current user: public

If you have questions about the server, please let us know.

Query: 4nk6_A mol:protein length:491 Poly(beta-D-mannuronate) C5 epimerase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490
# Score Template Links and tools%idFirst KALVKELHQAKTYTITSPPTGPLEMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEKGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSKSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNKSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLMPTKEVGISLNGILGERQDEILDLLVRQKKAVLIDPVESQTELRELast
1 -93.7004nk6_A mol:protein length:491 Poly(beta-D-mannuronate) C5 epimerase  ali model  100  1KALVKELHQAKTYTITSPPTGPLEMAKPVLPDLSGYTTEAALKKIARNKPGKITVARMMEETGLKEFIGGDNKMAEWVVRQKGIPQAIMISDGYVNLQDLVKKVPKQFLSEVSPGVYVARLPILVKETGIFEIDSKTKELRLSQEKGSFIVSEGKMLITNTSVNAWSETRNGLAAYRTPDEFRPFVLTWGGSQTWIAKTKMASMGYNQSKSYGVSISQYTPNTAKVLKRGEPTGWIIDSEFADMWYGFYCYETRDFVVKGNTYRDNIVYGIDPHDRSHGLIIAENDVYGTKKKHGIIISREVDNSFIFRNKSHNNKLSGVVLDRNSVGNIVAYNEIYQNHTDGITLYESGNNLLWGNRVIANRRHGIRVRNSVNIKLYENVAMANGLMGVYGHIKDLNDTDRDIELDPFDAQVSLIMVGGELSSNGSGPLSIDSPLSVELYRVSMLMPTKEVGISLNGILGERQDEILDLLVRQKKAVLIDPVESQTELRE 491
2 -33.1002inu_A mol:protein length:410 Insulin fructotransferase  ali model follow..  45..............................................................................................IKQRQTSPDARPGAAIIIPPGDYDLHTQVVVDVS-YLTIAGFGHGFFSRSILDN----------SNPTGWQNLQPGASHIRVLTSPSAPQAFLVKRAGDPRLSGIVFRDFCLDGVGFTPGKNSYHNGKTGIEVASDNDSFHITGMGFVYLEHALIVRGADALRVNDNMIAECG-NCVELTGAGQATIVSGNHMGAGPDGVTLLA-ENHEGLLVTGNNLFPRGRSLIEFT-GCNRCSVTSNRLQGFYPGMLRLNGCKENLITANHIRRTDLYGVVHIAGDNNLISDNLFAYNQPTQILIAGGDANVVALNHVVSDVASQLDASTTHSKVLDSGTASQITSYSSDTAIRPT................................................ 409
3 -30.2005lw3_A mol:protein length:387 Poly(beta-D-mannuronate) C5 epimerase 6  ali model follow..  12  15.........................................................................................VSDDRVAIQAAIDAAHAGGTVYLPPGEYRVSACLTLRDNVYLAGAGMGQTVIKLVDGSAQKITGIVRSPFGEET----------------------------SNFGMRDLTLDG----NRANTVDKVDGWFNGYAPGQPGADRNVTIERVEVREMGYGFDPHEQTINLVLRDSVAHHNGLDGFVADYQIGGTFENNVAYANDR-HGFNIVTSTNDFVMRNNVAYGNGGNGLVVQRGSENILIDGGSYYDNGLEGVLVKMSNNVTVQNADIHGNGSSGVRVYGAQGVQILGNQIHDNAKTAVAPEVLLQSYDDTLGVSGNYYTTLNTRVEGNTITGSANSTYGVDGTDFSSLVGNTINGVQEAAHLYGPNSTVSGTVSAPPQGTD.................. 385
4 -28.8002pyg_A mol:protein length:377 Poly(beta-D-mannuronate) C5 epimerase 4  ali model follow..  14  15.........................................................................................VSDDRASIQAAIDAAYAGGTVYLPAGEYRVS-AAGEPGDGCLMLKD-GVYLAGAGMGETVIKLIDG-------------------SDQKITGMVRSAYGEETSNFGMRDLTLDGNR----DNTSGKVDGWFNGYIPGGDGADRDVTIERVEVREMGYGFDPHEQTNLTIRDSVAHDNGLDGFVA-DYLVDSVFENNVAYANDR-HGFNVVTSTHDFVMTNNVAYGNGSSGLVVQRGPSNILIDGGAYYDNAREGVLLKMTSDITLQNADIHGNGSSGVRVYGAQDVQILDNQIHDNAQAAAVPEVLLQSFDDTAGASGTYYTTLNTRIEGNTISGSANSTYGIDGTDYSSLIDNDIAGVQQP--IQLYGPHSTVSGE......................... 376
5 -25.5001dbg_A mol:protein length:506 CHONDROITINASE B  ali model follow..  29...........................................................................................ASNETLYQVVKEVKPGGLVQIADGTYKDVQLIVSNSGKSITIKALNPGKVFFTGDAKVELRGEHLILEGIWFKDGNRAIQAWKSH------GPGLVAIYGSYNRITACVFDCFD-------------------------------ANSAYITTSLTEDGKVPQHCRIDHCSFTDKITFDQVINGPGMYHRVDHCFFSNGNAGGGIRIRNDIGRCLVDSNLFMRQDSEAEIITSKSQENVYYGNTYLNCQG-TMNFRHGDHQVAINNFYIGNGYGGMFVWGS-RHVIACNYFELSETIKS--RGNAALYLNPGAMASEHALAFDMLIANNAFINVNGYAIHFNPPHQLMLKGNLFFKDKPYVYPFFKDDYFIAGKNSWTGNV................... 415
6 -24.1005gkd_A mol:protein length:726 AlyGC  ali model follow..  6...........................................................................................KTPEAYDQALKKAKPGDDIILANGTW--DFEVLFEAKGNITLRGQTPGKVFLTGQSNLRLAGEHLIVSGLVFKDGYTPTGEVIAFRRNKD-------VLASHSRVTQVVIDNF---------------------------------SNPEKFEQDSWVMVYGRHNRFDHNHLVGKRNKGVTMSSQQNHHRIDHNYFGPSNGGETLRIGTSDSFTLVENNYFDRCNGEVEIISNKSGKNSIRNNVFFESRG-TLTLRHGNGNIVENNVFFGNGTGGIRVINR-DQIIRNNYLEGLTGYRFGSGLTVMNGVPNSKI-NRYHQVDNALIENNTLVNVEHIQFAAGSDKNSNMNNNLIVNDQGTDGITAFDDISGIK........................... 365
7 -23.9003vst_A mol:protein length:638 Xylosidase  ali model follow..  11  13..........................................................................................GKGTLTINKAASVAMAGDTIIVHEGVY--REWVKPKYKGL----SDKRRITYKAAEGEKVVIKGSERIQSGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQ---SKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIAIAGIKLHAAIDVQIHHNRIHDCS-LGLWLDEAQGTRVSKNLFYNNN-RDVFVEVSHGPYLVDHNILSSEYAIDGGAYINNLIAGKMNQRKVLNRSTDDRFYNNIFIGKEG......................................... 485
8 -21.8005gqc_A mol:protein length:606 Lacto-N-biosidase  ali model follow..  1......................................................MQSATQGKETATTTSSGTTYYVSSAHGDDANAGTSENAPWKSLTKVNDIASD-----GPGDSVLLEYGSEFNDQYLHIKDTAGNAITISAYGDADEGKPVIASNGVKGSQWEQDYRANVGNHKNKGTVSTTLLLKDVSYITVSNLEITNDDADVYDPIDLDRSASRMDRTGVAGIAENGATMSNVTLDNLYLREHVSRFDHVTIRNSTVKDVDRWGIAV-GYTAYLNYIDANYGDGSIDDALIAKYGSTNVRIENNYVKGAGGDAITLM-YCDRPVIEHNVGDSVSAAGIWPWRCKDPVFQYNEMYNNDGQAWDADYGDGTLYQYNYSYGNSFASLMIWYAVNTTFRYNISQNDRQGVFGNHIYNNTVYVDADSQVLTKRSNSQSLFENNIFINATNT....................................... 480
9 -21.6005olq_A mol:protein length:522 Rhamnogalacturonan lyase  ali model follow..  12  15..........................................................................................NPGTSTLVKVQEVVVAGDVVYINPGTYVVPANQVPMTTTNSGLYHCVFHMNKSGEAGKPI-----------SYLANPNKQGRPISQVKPKDQRITVFYVTGSNLYLKGFDVIGTQVTITGHTQ--------SECFRIVKGANNNKFEDLRTHDGMIGFYLLGGSNNHILNCDAYNNYDSVSEGGKGGN---------FGGHINSSSVGEGKGTGNVFEGCRAWYNSDDGFDLINCFEAVKIINCWSFLNGYKP---SVIPQHEVRNSLAYYNRLRGFYANHLGGIIFESNTAVNSGEN-----YNMTNRESPLALPPTDVNGYDHMVKNNLSLVTRSGSKHIVNRAKSEVSNNSFDGSE.......................................... 380
10 -21.5001ru4_A mol:protein length:400 Pectate lyase  ali model follow..  1...........................................................ADCSSDLTSGISTKRIYYVAPNGNSSNNGSSFNAPMSFSAAMAAVNPGELILLKPGTYTIPYTQGKGNTITFNKSGK----------------------DGAPIY---------------------VAAANCGRAVFDFS---------------FPDSQWVQASYGFYVTGDYWYFKGVEVTRAGYQGAYVIGSHNTFENTAFHHNRNTGLEINNGGSYNTVINSDAYRNMADGFGPKQKQGPGNRFVGCRAWENSDDGFDLFDSPQKVVIENSWAFRNGGNGFKLGGNQNHRITRSVAFGNVSKGFDQNNAGGVTVINNTSYKNGINGSNVQSGQKHYFRNNVSLSASVTVSNADAKSNSWDTG.................................................................. 335
11 -20.8005mqp_A mol:protein length:624 Glycoside hydrolase BT_1002  ali model follow..  251..............................................................................................................................TNARELLDVAGEWYHDIDARKVYYYPREGEKLQDAGTEVIVPAIETL------------IQVKGTFDRPVSHIRFEKITFSHTTWMRPSEKGHVPLQAGMYLDYLNHPLDNQGWLGRPAAAVSVAAANQIDFERCRFDHLGSTGLDYEEAVQGGVVRGCLFRD--AGNGLVVGSFCAHQQISNCYFTEWGCLAILA-GYVKDINIEHNEICEVPYSGISLNCMRNNRVHANLIHHYDVAGVYTLGSQKSYVTENCVHSNHWFYLYTDEGSSF----------------ITVRDNWTEGEK--YLQNANGPGNVWENNGPQVDTV......................................... 602
12 -20.7002v5i_A mol:protein length:559 SALMONELLA TYPHIMURIUM DB7155 BACTERIOPHAGE DET7 TAILSPIKE  ali model follow..  10  24...........................................................................................SDYSTLQDAVTDAVDGLLIDI-NYNFTDGESVILTINCKAKFIGDGALIFNNMGPGSVINADGKWITDAALVAATLKQSKIEGYQPGVNDWVKFPGLEALLPQNVKDQHIAA---------------------TLDIRSASRVEIRN--AGGLMAAYLFRSCHHCKVIDSDSIIGGKDGIITFENLSGDWGLGNYVIGGRVHYG---GGESHNGGVIGVTSWRAGESGFKTYQGNYNLQFRDSVALSPVWDGFDLGSDPGMAPEPDRPGDLPVSEY-HQLPNNHLVDNILVMNSLGVGLGMDGSG------------------GYVSNVTVQDCAGAGMLAHTYNRVFSNITVIDCNFDSDQIIIIGDCIVNGIRAAGIKPQPSNGLVIS--APNSTISG 421
13 -18.7005g5o_A mol:protein length:373 LH3 HEXON-INTERLACING CAPSID PROTEIN  ali model follow..  33...............................................................................................PGQSPDEAFARNSVVFLVPGAEYNWKNVVIRKP--VWIYGNGATVKTSGLGPIIHIMGDLDNPMDVRIQD---------------------LTFIGGDSPDRLVPFSA--------------------------------------VLTNQMALWCIDPRITIRGCSFYNFGGAAIYLERSERDTGFRFG----------------RGQVMITDCRFRGCR-IGIANGGSVEYGLASQNNFSDCQ-ICFNV-VGGNWTRSGNVASNCRCMYLHTQGMAHGSFTSNTLNHCDYGGNLWPTEPDRVINLAGFYFDNAAARLPNFSGNSQWYGDMKLINFLPDSTFVINGGALYGGPGDTGVIAVATAL--AAKVFVIGCQGNAGQQIVNVPAANIIPE 360
14 -18.2003riq_A mol:protein length:543 Tailspike protein  ali model follow..  18...........................................................................................SDYMTLQEAATAAVDSLLI---DIDYNFIDGEAVDFGGKVKFIGDGVLNWNNLGSGSKVISPHMHTKTTPYTVYRFDDNGNWVTNPTTVLASVAQRLDKGYKPNVNDHDIWASLPDNVKNQVAGATLRVNSANNIIF----------THPEATMGGYLFTLCNHILVESPRNFIAWESGITFENHHTTAWGTGNKVVGGGSGSAVLFIRNDHDGGVRDLISYRVGESGVKTYQNNYRLVFDNITTIQCYYDGIDVNADTQHIIRNIITRDCMGIGAWW-DGQKNIIDNVVTYEAHKEGMFDRGTNNDIT-------------NITVVCANKDLTNLNQIVCEGGS--RLRGIMVHAYTTQGYAVYAPSSEVSNVSCAGSGTKKILCTYVADIQGGNI... 430
15 -18.0004mr0_A mol:protein length:648 Plasmin and fibronectin-binding protein A  ali model follow..  122.........................................................................................IHDDRQAIQDAIDAAAQGGNVYFPEGTYLVKEIVFLKSHTHLELN-----------EKATILNGINI----------KNHPSIVFMTGLFTDDGAQVEWGPTEDISYSGGTIDMNGALNEEGTKAKNLPLINSSGAFAIGNSNNVTIKNVTFKDSYQGIQIAGSKNVLVDNSRFLGQALESIQIEPKSENVTIQNSYFGKSDKSGELVTAIGTSNIKILNNHFDNMMYAGVRF-TGFTDVLIKGNRF-DKKVKGESVHYRSDITVTKNVINNNSKENIELLRVSDNLVVSENSIFGGKEGIVIEDSKGK----------------ITVLNNQFYNLSGKYISFIKSNANGKEPVIRDSDGNFNIVTENGLYKIVTNNLSEKEKNKEEKQSNSNNVIDSNQKN 588
16 -16.4003zpp_A mol:protein length:443 CELL WALL SURFACE ANCHOR FAMILY PROTEIN  ali model follow..  30.........................................................................................IHDDRQAIQDAIDAAAQGGNVYFPEGTYLVKEIVFLKSHTHLELN-----------EKATILNGINI----------KNHPSIVFMTGLFTDDGAQVEWGPTEDISYSGGTIDMNGALNEEGTKAKNLPLINSSGAFAIGNSNNVTIKNVTFKDSYQGIQIAGSKNVLVDNSRFLGKTMKDGQI-ISKESIQIEPLTRKGFPYALND--GKKSENVTIQNSYFGKSDKSG--------------VTAIGTHYQTLSTQNPSNIKIQNNHFDNMMYAGVRFTGFTDVLIKGNRF-DKKVKGESVHYRESGAALVNAYSYKNTKDLLDLNKQVVIAENKDSAEYLGKVSDITVTKNVINNNSKETEQPNIELLRVSDNLVVSENSGGKEGIVIEDSKGKITVLN 421
17 -16.2002vbe_A mol:protein length:514 TAILSPIKE-PROTEIN  ali model follow..  64.........................................................................................VTDNYQAIQNAIDAVASGGELFIPASNQIVGSTLLIPGGVNIRGVGKASQLRAKSGLTGSVLRLSY---------------------------------SDTIGRYLRNIRVTGNNTCNGIDTNITAE-------DSVIRQVYGWVFDNVMVNEVETAYLMQGLWHSKFIACQAGTCR-VGLHFLGQCVSVSVSSCHFSRADESFGIRIQPQSEAIILDSETMCIGFKNAVYVH-DCLDLHMEQLDLDYCGSTGVVIENVNGGFSFSNSWIAADADGTEQFTGIYFRTPTSTQSHKIVSGVHINTANKNTAANNQSIAIEQSAIFVFVSGCTLTGDEWAVNIVDINECVSFDKCIFNKP........................................... 402
18 -14.1004ru4_A mol:protein length:602 tail spike protein gp49  ali model follow..  13  52...........................................................................................SDEIDWAALQAAVDSGAPVHIPSGDYQINRGISSTGSLQIAGDGATSIIRVSAGSLTIDFASTPNLVAGDVFIIYNPTDSSFSGFRTSYRAGEFCEVRAVSGNTVATVAIYKVVSGVVDIASIQIVGGTVPMNGLLVEAVVSPRVDDVTVTLNNAGVYFARCYDAKITNSNISNGDDYGIIF-GNCHDGGADNCKVYARR--HAIATGGDAENVRMRNCTLRNDITSGADFHGNAEDCSYENCTIYGGATWQ-----GKDISYRHCTITNASGGWIVISAGGTFLLDQCTLYTTGDPQPGNRGVIDVGGNSAVLTTNTTQPCNFLIQGGSLRAPS................................................................. 433
19 -11.0004ru5_A mol:protein length:605 tailspike gp27  ali model follow..  10  48...........................................................................................TDSIDWAAYQAAINSGPHVHAPGGHYVMNRGTLAERDIRYTGDGYATRVDFSLADGSVVKGARTLTFAAAPVYNPANGSWLADRDPYRAGEMWKVHSVSGSTVTIYGNSSSVYLFSEVDVYRMRSPSDTYAIAPFRVVFGDGVKVSNYYASDRYTGLEVERCFDVSINAVSSPNNDEYGITI-SNCHNFSVYGGYAAATR--HAVALGGMDAVCCVIEGIDIDSDIGAGDMHGNADKITYDNCEFRN----GVIL-QGRDATVRNSTIYGVSSVS----YGGTYTIENNRFISYGNGA-SQREALLIIARNNTFELPNATGSTKVLFLRGRNSPLPCSVNIDG---MHVHMAPVAMQCFLFADDQVAATLNSNYLIIDGVYGPSGTYLLYPTSKNAAIP. 508
20 -10.8004y9v_A mol:protein length:625 Particle-associated lyase  ali model follow..  11  57...........................................................................................LPSEDISTVLNQVDGVKKLHVKSREYIVNSLIEFTDDFEFVNETGT---VFNFGDTGGFYASGSHTQITTLASDIVKNQSQSFDVADASQIQKGLVIYCTDDASVSGNTVK--------FGRAYDNYLTSENIVILKVNPINFKFNYLKTNNPNVPLVIDYARNFETGYFENKGGKFAGLRL-RRCFNFNIAINSAKNNTLNYGIQIS-NCQNYNYFGGSN-NSTRHAVAIGGDGDLGCVERTVYDHCTTNYATF-GAGDNEYSNCDIYEREGQGCVLIAGGEFKLTNNTYYTKT-------PLNSWSLVHGIIEKQLHEDLTVKLDGGCINGVGGASAGIVTIRQSNALNEALTKK........................................... 452
21 -10.6003izo_F mol:protein length:581 Fiber  ali model follow..  33....................................................................................................................................................FVSPNGFQESPPGVLSLRLSEPLVTSNGMLALKMGNGLSLDEAGNLTSQNVTTVSPPLKKTKS-----NINLEISAPLTVTSEALTVAAAAPLMVAGNTLTMQSQAPLTVHDSKLSIATQGPLTVSEGKLALQTSGPLTTTDS---STLTITASPPLTTATGSLGIDLKEPIYTQNGKLGLKYGAPLHVTDDLNTLTVATGPGVTINNTSLQTKVTGALGFDSQGNMQL-------NVAGGLRIDSQNRRLILDVSYPFDAQNQLNLRLGQGPLFINSAHNLDINYNKGLYLFTASNNSKKLEVNLSTAKGLMFDATAIAINAGDG................. 343
22 -10.3001qcx_A mol:protein length:359 PECTIN LYASE B  ali model follow..  10  107............................................................................................................................................................................................................................................................NSNKSIVGQGTKGVKGKGLRVVSGAKNVIIQNIAVTDINGGDAITV-DDSDLVWIDHVTTARIGRQHIVGTSADNRVTISYSLIDGRSDYSATCNGHHMVTLKGNYFYNLSGRMPKVQGNTLLHAVNNLFHNFDGHAFEIGTGGYVLAEGNVFQDVNVVVETPISGQLFSSPDANTNQQCASVFGRSCQLNAFGNSGS......................................... 321
23 -10.1003jur_A mol:protein length:448 Exo-poly-alpha-D-galacturonosidase  ali model follow..  12  41..........................................................................................TDCSESFKRAIEELSKGGRLIVPEGVF-LTGPIHLKSNIELHVKGTIK-VYALDCENVAITGSGVLDGSADEMAERGTPVEERVFGKGHYLRPSFVQFYRCRNVLVEGVKIINSPMENVIIRNIEISSTGPNNDGIDPESCKYMLIEKCRFDTGDDSVVIKSGRD------------ADGRRIGVPSEYILVRDNLVISQASHGGLVIGSEMSGNVVARNNVYMNVERALRLKTNSRRGGYMENIFFID----NVAVNVSEEVIRKNLKATGGKYAVRIEGLENDYVKDILISD-----TIIEGAKISVLLE---------FGQLGMENVIMNGSRFEKLYIEGKALLK.................................................... 448
24 -9.8502uve_A mol:protein length:608 EXOPOLYGALACTURONASE  ali model follow..  10  170..........................................................................................TLNTKAIQQAIDSCKPGCRVEIPAGTY-KSGALWLKSDMTLNLQAGANNSKPGTFRNIRITGSGVIDGNGWLRAKTAEITDELGRSLPQYVASK-MTLRGVENVYLAGFTVRNPAFHGIMNLENHNVVA-------------NGLIHQTYDANNGDGIEFGNSQNVMVFNNFF-DTGDDCINFAAGMKGAWLFNNYFRMGHG--AIVTGSHTGADILAENNVMYLTDIGLRAKSTSTIGGGARNVTFRN----NAMRDLAKQVMVMTLDYADSNANIDYPPAKIPAQFYDFTLKN----VTVDNSTGKNPSIEIKGDTANKAWHRLVHVNNVQLNNVTPTAISDLRDSEFNKVTFTELRGDTPWHFSEVKNVKVDGK........................ 604
25 -9.7201air_A mol:protein length:353 PECTATE LYASE C  ali model follow..  14  85...................................................................................................................................................................................................................................KEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYKDGDMIRV-DDSPNVWVDHNELFAANHEC-VDIKGASNTVTVSYNYIHGVKKVGSSSSDTGRNITYHHNYYNDVNARLPLQRGGL---AYNNLYTNITGSGLNVRQNGQALIENNWFEK........................................................................................................... 259
26 -9.4601rmg_A mol:protein length:422 RHAMNOGALACTURONASE A  ali model follow..  11  34..........................................................................................TDVGPAITSAWAACKSGGLVYIPSGNYALNTWVTLTGGSATAIQLDGIIYRTGTASGNMIAVTDTTDFELFSSTS--------------------------------KGAVQGFGYV---------AEGTYGARILRLTDVTHFSVHDIILVDAAFHFTMDTCSDGEVYNMAIREGGLDGIDV--WGSNIWVHDVEV--TNKDECVTVKSPANNILVES--IYCNWSGGCAMGSLGADTDVTDNVYTWSSNQMYMIKSNGGSGTVSNVLLEN----FIGHGNAYSLDIDGYWSSMAGDGVQLNNITVKNWKGTEANGATRPPIRVVCSDTAPCTD----LTLED......................................................... 335
27 -9.4003lmw_A mol:protein length:473 Iota-carrageenase, CgiA  ali model follow..  37..........................................................................................SDDSNALQRAINAISRGGTLLIPNGTYHFL-GIQMKSNVHIRVESDVIIKPTWNGDGRLFEVGVNNIVRNFSFQGLGNGF-LVDFKDSRDKNLAVFKLGDVRNYKISNFTIDD------NKTIFASILVDVTERNGRLHWSRNGIIERIKQNNALFGIQTYGADNILFRNLHSEGGIALRME----------TDNLLMKNYKQGGI-------RNIFADNIRCSKGLAAVMFHFMKNGDVQVTNVSSVSCGSAVRSDSG-ELFSPTDEVHTRQSWKQAVESKLGRGCAQTPYARGN-------GTRWAARVTQKDACLDKAKLEYGIEPGSFGTVKVFDVTARFGYNADLKQDQL.............................................. 372
28 -9.1105olp_A mol:protein length:452 Pectate lyase  ali model follow..  52..........................................................................................VDNTKAIAAAIDACNKGGRVVVPAGIW-LTGPVHFKSNINLCLEEDAV-LYAFECENVAISGKGTLQPKMGTWKVWFKRPAPHLQALKELYTKASIHFNRCKNVMLDGFKIRESPFDGGIVRNLDVRAHGHNNDGIDFEMSRNFLVEDCSFDQGDDAVVIKAGRN------------QDAWRLNTPCENIVIRNCRILKGHTL-GSEISGGIRNIYMHDCTAPNSVMRLFFVKTNHRRGGFIENIYMKN----VASGTAQRVLEIDTEVLYQWKDLVPTYEKRITRIDGKVTCESADAVYELKGNAELPVKN------------VRIKDVKVGSVKKFVKKVSNVENVVEKNVTYSQKD.......................................... 446
29 -9.0901idj_A mol:protein length:359 PECTIN LYASE A  ali model follow..  107......................................................................................................................................................................................................................................TSNKSLIGEGSSGAIKGRIVSGAENIIIQNIAVTDWGGDAITL-DDCDLVWIDHVTTARIGRQHYVLGTSADNRVSLTNNYIDGVSDYSATCDGYHYWGTMKGNYIYHTSGRSPKVQDNTLLHCVNNYFYDISGHAFEIGEGGYVLAEGN-VFQNVDTVLETYEGAAFTVPSTTAGEVCSTYLGRDCVINGFGCSG................................................................. 319
30 -9.0401bhe_A mol:protein length:376 POLYGALACTURONASE  ali model follow..  23..........................................................................................STATSTIQKALNNCDQGKAVRLSAGSTFLSGPLSLPSGVSLLIDKGVT-ITAVSTTNSGIYGPGTIDGQGGV-VSWWELAADAKVKKLKQNTPRLIQINKSKNFTLYNVSLIN-----------------SPNFHVVFSDGDGFTAWKTTIKTNTDGIDPMSSKNITIAYSNI-ATGDDNVAIKAYKGRAETRNISILHNDTGHGMSIGSETMGNVTVDDLKMNGTTNGLRIKSDKSAAGVVNGVRYSN----VVMKNVAKPIVIDTVYEKKEGSNVPDWSD----ITFKDVTSETKGVVVLNGENAKKPIEVTMKNVKLTSDSTWQIKNV...................................................................... 372

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24