVKDLEKENIFTIPSAKGI-------RVAICVGEEKIPKLVQRLAFYTNK... 412
55 -64.0005ax8_A mol:protein length:407 Aspartate aminotransferase, mitochondrial  ali model follow..  15  1......SSWWTHVEMGPPDPILGVTEAFKRNSKKMNLGVGAYRDDLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKGMADRIIGMRTQLVNLKKEGSTHNWQHITDQIGMFCFTKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLA--HAIHQVTK........... 401
56 -63.3003fsl_A mol:protein length:397 Aromatic-amino-acid aminotransferase  ali model follow..  14  1........MFQKVDAYAGDPILTLMERFKESIGLYYNEDGIIPQLQAVAEAEARLNAQPHGASLYLPMEGLNCYRHAIAPLLFGADHPVLKQQRATIQTLGGSGALKVGFLKRYFPESGVWVSDPTWENHVAIFAGAGFEVSTYPWDEATNGVRFNDLLATLKTLQAGSIVLLHPCCHNPTGADLTNDQWDAVIEILKARELIPFLDIAYQGFGAGMEEDAYAIRAIASPALVSNSFSKIFSLYGERVGGLSVMCEDAEAAGRVLGQNYSSPPNFGAQVVAAVLNDEALKASWLKEVEEMRTRILAMRQELVVLSTEMPERNFDYLLNQRGMFSYTSAAQVDRLREEFGVYLIASG----------RMCVAGNTANVQRVAKAFAAVM..... 397
57 -62.4004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  14  2.......AMFEHIDAYPGDPILTLNENFQKRDQKVNLSIGIYDAEGRIPVMGAVREARDSGPKPYLPMVGLAAYRDAVQSLVFGADHPARAAGRIATLGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYDEATGGLKFDAMLAAIDALPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEARELLPFVDMAYQGFGAGLDADAFAVRELARPTLVANSFSKNFSLYGERVGGLSVVERVLGQLAGAVRSNYSNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIHGLRDHVSGEALTRYVKQRGMFTYTTESQVDALREVHGVYILRSG----------RMCVAGNDSNVGIVADAIGKVLKSGA. 402
58 -62.4003hlm_A mol:protein length:401 Aspartate aminotransferase, mitochondrial  ali model follow..  16  1......SSWWTHVEMGPPDPILGVTEAFKRNSKKMNLGVGAYRDDNGKPYKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENNEVLKSGRQTISGTGALRVGASFLQRFFKFSRDVFLPKPSWGNHTPIFRDAGMQLQGYRYDPKTCGFDFSGALEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIASVVKKKNLFAFFDMAYQGFASGDGDKDAWA--QGINVCLCQSYAKNMGLYGERVGAFTVVKRVESQLKILIRPLYSNPPLNGARIAATILTSPDLRKQWLQEVKGMADRIISMRTQLVNLKKEGSSHNWQHITDQIGMFCFTKPEQVERLTKEFSVYMTKDGRISVAGVTSGNVGYLA--HAIHQVTK........... 401
59 -62.1003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  13  1........MFENITAAPADPILGLADLFRARPGKINLGQGVYKDETGKSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAQQGFARGLEEDAEGLRAFAAELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKG-----ANRDFSFIIKQNGMFSFSTKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL..... 396
60 -62.0004eu1_A mol:protein length:409 Mitochondrial aspartate aminotransferase  ali model follow..  14  5...TLEAQTQGPGSMGKPDPILGLGQDFRMAKRKVNLSIGVYDDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGRQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYDPATKGLNLAGMLECLDKAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFV--MVPNLIVAQSFSKNFGLYGHRCGALHISTASAEEAKRLVSQLANNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGMMAYTTREQVELLRSEYHIYMTLNGRAAVSGLNSTNVEYVS--QAIHNVTK........... 403
61 -61.9001tog_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  14  1........MFENITATTADPILGLADLFRARPGKIDLGIGYKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKTAQTPGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAELIVASSYSKNFALYNERVGACTLVDRAFGQMKAAIRDNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMFSFSTKEQVLRLREEFGVYAVASGRVNVAG---------MTPDNMAPLCEAIVAVL..... 396
62 -61.8002d64_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  14  1........MFENITTAPADPILGLADLLRARPGKIDLGMGVYNDETGKTPVLTSVKKANETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPGWPTHKSVFNSAGLEVREYAYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFTIKQNGMFFFGTKEQVLRLREEFGVYAVASGRLNVAGMTPDNLAPLC--EAIVAVL............ 396
63 -61.6004f5m_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  13  1....MAVGTFENITAAPADPILGLADLFRARPGKINLGIGVKDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSNPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKGARDFSFIIKQNGMFSFSGL----TKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL............ 400
64 -61.4003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  15  2............VKLENSRKPEKISNNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIDLMSYFSDMTNPELEDAIKDLHGVVGNAATEDR-YIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEGDAWGFD-------------KKGPYIELVTSPNNPDGTI-----RETVVNRPDDDEAKVIHDFAYYWPHYTP------ITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKVAKKMVEYIIVNSIGVSKESQVRTAKILNESENFFKYGREMMKNRWEKLREVVKESDFTLPKYPEAFCNYFGKSAWLGTKEETDLVSELRRHKVMSRAGERCGS-DKKHVRVSMLSREDVFNVFLERLANMKLIKSI 389
65 -61.3004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  12  1............MAMGKPDPILGLGQDFRMAKRKVNLSIGVYDDADQPFVLECVKQATLGTNMDYAPVTGIASFVEEAQKLCFGPTCAALRDGRQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYDPATKGLNLAGMLECLDKAPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRRNHIPFVDMAYQGFATGQLDYDAFV--MVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLASNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLVELKACGSVHDWSHIERQVGMMAYTTREQVELLRSEYHIYMTLNG----------RAAVSLNSTNVEYVSQAIHNVTK.... 390
66 -61.1004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  14  15.....SMSLFSAVELAPRDPILGLNEAFNARPTKVNLGVGVYTNEDGKIPLLRAVRVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVALGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYDAKTNGVNFDGMLAALNGYEPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKARRLVPFLDIAYQGFGESIEADAAAVRLFAANVFVSSSFSKSFSLYGERVGALSIIARVLSQLKRVIRTNYSNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLVRLKAAGIERDFSFINAQRGMFSYSTSAQVDRLREEFGIYAVSTG----------RICVALNTRNLDVVANAIAAVLK.... 414
67 -61.1003ii0_A mol:protein length:422 Aspartate aminotransferase, cytoplasmic  ali model follow..  12  1...............MQPVLVFKLTADFREGVGAYRTDDCHPWVLPVVKKVEQKIANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKGGTGALRIGADFLARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWA--EGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMESNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRRLEALKTPGTWNHITDQIGMFSFTNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATVTKIAENLYFQSDYKDDDDK 416
68 -61.0001ahe_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  14  1........MFENITAAPADPILGLADLFRARPGKINLGIGLYYDETGKIPVLTSVKKAEQTTKLYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAGGSGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRANYSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMFSFSTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL............ 396
69 -60.5002d61_A mol:protein length:396 Aspartate aminotransferase  ali model follow..  14  1........MFENITTAPADPILGLADLLRARPGKIDLGMGVYDETGKTPVLTSVKKAENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAIRVNYSSPPAHGASVVATILSNDAQELTDMRQRIQRMRQLFVNTLQEKG-----ANRDFSFIIKQNGMFSFSTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLC--EAIVAVL............ 396
70 -58.2001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  14  8.....AAEEAEAVANINCSEHGRADCSEKIQGCSADVASGDGLFLEEYWKQHKEASAVRMSYFFNPVSNFIFELEKTIKELHEVVGNAAAKDR-YIVFGVGVTQLIHGLVISLDAPESKVVAHAPFYPVFREQTKY-------FDKKGYVWAGNAANYVNVSNP---EQYIEMVTSPNNPEGLLRH----------AVIKGCKSIYDMVYYWPHYTP------IKYKADEDILLFTMSKFTGHSGSRFGWALIKESVYNNLLNYMTKNTEGTPRETQLRSLKVLKEVVAMVKTGFKKLRERWVNITALLDQSDFSYQELPQSEYCNYFRRMRCEWEEDKDCYQTFQNGRINTQNGVGFE-ASSRYVRLSLIKTQDDFDQLMYYLKDMVKAKRK 427
71 -56.9001g7x_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  13  1........MFENITAAPADPILGLADLFRARPGKINLGIGVYDETGKTPVLTSVKKAEQETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRARTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHAPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAELIVASSYSKNFGLYNERVGACTLVDRAFSQMKAAILANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFIIKQNGMFSFSTKEQVLRLREEFGVYAVASG----------LVNVAGTPDNMAPLCEAIVAVL..... 396
72 -56.1004f5h_A mol:protein length:406 Aspartate aminotransferase  ali model follow..  14  1....MAVGTFENITAAPADPILGLADLFRARPGKVDLGIGYKDETGKTPVMTSVKKAENETTKTYLGLDGLPEFGRCTQELLFGKGSALINDKRARTAQTSGALRVAADFLAKNTSVKRVWVSNPSWPNHKAIFNSAGLEVREYAYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGADPTLEQWQTLAQLSVEKGWLPLIDFAYQGFGRGLEEDAEGLRAFAAELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKSSPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRLRQLFVTLQEKGANRDFSFIIKQNGMFSFSTKEQVLRLREEFGVYAVASG----------RVNVAMTPDNMAPLCEAIVAVL..... 400
73 -55.3003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  20  22..............................GQGVLPLWVAESDFSTCPAVLQAITDAVQREAFGYQPDG--SLLSQATAEFYADRYGYQARPE-WIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT---GGINLHDVEKGFQA---GARSILLCNPYNPLGMVFAPEWLNELCDLAHRYDARVLVDEIHAPLVFDGQVAAGVSDTAASVCITITAPSKAWNIAGLKCAQIIFSPSDAEHWQQLSPVIKDGASTLGLIAAEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPK-GAKITPMQATYLMWIDFRDT----EGSPSEFFIEKAKVAMNDGAWFGEDGTGFCRLNFATSREVLEEAIDRMAKAVSHHT. 377
74 -55.1002zc0_A mol:protein length:407 Alanine glyoxylate transaminase  ali model follow..  25  1..MDYTKYLAGRANWIKGSALADVMKKASEGVKLISLAAGDPDPEL-AVLGEIAKEVLEKEPKMYTPANGIPELREELAAFLKKYDHLEVSPE-NIVITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAKIEGVPVDNDGMRVDLEEKIKELKAKGQKVKLITIPTGQNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVPLKALDNERVIVAGTLSKVLG-TGFRIGWIIAEGEILKKVLMQKQPIDFCAPAISQYIALEYLKRGKYHLEGALLGYKEKRDIMLKALEN-NAEFTKPIAGMFVMFFLPE--GADGISFANELMEREGVVVVPGKPFDESGKNAIRLNFSPSKEEIPIGIKKLAKLYKEK.. 404
75 -55.0001czc_A mol:protein length:396 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  13  1........MFENITTAPADPILGLADLLRARPGKIDLGMGTGKTPVLTSVKKAEQYLLENETTKYLGIDGIPEFGRCTQELLFGKGSALINDKRAQTPGGTGALRVAADFLAKNTSVRRVWVSNPSWPNHKSVFNSAGLEVREYAYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAELIVASSYSKNFGLYNERVGTCTLVAADSETVDRAFSQNYSSPPAHGASVVATILGNDALRAIWEQELTDMRQRIQRMRQLFVTLQEKGANRDFSFTIKQNGMFFFGTKEQVLRLREEFGVYAVASG----------RLNVAMTPDNLAPLCEAIVAVL..... 396

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24