current user: public

If you have questions about the server, please let us know.

Query: 4n0w_A mol:protein length:424 Serine hydroxymethyltransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst MASMFDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDAATIERVRAQVAELTKRFPVYRLast
1 -120.0004n0w_A mol:protein length:424 Serine hydroxymethyltransferase  ali model  100  1MASMFDRAQSTIANVDPEIFAAIEQENRRQEDHIELIASENYTSPAVMAAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGMSLAHGGHLTHGSPVNMSGKWFNVVSYGLNENEDIDYDAAEKLANEHKPKLIVAGASAFALKIDFERLAKIAKSVGAYLMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVILMKAEYEKPINSAIFPGIQGGPLMHVIAAKAVAFKEALSPEFKEYQQKVVENARVLAETLVKRGLRIVSGRTESHVMLVDLRAKHITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGIRLGSPAMTTRGFGPAEAEQVGNLIADVLENPEDAATIERVRAQVAELTKRFPVYR 418
2 -115.0003pgy_A mol:protein length:415 Serine hydroxymethyltransferase  ali model follow..  61  1.....SNAMSYITKQDKVIAEAIEREFQRQNSNIELIASENFVSEAVMEAQGSVLTNKYAEGYPGRRYYGGCEFVDVTESIAIDRAKALFGAEHVNVQPHSGPQANMAVYLVALEMGDTVLGMNLSHGGHLTHGAPVNFSGKFYNFVEYGVDDTERINYDEVRKLALEHKPKLIVAGASAYSRTIDFKKFKEIADEVNAKLMVDMAHIAGLVAAGLHPNPVEYADFVTTTTHKTLRGPRGGMILCKEEYKKDIDKTIFPGIQGGPLEHVIAAKAVAFGEALENNFKTYQQQVVKNAKVLAEALINEGFRIVSGGTDNHLVAVDVKGSILTGKEAEETLDSVGITCNKNTIPFDQEKPFVTSGIRLGTPAATTRGFDEKAFEEVAKIISLALKNSKDEEKLQQAKERVAKLTAEYPLYQ 415
3 -114.0001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  60  1........MKYLPQQDPQVFAAIEQERKRQHAKIELIASENFVSRAVMEAQGSVLTNKYAEGYPGRRYYGGCEYVDIVEELARERAKQLFGAEHANVQPHSGAQANMAVYFTVLEHGDTVLGMNLSHGGHLTHGSPVNFSGVQYNFVAYGVDETHVIDYDDVREKARLHRPKLIVAAASAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAGLHPNPVPYAHFVTTTTHKTLRGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDFKAYAKRVVDNAKRLASALQNEGFTLVSGGTDNHLLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESPFVTSGIRIGTAAVTTRGFGLEEMDEIAAIIGLVLKNVGSEQALEEARQRVAALTDPTSRSA 411
4 -113.0001dfo_A mol:protein length:417 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  64  5........EMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDIVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLEPGDTVLGMNLAHGGHLTHGSPVNFSGKLYNIVPYGIDATGHIDYADLEKQAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLVAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGELYKKLNSAVFPGGQGGPLMHVIAGKAVALKEAMEPEFKTYQQQVAKNAKAMVEVFLERGYKVVSGGTDNHLFLVDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRVGTPAITRRGFKEAEAKELAGWMCDVLDSINDEAVIERIKGKVLDICARYPVYA 417
5 -113.0005vc2_A mol:protein length:424 Serine hydroxymethyltransferase  ali model follow..  52  2......AMAYFLEQTDSEIFELIFEEYKRQNEHLEMIASENYTFPSVMEAMGSILTNKYAEGYPNKRYYGGCEVVDKIESLAIERAKKLFNCQFANVQAHSGSQANNAVYHALLKPYDKILGMDLSCGGHLTHGAKVSLTGKHYQSFSYGVNLDGYIDYEEALKIAQSVKPEIIVCGFSAYPREIDFKKFREIADEVGALLLGDIAHVAGLVVTNEHAHPFPHCHVVSSTTHKTLRGPRGGIILTNDEEIAAKIDAIFPGTQGGPLMHVIAAKAVGFKENLKPEFKAYAKLVKSNMQVLAKALKEKNHKLVSGGTSNHLLLMDFLDKPYSGKDADIALGNAGITVNKNTIPGETRSPFVTSGIRIGSAALSARGMGAKEFEIIGNKISDILNDINNVSLQLHVKEELKAMANQFPVY. 413
6 -112.0003ecd_A mol:protein length:425 Serine hydroxymethyltransferase 2  ali model follow..  57  2MSNANPFFSQSLAERDASVRGAILKELERQQSQVELIASENIVSRAVLDAQGSVLTNKYAEGYPGKRYYGGCEFADEVEALAIERVKRLFNAGHANVQPHSGAQANGAVMLALAKPGDTVLGMSLDAGGHLTHGAKPALSGKWFNALQYGVSDTMLIDYDQVEALAQQHKPSLIIAGFSAYPRKLDFARFRAIADSVGAKLMVDMAHIAGVIAAGRHANPVEHAHVVTSTTHKTLRGPRGGFVLTNDEEIAKKINAVFPGLQGGPLMHVIAGKAVAFGEALTDDFKTYIDRVLANAQALGDVLKAGGVDLVTGGTDNHLLLVDLRPKGLKGAQVEQALERAGITCNKNGIPFDPEKPTITSGIRLGTPAGTTRGFGAAEFREVGRLILEVFEALRTHATEQRVRREIFALCERFPIY. 425
7 -112.0005vmb_A mol:protein length:425 Serine hydroxymethyltransferase  ali model follow..  62  1MAMFAN---ISISEFDPELAQAIASEDERQEAHIELIASENYCSPAVMEAQGSKLTNKYAEGYPGKRYYGGCEFVDVIEQMAIDRAKELFGADYANVQPHAGSQANSAVYLALLNPGDTVLGMSLAHGGHLTHGAKVSFSGKTYNAVQYGLNETGEIDYEEVERLALEHKPRMIVAGFSAYSRVVDWQRFRDIADKVGAYLFVDMAHVAGLVAAGVYPNPVQIADVTTTTTHKTLRGPRSGLILAKANEEIEKKSAVFPGNQGGPLMHAIAAKAICFKEAMSDDFKAYQQQVVKNAQAMAEVFIARGYDVVSGGTDNHLFLLSLIKQDVTGKDADAWLGAAHITVNKNSVPNDPRSPFVTSGIRIGTPAVTTRGFGEAEVRELAGWIADVIDSKGDEKVIADVKAKVEAVCAKFPVY. 417
8 -112.0003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  51  10.TQGPGSMSAPLAEVDPDIAELLAKELGRQRDTLEMIASENFVPRAVLQAQGSVLTNKYAEGLPGRRYYGGCEHVDVVENLARDRAKALFGAEFANVQPHSGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYENGFYGVDATHLIDMDAVRATALEFRPKVIIAGWSAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAGLHPSPVPHADVVSTTVHKTLGGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEFADRQRRTLSGARIIADRLMAPDVAKVSGGTDVHLVLVDLRDSPLDGQAAEDLLHEVGITVNRNAVPNDPRPPMVTSGLRIGTPALATRGFGDTEFTEVADIIATALATGSSVD-VSALKDRATRLARAFPLY. 430
9 -112.0003n0l_A mol:protein length:417 Serine hydroxymethyltransferase  ali model follow..  52  2.......NAMSLEMFDKEIFDLTNKELERQCEGLEMIASENFTLPEVMEVMGSILTNKYAEGYPGKRYYGGCEFVDEIETLAIERCKKLFNCKFANVQPNSGSQANQGVYAALINPGDKILGMDLSHGGHLTHGAKVSSSGKMYESCFYGVELDGRIDYEKVREIAKKEKPKLIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAGEHPSPFPYAHVVSSTTHKTLRGPRGGIIMTNDEELAKKISAIFPGIQGGPLMHVIAAKAVGFKFNLSDEWKVYAKQVRTNAQVLANVLMDRKFKLVSDGTDNHLVLMSFLDREFSGKDADLALGNAGITANKNTVPGEIRSPFITSGLRLGTPALTARGFKEKEMEIVSNYIADILDDVNNEKLQENIKQELKKLASNFIIYE 413
10 -111.0004wxb_A mol:protein length:428 Serine hydroxymethyltransferase  ali model follow..  55  4.SGSMIFDKEDYKAFDPELWNAIDAEAERQQNNIELIASENVVSKAVMAAQGTLLTNKYAEGYPGKRYYGGTAVIDVVETLAIERAKKLFGAKFANVQPHSGSQANAAVYMSLIQPGDTVMGMDLSAGGHLTHGAPVSFSGKTYNFVSYNVDESELLDYDAILAQAKEVRPKLIVAGASAYSRIIDFAKFREIADAVGAYLMVDMAHIAGLVASGHHPSPVPYAHVTTTTTHKTLRGPRGGLILTDDEDIAKKLNAVFPGLQGGPLEHVIAAKAVALKEALDPAFKEYGENVIKNAAAMADVFNQHPDFRVSGGTNNHLFLVDVTKVVENGKVAQNVLEEVNITLNKNSIPYEQLSPFKTSGIRVGSPAITSRGMGEAESRQIAEWMVEALENHDKPEVLERIRGDVKVLTDAFPLY. 422
11 -111.0004j5u_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  56  1....MNIFNNNLHETDKEINEIIKHEKLRQSSVIELIASENFVSPAVLEAQGALLTNKYAEGYPSKRFYNGCEEVDKAENLAIERVKKLFNCKYANVQPHSGSQANQAVYLALLQPGDTVLGMSLDSGGHLTHGAAPNMSGKWFNAVSYSVNETYLIDYDEIERLADLHKPKLLIAGFSAYPRNIDFAKFREIVDKVGAYFMADIAHIAGLVATGEHQSPIPYAHAVTSTTHKTLRGPRGGLILSNDEEIGHKISALFPGLQGGPLMHIIAAKAVAFLENLQPEYKSYIQQVISNAKALASSLQERGYDILTGGTDNHIVLVDLRKDGITGKLAANSLDRAGITCNKNAIPFDETSPFITSGIRLGTPACTTRGFKEKDFVLVGHMVADILDGLKNNALEQQVLNEVTKLIELFPFY. 419
12 -110.0003gbx_A mol:protein length:420 Serine hydroxymethyltransferase  ali model follow..  65  1.SNAMLKREMNIADYDAELWQAMEQEKVRQEEHIELIASENYTSPRVMQAQGSQLTNKYAEGYPGKRYYGGCEYVDVVEQLAIDRAKELFGADYANVQPHSGSQANFAVYTALLQPGDTVLGMNLAQGGHLTHGSPVNFSGKLYNIVPYGIDESGKIDYDEMAKLAKEHKPKMIIGGFSAYSGVVDWAKMREIADSIGAYLFVDMAHVAGLIAAGVYPNPVPHAHVVTTTTHKTLAGPRGGLILAKGGDEKKLNSAVFPSAQGGPLMHVIAGKAVALKEAMEPEFKVYQQQVAKNAKAMVEVFLNRGYKVVSGGTENHLFLLDLVDKNLTGKEADAALGRANITVNKNSVPNDPKSPFVTSGIRIGSPAVTRRGFKEAEVKELAGWMCDVLDNINDEATIERVKAKVLDICARFPVY. 419
13 -108.0002dkj_A mol:protein length:407 serine hydroxymethyltransferase  ali model follow..  58  1........MVSTLKRDEALFELIALEEKRQREGLELIASENFVSKQVREAVGSVLTNKYAEGYPGARYYGGCEVIDRVESLAIERAKALFGAAWANVQPHSGSQANMAVYMALMEPGDTLMGMDLAAGGHLTHGSRVNFSGKLYKVVSYGVRDTELIDLEEVRRLALEHRPKVIVAGASAYPRFWDFKAFREIADEVGAYLVVDMAHFAGLVAAGLHPNPLPYAHVVTSTTHKTLRGPRGGLILSNDPELGKRIDLIFPGIQGGPLEHVIAGKAVAFFEALQPEFKEYSRLVVENAKRLAEELARRGYRIVTGGTDNHLFLVDLRPKGLTGKEAEERLDAVGITVNKNAIPFDPKPPRVTSGIRIGTPAITTRGFTPEEMPLVAELIDRALLEGPS----EALREEVRRLALAHPM.. 406
14 -107.0004p3m_A mol:protein length:429 Serine hydroxymethyltransferase  ali model follow..  62  1....MFNRDMNIADYDPELWQSITDEVQRQEDHIELIASENYTSPRVMEAQGSQLTNKYAEGYPGKRYYGGCEYVDVAESLAIERAKSLFGADYANVQPHSGSQANAAVYQALCAPGDTILGMSLAHGGHLTHGSHVSFSGKMYNAVQYGITETGILDYAEIERLAVEHKPTMIIAGFSAYSGIVDWAKFREIADKVGAYLFVDMAHVAGLVAAGLYPNPVPFADVVTTTTHKTLGGPRGGLILAKANEAKKLNSAVFPGQQGGPLMHVIAAKAVAFKECAEPEFAVYQQQVLDNAKAMVKSFLARGYKIVSGGTENHLFLVDLIAQDITGKEADAALGNAHITVNKNSVPNDPRSPFVTSGLRIGTPALARRGVNAQQSAELALWMCDVLDAIKDETTITAVKVKVAALCKACPVY. 420
15 -105.0005x3v_A mol:protein length:496 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  42  17EANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNRYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDR-SAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVKSLANLRQRVEQFARAFPMP. 478
16 -105.0001eji_A mol:protein length:478 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  43  9WASHEKMLSQPLKDSDAEVYSIIKKESNRQRVGLELIASENFASRAVLEALGSSLNNKYSEGYPGQRYYGGTEFIDELEMLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTDKKKISATSIFFESPETGYINYDQLEENASLFHPKLIIAGTSCYSRNLDYARLRKIADDNGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVRSLINSAVFPGLQGGPHNHAIAGVAVALKQAMTTEFKIYQLQVLANCRALSDALTELGYKIVTGGSDNHLILMDLRSKGTDGGRAEKVLEACSIACNKNTCPGDK-SALRPSGLRLGTPALTSRGLLEEDFQKVAHFIHRGIELTLQIQSVATLREEVENFASNFSL.. 472
17 -104.0005z0y_A mol:protein length:470 Serine hydroxymethyltransferase  ali model follow..  44  1MSHYAQMVEGHLAETDPEVNQIIKDEVDRQKHSIVLIASENFTSTSVFDALGTPMCNKYSEGYPGARYYGGNEHIDRMEILCQQRALKAFHLDGVNVQTLSGSPANLQVYQAIMKPHDRLMGLDLPHGGHLSHGYQTSAVSTYFETMPYRVDETGIIDYDMLEKTAVLYRPKVLVAGTSAYCRLIDYKRMREIADKVGAYLVVDMAHISGLIAAGVIPSPFEYADIVTTTTHKSLRGPRGAMIFFRKDLENPINFSVFPGHQGGPHNHTIAALATALKQAATPEFKQYQEQVLKNAKALENEFKRLGYKLVSDGTDSHMVLVSLKDKDIDGARIETVCENINIALNKNSIPGDR-SALVPGGVRIGAPAMTTRGASEEDFVKIANYIDKSVQYAKKSDEITQLKNEISAWAGEFPLS. 469
18 -104.0006fl5_A mol:protein length:471 Serine hydroxymethyltransferase, cytosolic  ali model follow..  44  5WSSHDKMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPNGAIMGLDLPDGGHLTHGFMTSATSIFFNSMPYKVNDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVKSLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDR-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQAVQALREEVESFASLFPLP. 468
19 -103.0001bj4_A mol:protein length:470 PROTEIN (SERINE HYDROXYMETHYLTRANSFERASE)  ali model follow..  44  5WSSHDAMLAQPLKDSDVEVYNIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEFIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMPYKVNDTGYINYDQLEENARLFHPKLIIAGTSCYSRNLEYARLRKIADENGAYLMADMAHISGLVAAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRKGVESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTLEFKVYQHQVVANCRALSEALTELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDR-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTLQIQSVQALREEVESFASLFPLP. 468
20 -102.0004o6z_A mol:protein length:480 Serine hydroxymethyltransferase  ali model follow..  38  28PFTPGMFNNDPLQKYDKELFDLLEKEKNRQIETINLIASENLTNTAVRECLGDRISNKYSEGYPHKRYYGGNDYVDKIEELCYKRALEAFEEWGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSFESKLYKCNSEGYVDMESVRNLALSFQPKVIICGYTSYPRDIDYKGFREICDEVNAYLFADISHISSFVACNLLNNPFTYADVVTTTTHKILRGPRSALIFFNKKRDQKINSSVFPSFQGGPHNNKIAAVACQLKEVNTPEFKEYTKQVLLNSKALAECLLKRNLDLVTNGTDNHLIVVDLRKYNITGSKLQETCNAINIALNKNTIPSDV-DCVSPSGIRIGTPALTTRGCKEKDMEFIADMLLKAILLTDENPKIDELKKEVVQWAKNLPF.. 473
21 -101.0004oyt_A mol:protein length:442 Serine hydroxymethyltransferase, putative  ali model follow..  38  4........NEPLEQIDKELHDILADEEKRQRETINLIASENLTNGAVRECLGNRVSNKYSEGYPKKRYYGGNDFIDKIEELCQKRALEAFNVSGVNVQPLSGSAANVQALYALVGVKGKIMGMHLCSGGHLTHGFFDEKKKVSFESKLYKCNSQGYVDLDAVREMALSFKPKVIICGYTSYPRDIDYQQFRQICDEVNAYLFADISHISSFVACNILNNPFLHADVVTTTTHKILRGPRSALIFFNKKRNQKINSAVFPSFQGGPHNNKIAAVACQLKEVHSPAFKEYTQQVLLNSKALAKALISKQIDLVTNGTDNHLIVVDLRKFSITGSKLQETCNAINVSLNKNTIPSDV-DCVSPSGVRIGTPAMTTRGAKEKDMEFIADVLARAIKITVDLQELQQLKQEVVTWAGALPF.. 441
22 -101.0006ccz_A mol:protein length:455 Serine hydroxymethyltransferase  ali model follow..  48  6........DYGLSEADPDVHAIINKEKDRQFRSLELIASENFTSKAVMEAVGSCLTNKYSEGLPGKRYYGGNEHIDELEILCQQRALAAFDKWGVNVQPLSGSPANFAVYTAILKPHDRIMGLDLPHGGHLSHGFMTAKRRVSGTSIYFESESTGVIDYDMLEKTAALFRPKLIIAGASAYPRDIDYARFRKIADSVGAFLMMDMAHVSGLIAASVLADPFEFVDIVTTTTHKSLRGPRGGMIFFKKDAVSAINNAVFPGLQGGPHNHTIGGLAVCLKYAQSPDFKNYQNQVVANCRALANRLVEHEYKLVSGGSDNHLVLVDLRPSGIDGARVEKILDMASITLNKNSVPGDK-SALVPGGIRIGSPAMTTRGLGEKEFELIADLIHEGVRISLEGDKVSNLRRKVEALATQYPIP. 453
23 -100.0006dk3_A mol:protein length:488 Serine hydroxymethyltransferase, mitochondrial  ali model follow..  43  22EANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGTRSGLIFYRKTFEDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDR-SAITPGGLRLGAPALTSRQFREDDFRRVVDFIDEGVNIGLEVQRLANLRQRVEQFARAFPM.. 482
24 -99.4004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  34  2..........EYSDVPKFIRDVSIKQHEWMRESIKLIASENITSLAVREACATDFMHRYAEGLPGKRLYQGCKYIDEVETLCIELSKELFKAEHANVQPTSGVVANLAVFFAETKPGDKLMALSVPDGGHISHWKVSAAGIRGLKVINHPFDEEMNIDADAMVKKILEEKPKLILFGGSLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLIAGKQFQDPLEGAEYLMGSTHKTFFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALA-EMLEFGEAYAKQVIKNAKALAQALYERGFNVLCEHKDFTESHQVIIDIEFSASELAKMYEEANIILNKNLLPWDDNNSDNPSGIRLGTQECTRLGMKEKEMEEIAEFMKRIAIDKEK---PEKVREDVKEFAKEYSTIH 414
25 -97.7001ls3_A mol:protein length:483 Serine Hydroxymethyltransferase  ali model follow..  45  15.SSHEQMLAQPLKDSDAEVYDIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGGTEHIDELETLCQKRALQAYQCWGVNVQPYSGSPANFAVYTALVEPHGRIMGLDLPDGGHLTHGFMTSATSIFFESMAYKVNDTGYIDYDRLEENARLFHPKLIIAGTSCYSRNLDYGRLRKIADENGAYLMADMAHISGLVVAGVVPSPFEHCHVVTTTTHKTLRGCRAGMIFYRRNLESLINSAVFPGLQGGPHNHAIAGVAVALKQAMTPEFKEYQRQVVANCRALSAALVELGYKIVTGGSDNHLILVDLRSKGTDGGRAEKVLEACSIACNKNTCPGDK-SALRPSGLRLGTPALTSRGLLEKDFQKVAHFIHRGIELTVQIQDVRALRQEVESFAALFPLP. 478
26 -21.6002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  16  54............................................................................PIHDFIHNQLPKFLGCDVARV---GAREAKFAVMHSLAKKDAWVV---MDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQTIEETKKRLITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKE----GADFIVGSGHKSMAASGPGVMGMKEEWAEIVLKNKEVELLGCTARGATIITLMASFPHVRERIKRWDEE-VEKARRFAAEMEKLGIKQLGDNPHNHDLMFFHAEV-GGRFFLYRELKSRKIHGIKPGLT--------------RYFKLSTYGLSDEEVDYVLNAFKEIIEK......................... 369
27 -20.4003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  18  4MQEILSQLNKEIEGLKKAITSPQNAEIKVGEKEVLNFCANNYLGPALIKTAQTVV-EQYGFGMASVRFICGTQ---TIHKELEKDISEFLGTDDTIL---SCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKN-----------AMGDLEAKLKEARFKLIATDGSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENEYCGVADRVDILTGTLGKALGGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEGPQLRKQLQENSRYFRAGMEKLGFQLVPGNHP---IIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMG---KARIRVQMSA----VHTQQQLDRAIEAFGQVGKK......................... 395
28 -19.8001wyt_B mol:protein length:474 glycine dehydrogenase subunit 2 (P-protein)  ali model follow..  14  47...............ELTLVRHYTGLSRRQVGVDTTFYPLGSCTMKYNPKLHEEAARLFADLHPYQDPRTAQGALRLMWEL-GEYLKALTGMDAITLEPAAGAHGELTGILIIRAYHED--VVLVPDSAHGSNPATASMAGYQVREIP--SGPEGEVDLEALKRELGPHVAALMLTNPNTLLFERRILEISRLCKEAGVQLYYDGANLNAIMG---WARPGDGFDVVHLNLHKTF-GPGSGPVGVKAHLAPYLRPKSIGRVRSFYGNFLALVRAWAYIRTLGLEGKKAAALAVLNARYLKELLKEKGYRVPYDGPSMHEFVAQ------PPEGFRALDLAKGLLELGFHPPTVYFPLIVKEALMVEPTETE----AKETLEAFAEAMGALLKKPKEWLENAPYSTPVRRL........ 457
29 -19.7005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  16  38...................YKNLTRSLTREFINLNPIQRGGILPKEAKKAV-----YEYWDGYSVCDYCHGDEVTCPPIKDFLEDIAKFLNMDCARP-THGAREGKFIVMHAICKEGDYVVLDKNAH--YTSYVAAERAKLNVAEVGYEEEYPTYKINLEGYKEVIDNKNVGLILLTDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKE----KADFIVASGHKSMAASAPGILAFSEEFSDKITPVKEIEMLGCTSRGLPIVTLMASFPHVVERVKKWDEE-LKKTRYVVDELEKIGFKQLGIKPKEHDLIK----------ETPVLDEIAKKDKRRGFFFYDELKKRGIGGIRAGVTKMSVYGLEWEQVEYVVNAIKEIVE.......................... 408
30 -19.3002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  15  46.............................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN-------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTI----RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY......................... 383
31 -19.2002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  19  10....................................LRSDTVTKP------TEEMRKAMAQAEVGDDVYGEDPTINELE----RLAAETFGKEAALFVP-SGTMGNQVSIMAHTQRGDEVIL---EADSHIFWYEVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPPRTSLIAIENTRVVPLENIKEICTIAKEHGINVHIDGARIFNASIGVPVKEYAGYADSVMFCLSKGLCAPVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALTKM-----DRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILRTDNLKVNAHGFIEALRNSGVLANA----------VSDTEIRL----VTHKDVSRNDIEEALNIFEKLFRK......................... 347
32 -19.2001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  17  52.............................ANNYLGLANHPDLIAAAKAGM------DSHGFGMASVRFICGTQ---DSHKELEQKLAAFLGMEDAIL---SCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYAN-----------DMQELEARLKEAREHVLIATDGVFSMD-NLKGVCDLADKYDALVMVDDSHAVGFVGENEYCDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAG-SELRDRLWANARQFREQMSAAGFTLAGADHA---IIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKG---QARIRTQMSA----AHTPEQITRAVEAFTRIGKQ......................... 396
33 -19.1001ax4_A mol:protein length:467 TRYPTOPHANASE  ali model follow..  15  1MAKRI------VEPFRIKMVEKIRVPSREERNPFLLPSSAVYIDLLTDSGTNAMSDHQWAAMITGDEAYAGSRNYYDLK----DKAKELFNYDYI-IPAHQGRGAENILFPVLLKYKQKEGPVFISNFHFDTTAAHVELNGCKAINIVTE-DWKGDFDIKKLKENIAQHGADNIVAAGGQPVSMSNLKEVYEIAKQHGIFVVMDSARFCNATIKEVIFDMYKYADALTMSAKKDPLLNIGGLVAIRDNEIFTLARQRCVPMEGFVTYGGLAGMAAMVQGLEEGTEEEYLHYRIGQVKYLGDRLREAGIPIQYP-TGGHAVFVDCKKLVPQIPGDQALYLESGVRAVEIGSFLLGRDPATGE-MRLTIAR-----YTNDHMDYIADALIGLKEKFATLKGLEFEYEPLRHFTARLPI.. 466
34 -19.0003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  17  13.KIVEELKAKGLYAYFRPIQSKQDTEVKIDGRRVLMFGSNSYLGTRIIKAAQDAL-EKYGTGCAGSRFLNGTL---DIHVELEEKLSAYVGKEAAIL---TGFQSNLGPLSCLMGRNDYILL---DERDHASIIDGSRLSFSKVIKYGHN-------NMEDLRAKLSRLPEKLICTDGSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKSHFGLNDDVDLIMGTFSKSL-ASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNE-PEHIEKLWKNTDYAKAQLLDHGFDLGATESP---ILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAE---ESLIRFSLMA----THTYDQIDEAIEKMVKVFKQ......................... 391
35 -19.0003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  15  60.............................SNDYLALANHPLIKARLAKSL------LEEQQSLFMSASFLQND---YDKPMIEKRLAKFTGFDECLL---SGWNANVGLLQTICQPNTNVYI---DFFAHMSLWEGARYANAQAHPFMHN-------NCDHLRMLIQRHGPGIIVVDSSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNAELGLTREVHFMTASLAKTF-AYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESA-DNRRQHLDRMARKLRIGLSQLGLTI----RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKN---KNIIRLSLNS----DVNDEQIAKIIEVCSDAVNY......................... 397
36 -18.9001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  15  46.............................SNDYLGLSHHPQIIRAWQQGA------EQFGIGSGGSGHVSGYS---VVHQALEEELAEWLGYSRALL---SGFAANQAVIAAMMAKEDRIAA---DRLSHASLLEAASLSPSQLRRFAHN-------DVTHLARLLASPCPGQMVVTEGVFSMD-PLAEIQQVTQQHNGWLMVDDAHGTGVIGRGSCWLQKVKPELLVVTFGKGF-GVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDGDARREKLAALITRFRAGVQDLPFTLADSCSA---IQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAG---TARLRLTLTA----AHEMQDIDRLLEVLHGN............................ 383
37 -18.8001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  16  34...............................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTAAHGIKVFYDATRCVENAYAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLRE-YEYIEHRVKQVRYLGDKLKAAGVPIVEP-VGGHAVFLDARRFCEHLTQDEFPAQSLAASI------------YVETGVRSPKLETVRLTITYAHMDVVADGIIKLYQHKEDIRGLKFIYEPLRFFTARFYI.. 456
38 -18.7002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  19  51.............................TYNYMGMTFDPDVIAAGKQAL------DEFGSGTTGSRVLNGTY---QGHKACEDALKEFYGTEHAIV---TGYQANLGMISTLAGKGDYIIL---DADSHASIYDGCWLGDAEIVRFRHN-------SVEDLDKRLGRLPAKLVVLEGSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHEEAGVEADVDFVVGTFSKSV-GTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHA-GDKRAHLWKNSRRLHQGLRDMGYKLGTETAQSAIIAVILTD-MAQAVALWQGLLEAGLYVNTARPPATPAG---MFLLRCSLCAE-----SDEQVEQILGMFESAGRA......................... 394
39 -18.7003gwp_A mol:protein length:427 carbon-sulfur lyase involved in aluminum resistance  ali model follow..  12  2MLESTKQFLKKYNINDRVLKLYETAMNDIQNQFKILDDIREFNQLKVLNAFQEERISEAHFTNSSGYGYGGRDSLDAVYA-------RVFNTESALVRPHNGTHALGAALFGNLRPGNTMLSVCGE--GITENSNMGSLKEFGINYKQVDLKEDGKPNLEEIEKVLKE-DESITLVHIQRALLIEDIKSIVDCVKNIDIICFVDNCYGEFM----DTKEPTDGADLIAGSLIKNIGGPTGGYLAGTKDCIEKTSYRLTVPGIGGECGSTFGVVRSMYQGLFLA--PHISMEALKGAILCSRIMELAGFEVMPKYDEKRSDIIQSIKFN-DKDKLIEFCKGIQTGSPIDSFVSCEPWDMPGYTDQVIMAAGAFIQGSSIELSADAPIREPYIAYLQGGLTFDHAKIGILIALSRI.... 425
40 -18.7005i90_A mol:protein length:427 PvdN  ali model follow..  16  21LSAAQSLRAEGVPSDAGNKWKALRQQFDLDPQYLHFANFLLTSHPRPVREAIERLRVRFDRN-PGEAVDWHREEIWKYEDEARAWAGRYFAVQPGQV-TGSTTDGLAAIYGGLVQPGKEILTSSHEHYSTYTLEYRHKRMGTQVREFPLFKDPHRVSADEILSSIAAQIRPQTRVLGMTWVQSGLPIREIGKLVRELNQIYVVDGVHGFGVEDVSFAD----DCDYFIAGTHKWLFGPRGGVIIARSEQLQEHLVPSIPTFSGYHAFEHRLALGTAFELHLQLGKAEVQARIHQLNAYLKQRLGEHKVRLVTTSPELSSGFTFFRVEGRDCEAVAKHLMAHRVISDAVD---------VGPVVRLAPSLLN----DEAEIDRVLEILAPQL........................... 426
41 -18.6004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  14  16.SNAMLNLQDKYTQYQRDNLLRELTPFIKDDSIIDFTTSDNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYT---DETQQFEHEFAKFINYPRAIF---SGFMANLAIYSTLFSKHDSIFA---DKYIHASIIDGIKLSQAKLRRYKHQ-------QLSQLQDIYDGKS---FITTEGVFSTSGSITQLDKLAKITPEKLIVDEAHSFGVLAINSFRISYKNCLICVFPLGKAF-GGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENV-NDNRARLQQNITFFNELCDAKDLELVS--KDLSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKD---QAILRFSLHSN-----TFDQIQQALEIISKEVKY......................... 387
42 -18.3002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  21  62.............................RGKDTILLGTYNYMGPDVIAAGKEAL-EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN-------SVEDLDKRLGRLPKKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSKSV-GTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLED-QEQAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICA----EHTPAQIQTVLGMFQAAGRA......................... 414
43 -18.3002hzp_A mol:protein length:501 Kynureninase  ali model follow..  12  52CHPTDERVALHLDEEDKDLPPVDLSLVNKDENAIYFLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESI-VGLMKDIVGANEKEIALMNALTVNLHLLMLSFPKRYKILLEAKAPSDHYAIESQLQLHGLNIEESMRMIETLRIEDILEVIEKEGD-SIAVILFSGVHFYQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHD----GVDFACWCSYKYLNAGAGAGAFIHEKHAHTIKPALV---ISNPPILLVCSLHASLEIFKQATMKALRKKSVLLTGYLEYLIKHNVVNIITPSHVEERGCQLTITFSVPNKDVFQELEKRGVVCDKR----------NPNGIRVAPVPLYN---SFHDVYKFTNLLTSILDSAETKN.................... 495
44 -18.2006MME Entity 1(prereleased)  ali follow..  16  34...............................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAYAGSENFYHLE----RTVQELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDEAHDAGLKGDIDLKKLQKLIDEKNIAYICLAVTV-VSMANMRAVRELTEAHGIKVFYDATRCVNKSIAEIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDDEMFSSAKELVVVYEGMPSYGGLAGRDMEAMAIGLRE-YEYIEHRVKQVRYLGDKLKAAGVPIVEP-VGGHAVFLDARRFCEHLTQDEFPAQSLAASI------------YVETGVRSMELETVRLTITYAHMDVVADGIIKLYQHKEDIRGLKFIYEPLRFFTARFYI.. 456
45 -18.2003bc8_A mol:protein length:450 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  1.....RQGCEARRAHEHLIRLLLEQGKCPEDG------DESTLELFLHELAVMDSNNFLGNCGVGER--AGSSLLNKITNSLVLKLAGVHSVASCFVVPMATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVINVLEGDELRTDLKAVEAKIQELGPECLHSTTACFA---RLEELAVICANYDIPHVVNNAY--GLQSSKCMHLIVGRIDAFVQSLDKNFMVPVGGIIAGFNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEANERLLHHDKAVTQLGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLNA----AAAIGMKMQDVDLFIKRLDKCLNIVRKEQ.................... 447
46 -18.1005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  15  11.EGLKEIDARGLRRRRRTADTPCAAHMTVDGRAIIGFASNDYLGPQLIAAIAEGA-QRYGAGSGGSHLLGGHS---RAHAQLEDDLAEFVGGFVENARALTGYMANLATLTALAGRGTTLFS---DALNHASLIDGARLSRADVQIYPHC-------DTDALSAMLEASDADKVIVSDTVFSMD-PLPRLLELAEQHGAWLIVDDAHGFGVLGPQAQAALRSPNLISIGTLDKAA-GVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEGDARRAHLQQLIGRTRAMLKATPWLPVDSHTA---VQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTG---TSRLRISLSA----AHSQADLDRLEAGLQQLGAK......................... 394
47 -18.1001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  13  17........................................SFVNDYSVGMHPKILDLMARDNMTQHAGYGQDSHCAKAA----RLIGELLERPDADV-ISGGTQTNLIACSLALRPWEAVIA---TQLGHISTHETGAIEATGHKVVTA-PCPDGKLRVADIESALHENIPKLVYISNTTQYTKQELEDISASCKEHGLYLFLDGARLASALSS-TLADIARLTDMFYIGATKAGGMFGEALIILNDALKPNA--RHLIKQRGALMAKGWLLGIQFEVLMKDNLFFELGAHSNKMAAILKAGLEACGIRLAWP-SASNQLFPILEN------------TMIAELNNDFDMYTVEPLKDGTCIMRL----CTSWATEEKECHRFVEVLKRLVASTA....................... 359
48 -18.1004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  20  78.............................RGKDTILLGTYNYMGPDVIAAGKEAL-EKFGSGTNGSRMLNGTF---HDHMEVEQALRDFYGTTGAIV---TGYMANLGIISTLAGKGEYVIL---DADSHASIYDGCQQGNAEIVRFRHN-------SVEDLDKRLGRLPKKLVVLEGSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNEAQGLEGQIDFVVGTFSASV-GTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTA-HEKRERLWSNARALHGGLKAMGFRLGTETCDSAIVAVMLED-QEQAAMMWQALLDGGLYVNMARPPATPAG---TFLLRCSICA----EHTPAQIQTVLGMFQAAGRA......................... 430
49 -18.0005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  16  9.RGLADLDAQGLRRVRRTADSACDAHMTVNGREIVGFASNDYLGLAAHPKLFAEGAQRYGSGSGGSHLLGGHS---RAHAKLEDELAGFAGGFSDAPRALTGYMANLAAVTALAGKDATIFS---DALNHASLIDGTRLSRATVQVYPHA-------DTATLGALLEACQTKLIVTDTSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQAAAALRSPHLVYVGTLGXAA-GVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDGDARRAHLAALIERTRALLRRTRWQPVDSHTA---VQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAG---TSRLRISLSA----AHSFDDLARLETALLRASEE......................... 392
50 -17.6003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  16  4....................................LRSDTVTRP------SRAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKEAA-IFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTVLPREYLKEAWEFTRERNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALKNNVARLQE------DNAAWMAEQLREAGADVMRQDTN----MLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSREQLAEVAAHWRAFLAR......................... 333
51 -17.6002aeu_A mol:protein length:374 Hypothetical protein MJ0158  ali model follow..  14  1...........MLSDYEEFLRLIILEILNEKGRDALYDLSGLSGGFLIDEKDKALLNTYI------------GSSYFAEKVNEYGLKHLGGDENDKCVGFNRTSSAILATILALKPKKVIHYL-PELPGHPSIERSCKIVNAKYFESD---------KVGEILNKIDKDTLVIITGSTMDLIELENFKKVINTAKNKEAIVFVDDASGARVRLLFNQPPALKGADLVVTSTDKLMEGPRGGLLAGKKELVDKIYIEGTKFGLEAQPP-----LLAGIYRALKNFNLERIRKAFERAKNFDLSKIEKNINIVYERTPTGFVIKRVYKDDTINIKKLIEIGFNLLKNYGIITITVAGMPGASKSLRIDLTSRDAERIDDNYIKAIVESIKMAFKS......................... 374
52 -17.5005vye_A mol:protein length:346 L-threonine aldolase  ali model follow..  11  7........................................QFASDNYSGICPEAWAAMEKANHGHDRAYGDDQWTERAS----EYFRNLFETDCEVFFAFNGTAANSLALASLCQSYHSVIC---SETAHVETDECGAPEFFS-SKLLTAASVNGKLTPQSIREVALKRKPRVVTITQATVYRPDELKAISATCKELGLNLHMDGARFTNACAFLGCSTWKAGVDVLCFGGTKNGMAVGEAILFFNRQLAEDFDYRCKQAGQLASKMRFLSAPWVGLLE--DGAWLRHGNHANHCAQLLALLVSDLPGVELMFPVEANGVFLQM------PEHAIEALRAKGWRFYTFI---------GSGGARF----MCSWDTEEERVRELAADIRSIITA......................... 346
53 -17.5001v72_A mol:protein length:356 Aldolase  ali model follow..  13  11........................................GFSSDNIAGASPEVAQALVKHSSGQAGPYGTDELTAQVK----RKFCEIFERDVEVFLVPTGTAANALCLSAMTPPWGNIYC---HPASHINNDECGAPEFFS-AKLMTVDGPAAKLDIVRLRERTREKQPACVSITQATIYTLDEIEAIGDVCKSSSLGLHMDGSRFANALVSLGCS--KAGVDALSFGATKNGVLAAEAIVLFNTSLATEM--SYRRKRAGHLSSKMRFLSAQIDAYLTDDLWLRNARKANAAAQRLAQGLEGLGGVEVLGGTEANILFCRL------DSAMIDALLKAGFGFY--------HDRWGPNVVRF----VTSFATTAEDVDHLLNQVRLAADRTQER..................... 356
54 -17.4001c7g_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  17  34...............................NTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMIGDEAYAGSENFYHLE----KTVKELFGFKHI-VPTHQGRGAENLLSQLAIKPGQYVAGFHQEKNGATFVDIVRDEAHDASLNLPFKGD----IDLNKLATLIKEKNIAYICLAVTV-VSMANMRAVHEMASTYGIKIFYDATRCVNVSIKDIVHEMFSYADGCTMSGKKDCLVNIGGFLCMNDEEMFSAAKELVVVYEGMPSYGGLAGRDMEAMAIGLRE-YEYIEHRVKQVRYLGDKLREAGVPIVEP-TGGHAVFLDARRFCPHLTQDQFPAQSLAASIYMET-ETGENHRPKLETVRL---TIPRRVYTYAHMDVVADGIIKLYQHKEDIRGLTFVYEPLRFFTARFFI.. 456
55 -17.4001c4k_A mol:protein length:730 PROTEIN (ORNITHINE DECARBOXYLASE)  ali model follow..  13  92AREIETAVNNYEDSILPPFFKSLKEYVSRYLIQFDC-PGHQGGQYYRKHPAGREFYDFFGETVFRADLCNADVALGDLLI-AEKHAARVYNADKTYFVLGGSSNANNTVTSALVSNGDLVL---FDRNNHKSYNSALAMAGGRPVYLQTNRNPYGFIDSDFDEKKIRELAAKAVIQLGTYDGTIYNAHEVVKRIGHLCDYIEFDSAWVGYEQFIPMMRN-EDPGIIVVQSVHKQQAGSQTSQIHKKDSHIKHFNNSFNLFMSTSPFYPMYAALDVNAAMQEGEAGRKLWHDLLITTIEARKKLIKGSMFRPFVPPVVNGKKWEDGDTEDMANNIDYWRFEKGAKWHAYEGYGDNQYYVDPNKFMLTTPGINPETGDYEDFGVPATIVANYLRDAETPAKMNNLITQLLQLQRLI.... 566
56 -17.3005uts_G mol:protein length:501 C-S Lyase Egt2  ali model follow..  13  15LPLQQKADAAQTVTGPLPFGNSLLKEFVLDPAYRNL----NHGSFGTIPSAIQQKLRSYQTAAEARPCPFLRYQTPVLLDESRAAVANLLKVPVETVNATMGVNTVLRNIVWSADGKDEILYFDTIYGACIDYVIEDKRGIVSSRCIPLIYPAEDDDVVAAFRDAIKKSRPRLAVIDSSMPGVRFPFEDIVKICKEEEIISCVDGAQGIGMVDLKITE----DPDFLISNCHKWLFTPRGAVFYVPVRNQHLIRSTLPTSHGFVPQVGNRVKDAIKWREEVLGGEERIMEYMTKLAREGGQKVAEIGTRVLENSTGTLIRCAMVN-YEIPHEEANMAFKWMYNVLDEFNTFVPMTFHRRRFWARLSAQVYL----EMSDFEWAGKTLKELCEEYKESALEVDLQGDHGLSAWSHP... 497
57 -17.3005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  18  34.........RYFNNINRLAKEFPLAHRQREADKVTVWCSNDYLAPEVLDAMHKTI-DKYGCGAGGTRNIAGHN---IPTLNLEAELATLHKKEGALV---SCYVANDAVLSLLGQKMKDLVIFS-DELNHASMIVGIKHANVKKHIFKHN-------DLNELEQLLQSYPPKLIAFESSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGKGGAKTVMDRVDMITGTLGKSF-GSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCH-IDLRTSQQKHTMYVKKAFHELGIPV--IPNPSHIVPVLIGNADLAKQASDILINKHQIYVQAINFPTVARG---TERLRITPTP----GHTNDLSDILINAVDDVFNE......................... 429
58 -17.3001qz9_A mol:protein length:416 KYNURENINASE  ali model follow..  14  8.........LALDAQDS--LAPLRQQFALPEGVIYL-NSLGARPVAALARAQAVIAEEWGNGLIR--SWNSAGWRDLSERL-GNRLATLIGARDGEVVVTDTTSINLFKVLSAAPERRVIVTETSN------FPTDLYIAEGLADMLQQGYTLRLVDSPEELPQAIDQ-DTAVVMLTHVNYKYMHDMQALTALSHECGALAIWDLAHSAGAVPVDLHQ----GADYAIGCTYKYL-GPGSAFVWVSPQLCDLVPQPLS---CGTQPITSLAMVECGLDVFAQTDMASLRRKSLALTDLFIELVEQRELTLVTPREHAKRGSH-VSFEHPEGYAVIQALIDRGVIGDYRE----------PRIMRFGFTPLYT---TFTEVWDAVQILGEILDRKTWAQAQFQVRHSVT.......... 416
59 -17.3004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  16  4....................................LRSDTVTRP------SRAMLEAMMAAPVGDDVYGDDPTVNALQ----DYAAELSGKE-AAIFLPTGTQANLVALLSHCERGEEYIV---GQAAHNYLFEAGGAAVLSIQPQPIDAAADGTLPLDKVAMKIKPFARTKLLSLENTVLPREYLKEAWEFTRKRNLALHVDGARIFNAVVA-ELKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALKNNVARLQE------DNTAWMAEQLREAGADVMRQDTN----MLFVRVGEENAAALGEYMKARNVLINASPI------------VRL----VTHLDVSRAQLAEVAAHWRAFLAR......................... 333
60 -17.3001elq_A mol:protein length:390 L-CYSTEINE/L-CYSTINE C-S LYASE  ali model follow..  11  4...................ITPSLHQFPGLANKTYF--NFGGQGILPTVALEAITAMYGYLQENGPFSIAANQHIQQLIAQLRQALAETFNVDPNTITITDNVTTDIVLWGLDWHQGDEILLTDCEHPGIIIVQAIAARFGITYRFFPVAATLNQGDAAAVLANHLGP-KTRLVILSHLLWNQVLPLAEIMAVCRRHQGRVLVDGAQSAGSLPLDFSR----EVDYYAFTGHKWFAGPAGGGLYIHGDCLGEIWAEGGKRFEVATSAYPQYAGLLAALQLHQRQGEERYQAICQRSEFLWRGLNQLHVHCLATSAPQAGLVSFTVDSPLGHRAIVQKLEEQRIYL---------RTIADPDCIRACCHYIT----DEEEINHLLARLADF............................ 388
61 -17.2004q6r_A mol:protein length:511 Sphingosine-1-phosphate lyase 1  ali model follow..  14  49.LKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFVYSGEEKLTELLVKAYGDFAWSNPLH-------PDIFPGLRKIEAEIVRIACSLFNGDSCGCVTSGGTESILMACKAYFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVP--LTKMMEVDVRAMRRAISRNTAMLVCSTPQFPHGVIDVPEVAKLAVKYKIPLHVDACL--GFLI-HPFDFRVKGVTSISADTHKYGYAPKGSLVLYSDKKYRNYQFFVDTDWQGGIYASISAACWAALMHFGENGYVEATKQIIKTARFLKSELENIGIFVFG---NPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFP---------PSIHF----ITLLHARKRVAIQFLKDIRESVTQIMKNPKAKT-RNMVAELSSVF-LYS 494
62 -17.1002z67_A mol:protein length:456 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  59...............DEKIKLFLKFLSMMDTDKDPKSVRIGEREARTYSKIHEELSSGFCHGVDPQPKASGASIMYALTNKILESFFKQLGVHAIATPISTGMSISLCLSAARKKYGSNVVIYPYA--SHKSPIKAVSFVGMNMRLVEVLDGDRVYVPVEDIENAIKKEIELCVLSTLTFFPP--DIVEIAKICENYDIPHIINGAY--AIQNNYYLEK-KYRVDAVVSSSDKNLLTPIGGLVYSTDAEFIKEISLSYPGRASA---TPVVNTLVSLLSMGSKNYLELVKNQKNSKKLLDELLNDTGGKFLDVESPIASCISVNSDPVEIAAKLYNLRVTGPRGIKKTDHFGNCYLGTYTHDY---IVMNAAIGVRTEDIVNSVSKLEKIL........................... 449
63 -17.1002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  18  24.........IDIEREKGAFPKAQWNRPDGGKQDITVWCGNDYLGPVVLAAMHEAL-EAVGAGSGGTRNISGTT---AYHRRLEAEIAGLHQKEAALV---SAYNANDATLSTLRVLFPGLIIYS-DSLNHASMIEGIKRNAGPKRIFRHN-------DVAHLRELIAAAAPKLIAFESSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRERDGLMHRIDIFNGTLAKAY-GVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAGQKLRDAQQMHAKVLKMRLKALGMPI--IDHGSHIVPVVIGDPVHTKAVSDMLLSDYGVYVQPINFPTVPRG---TERLRFTPSPV-----DLKQIDGLVHAMDLLWAR......................... 399
64 -17.1003maf_A mol:protein length:518 sphingosine-1-phosphate lyase  ali model follow..  13  80.........LPRAEILAEIAAMGAAESPAWRDG--VYHGDEHHIAFLNEVYALQSQSNPLH-------PDLWPSTAKFEAEVVAMTAHMLGGTVCGTVTSGGTESLLLAMKTRATKGITAPEAVVPVSAHAAFDKAAQYFGIKLVRTP--LDADYRADVAAMREAITPNTVVVAGSAPGYPHGVVDIPEIAALAAEHGIGCHVDACL--GFILVPPFDFRLEGVTSVSADTHKYGYGAKGSVILYRRPDLLHYQYFIAADWPGGLYFSLSATAWAAMLSLGEEGYLDATRRILQAADRLKAGVRAISLKILGDP----LWVIAVASDELNIYQVMEEMAGRGWRLNGLHRP---------PAFHV---ALTLRHTEPGVVDRFLADLQDAVAQVRAHPEKATGMAPVYGMAAAAP... 494
65 -17.0003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  15  9....................................LRSDTVTQP------TDAMRQCMLHAEVGDDVYGEDPGVNALE----AYGADLLGKEAA-LFVPSGTMSNLLAVMSHCQRGEGAVL---GSAAHIYRYEAQGSAVLSVALQPVPMQADGSLALADVRAAIAPDTPTRLVCLENTVLPLPYLREMRELVDEHGLQLHLDGARLFNAVVGHTVRELVAPFDSVSICLSKGLGAPVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQQH-----VRLADDHRRARQLAEGLAALGIRLDLAQVQTNMVFLQL--TSGESAPLLAFMKARGILFSG------------YGELRL----VTHLQIHDDDIEEVIDAFTEYLGA......................... 341
66 -17.0002yob_A mol:protein length:388 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  13  21..............................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMY------------QIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGRDIVSYVMDHFDIEI------MGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALVA......................... 386
67 -16.9005luc_A mol:protein length:403 Serine--pyruvate aminotransferase  ali model follow..  12  26..............................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMY------------QIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVNSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGRDIVSYVIDHFDIEI------MGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH......................... 391
68 -16.9003isl_A mol:protein length:416 Purine catabolism protein pucG  ali model follow..  10  1.....................MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAF------------TGIMNETMEMLRELFQTKNRWAYPITSRAGIEAVLASVIEPEDDVLIPI---YGRFGYLLTEIAERYGANVHMLECEWGTVFDPEDIIREIKKVKPKIVAMGETSTGRIHPLKAIGEACRTEDALFIVDAVATIG---GCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVERGTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSCKMPVVTCVEIPGGGESVRDMLLAQFGIEI------ASSFGPLAGKIWRIGMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKALQAALDVYENAGRQAAV.. 416
69 -16.9004i8a_A mol:protein length:394 Serine-pyruvate aminotransferase  ali model follow..  13  23..............................PNQLLLGPGPSNLPPRIMAAGGLQMIGSMSKDMY------------QIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVAFLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGRDIVSYVIDHFDIEI------MGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH......................... 388
70 -16.9002huf_A mol:protein length:393 Alanine glyoxylate aminotransferase  ali model follow..  12  18..............................PNKLLMGPGPSNAPQRVLDAMSRPILGHLHPET------------LKIMDDIKEGVRYLFQTNNIATFCLSGHGGMEATLCNLLEDGDVILIGH---TGHWGDRSADMATRYGADVRVVKSKVGQSLSLDEIRDALLIHKPSVLFLGDSSTGVLQGLEGVGALCHQHNCLLIVDTVASLG---GAPMFMDRWEIDAMYTGSQKVLGAPPGITPVSFSHRAVERYKRRNTKVKVTISSTLLYGLREAIAMACEEGLPALIARHEDCAKRLYRGLQDAGFELYADPKDRLSTVTTIKVPQGWLKAAQYAMKTYLVEI------SGGLGPTAGQVFRIGLMGQN---ATTERVDRVLQVFQEAVAA......................... 382
71 -16.9004cbr_A mol:protein length:392 SERINE--PYRUVATE AMINOTRANSFERASE  ali model follow..  13  21..............................PNQLLLGPGPSNLPPRIMAAGGLQMIGHMSKEMY------------QIMDEIKEGIQYVFQTRNPLTLVISGHCALEAALVNVLEPGDSFLVGA---NGIWGQRAVDIGERIGARVHPMTKDPGGHYTLQEVEEGLAQHKPVLLFLGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLG---GTPLYMDRQGIDILYSGSQKALNAPPGTSLISFSDKAKKKMYSRKTKPFSTIPVISLYSLRESLALIAEQGLENSWRQHREAAAYLHGRLQALGLQLFVKDPALRLPTVTTVAVPAGRDIVSYVMDHFDIEI------MGGLGPSTGKVLRIGLLGCN---ATRENVDRVTEALRAALQH......................... 386
72 -16.8003nnk_A mol:protein length:411 Ureidoglycine-glyoxylate aminotransferase  ali model follow..  12  1...................MDITQFSQLNPPSRLLMGPGPINADPRVLRAMSSQLIGQYDPAM------------THYMNEVMALYRGVFRTENRWTMLVTSRAGIEAILVSAIRPGDKVLVPV---FGRFGHLLCEIARRCRAEVHTIEVPWGEVFTPDQVEDAVKRIRPRLLLTGDTSTTMLQPLAELGEICRRYDALFYTDATASLG---GNPLETDVWGLDAVSAGMQKCLGGPSGSPITLSARMEEAIRRRKCVEEGRLNHHTEATTALFGARECARLILQEGLDYGIARGDALVKGIQAMGLETFGDLKHKMNNVLGVVIPQGGDQARKLMLEDFGIEI------GTSFGPLHGKVWRIGMGYNARKDCVMTTLSALEAVLNYLKFPTTQGAAMQAAWDHYRS......... 409
73 -16.8003hl2_A mol:protein length:501 O-phosphoseryl-tRNA(Sec) selenium transferase  ali model follow..  11  15.PAYVRQGCEARRSHEHLIRLLLEKGKCPENHELAIMDSNNFLGNCSALVARRHYRFIHGIGRSGD---AGSSLLNKITNSLVLKLAGVHTVANCFVVPMATGMSLTLCFLTLRPKAKYII---WPRIDQKSCFKSMITAGFEPVVIENVLEGDERTDLKAVEAKVQELGPDCIHSTTSCFA---RLEELAVICANYDIPHIVNNAY--GVQSSKCMHLIQQRIDAFVQSLDKNFMVPVGGIIAGFNDSFIQEISKMYPGRASASPSLDVLITLLSLGSNGYKKLLKERKEMFSYSNQIKKLSEAYNERLLHTPHNPISLAMTLKTLDEHRTQLGSMLFTRQVSGARVVPLGSMQTVSGYTFRGFMSHAASAIGMKMQDVDLFIKRLDRCLKAVRKERSKES................ 469
74 -16.8003f9t_A mol:protein length:397 L-tyrosine decarboxylase MfnA  ali model follow..  15  1.......GMRNMQEKGVSEKEILEELKKYRSLDLKYEDGNGSMCSNVLPITRKIVDIFLETNLGDPGLFKGTK---LLEEKAVALLGSLLNNKDAGHIVSGGTEANLMALRCIKNSKNEHPKIIVPITAHFSFEKGREMMDLEYIYAP--IKEDYTIDEKFVKDAVEDYDVDGIIAGTTELGTIDNIEELSKIAKENNIYIHVDAA-FGGLVIPFLDDKYKLGVDSITIDPHKMGHCPIPGGILFKDIGYKRYLDVDAPTILGTRVGFGGACTYAVLRYLGREGQRKIVNECMENTLYLYKKLKENNFKPVIEPI-----LNIVAIEDEDYKEVCKKLRDRGIYVSVCN---------CVKALRIVVMPHIKREHIDNFIEILNSIKRD............................. 397
75 -16.8003kgw_A mol:protein length:393 Alanine-glyoxylate aminotransferase  ali model follow..  12  22..............................PTRLLLGPGPSNLAPRVLAAGSLRMIGHMQKEM------------LQIMEEIKQGIQYVFQTRNPLTLVVSGHCAMETALFNLLEPGDSFLTGT---NGIWGMRAAEIADRIGARVHQMIKKPGEHYTLQEVEEGLAQHKPVLLFLGESSTGVVQPLDGFGELCHRYQCLLLVDSVASLG---GVPIYMDQQGIDIMYSSSQKVLNAPPGISLISFNDKAKYKVYSRKTKPVSTTPVTSLYCLRESLALIAEQGLENCWRRHREATAHLHKHLQEMGLKFFVKDPEIRLPTITTVTVPAGRDIVSYVLDHFSIEI------SGGLGPTEERVLRIGLLGYN---ATTENVDRVAEALREALQH......................... 387

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.