current user: public

If you have questions about the server, please let us know.

Query: 4o4a_A mol:protein length:170 Lipoprotein, putative, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MSSGVDLGTENLYFQSNAKETTDTIYLIPEEYEGDLIVVYNVPGAELLPKEEEFSVVTFAADGTAVTSTKNMKFGTVNDLYYTVNKEGQRTKIDSSCIHFSSTGSRTENSWEFPFANLEVTRTACSQEFSANGREVPENQEHPAEKKMRDLMQRIQERYMNKVKLast
1 -75.8004o4a_A mol:protein length:170 Lipoprotein, putative  ali model  100  1MSSGVDLGTENLYFQSNAKETTDTIYLIPEEYEGDLIVVYNVPGAELLPKEEEFSVVTFAADGTAVTSTKNMKFGTVNDLYYTVNKEGQRTKIDSSCIHFSSTGSRTENSWEFPFANLEVTRTACSQEFSANGREVPENQEHPAEKKMRDLMQRIQERYMNKVK 164
2 -8.4903mqi_A mol:protein length:96 Transcription factor COE1  ali model follow..  24.......................TVIIIGDNFFDGLQVIFGTMLVWSELITPHAIRVQTPPRHVTLSYKSKQFCKGTPGRFIYTALN............................................................................. 93
3 -8.0803r4q_A mol:protein length:160 Lactoylglutathione lyase  ali model follow..  11  71............................RHGAVGQGHFCFYADDKAEVDE----WKTRFEALEIPVEHYHRWPNG--SYSVYIRDPAGNSVEV....................................................................... 129
4 -7.5703ct8_A mol:protein length:146 Putative glyoxalase  ali model follow..  75............................HRKRTGLNHLAFHAASREKV----DELTQKLKERGDPILYEDRHPFAGGPNHYFCEDPNRIKVEI....................................................................... 137
5 -7.5205z7b_A mol:protein length:198 PadR family transcriptional regulator  ali model follow..  13  6......LMTLRSALLALLSSGPLTGYDASQRFGASVGFVWSGSDSQIYPE-----LRKMEAEELLVGSDVPWGSKGATKTEYALSEKGWEA......................................................................... 85
6 -7.4502zfw_A mol:protein length:148 Pex  ali model follow..  52.........................VLRHEDSYGTELIQHLETHWPNYRLSDTVLLKFLEDEQIISGYWKKVEGRGRPRRMYQLAQANDDR......................................................................... 120
7 -7.4302e1n_A mol:protein length:138 Pex  ali model follow..  42.........................VLRHEDSYGTELIQHLETHWPNYRLSDTVLLKFLEDEQIISGYWKKVEGRGRPRRMYQLAQANDDR......................................................................... 110
8 -7.3505t7a_A mol:protein length:118 BH0236 protein  ali model follow..  10  37..................TGNEVTIFFAPTTEARYVDVHLKVNNGQQMTERNGEWERVVESSGDVL-------------EYSFTYEKLG........................................................................... 100
9 -7.2205dym_A mol:protein length:117 PadR-family transcriptional regulator  ali model follow..  10  25........................VSILEKKDCYGYEIAKQVRERSEFELKEGTMLKRMESKNLIKSYYSNEQSSGGRRKYYNLTNEGKDF......................................................................... 94
10 -7.0502dql_A mol:protein length:115 Pex protein  ali model follow..  12  30.........................VLLQGESYGTELIQQLETEHPTYRLSDTVLIKFLEDNRAITGYWKKLEGRGRPRRMYQVSPEWQHQ......................................................................... 98

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24