current user: public

If you have questions about the server, please let us know.

Query: 4r2n_A mol:protein length:367 Putative phenylalanine aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360
# Score Template Links and tools%idFirst MVTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCVQLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDKVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWRSDQKLAAALELast
1 -115.0004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model  100  1MVTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCVQLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDKVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWRSDQKLAAALE 361
2 -101.0003ffh_A mol:protein length:363 Histidinol-phosphate aminotransferase  ali model follow..  28  3..AMKWKKSLAGLSSYKPGKREEEVTKLSSNENPLGTSKKVAAIQANSSVETEIYPDGWASSLRKEVADFYQ--LEEEELIFTAGVDELIELLTRVLLDTTTNTVMATPTFVQYRQNALIEGAEVREIPLQDGEHDLEGMLNAIDEKTTIVWICNPNNPTGNYIELADIQAFLDRVPSDVLVVLDEAYIEYV-TPQPEKHEKLVRTYKNLIITRTFSKIYGLASARVGYGIADKEIIRQLNIVRPPFNTTSIGQKLAIEAIKDQAFIGECRTSNANGIKQYEAFAKRFKVKLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSGFPTAVRITIGKEEDNSAVIALLEKLL.......... 363
3 -101.0003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  26  3....KFNEFLNNLSNYEPGKDIEVIIKLASNENPFGTPPKAIECLRQNANKAHLYPDDSMIELKSTLAQKYK--VQNENIIIGAGSDQVIEFAIHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSTHNLDEFKKLYETHKDEIKLIFLCLPNNPLGECLDASEATEFIKGVNEDCLVVIDAAYNEFASFKDSKEPCELIKEFDNVLYLGTFSKLYGLGGLRIGYGIANANIISAFYKLRAPFNVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDENSTDLSEKLLKKGIIIRNLKSNAIRITIGTSYENEKFFTEFDKILR......... 365
4 -98.5003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  24  2...........ETQPESAAFTTDNPIRINFNENPLGMSPKAQAAARDAVVKANRYAKNEILMLGNKLAAHHQ--VEAPSILLTAGSSEGIRAAIEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMDNWAFDIEGLKAAVAAYSSIVYLVNPNNPTGTITPADVIEPWIASKPANTMFIVDEAYAEFVNDPRFRSISPMIQGAENIILLKTFSKIHAMAGMRVGYAVAHPTVIALMGRYVAGEKINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNFVFHQLVVPLKDYQTHMADAGVLIGRAADNWCRISLGTPQEMQWVADTMREFRKKS....... 352
5 -97.8004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  31  6.AFSRFTPLIQSLPASVPFVGPEALARIGANESGFGPAPSVLLAIRQAAGDTWKYADPENHDLKQALARHLG--TSPANIAIGEGIDGLLGQIVRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADDREDLEGLLAAVGENAPLVYLANPDNPMGSWWPAERVVAFAQALPETTLLVLDEAYCETAPRDAL-PPIESLIDKPNVIRARTFSKAYGLAGARIGYTLSTPGTAQAFDKIRNHFGMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDRAIVDRLMSDHGIFIRMPLNRCIRISTAPDAEMDLLAAALPEVIRSLAAT.... 376
6 -96.5003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  27  1MSLIPLRQNIASMKGYIPGYQPPDIIKLNTNENPYPPSPEVVKAILEELGALRIYPSASSQKLREVAGELYG--FDPSWIIMANGSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTG---DFRIAGFPERYEGKVFFLTTPNAPLGPSFPLEYIDELARRCAG--MLVLDETYAEFAES----NALELVRRHENVVVTRTLSKSYSLAGMRIGLAIARPEVIAALDKIRDHYNLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPDDGKRVYDGLYARKVLVRHFLAHGMRISIGTREEMEQTLAALKEIGEG........ 354
7 -94.2003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  29  6LSDLPLREELRGEHAYGAPQL-NVDIRLNTNENPYPPSEALVADLVATVDELNRYPERDAVELRDELAAYIGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGDFRIDMDVALEEIAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPG--IVIVDEAYAEFSPSPSATTLLE--KYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHAAWQAFLDRGVLIRDVIAGHLRTTIGVPEENDAFLDAAAEIIKLNLSAWS.. 370
8 -92.8004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  30  11LDDLPLRADLRGKAPYGAPQL-AVPVRLNTNENPHPPTRALVDDVVRSVRELHRYPDRDAVALRADLAGYLTIQLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRNDFGLDVDVAVAAVVDKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPG--IAIVDEAYGEFSSQP---SAVSLVEEYPKLVVTRTMSKAFAFAGGRLGYLIATPAVIDAMLLVRLPYHLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDANFVLFGEFADAPAAWRRYLEAGILIRDVIPGYLRATTGLAEENDAFLRASARIATDLVPVTRSP 377
9 -92.1003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  24  2..........MSVGEAMDTEAAAQAVCLAFNENPEAVEPRVQAAIAAAAARINRYPFDAEPRVMRKLAEHFS--CPEDNLMLVRGIDECFDRISAEF--SSMRFVTAWPGFDGYRARIAVSGLRHFEIGLDDLLLDPNDLAQ--VSRDDCVVLANPSNPTGQALSAGELDQLRQRAG---KLLIDETYVDYSS-----FRARGLAYGENELVFRSFSKSYGLAGLRLGALFGPSELIAAMKRKQWFCNVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEANFVLVENA-AGERTLRFLRERGIQVKDALHHHIRISIGREEDNDRLLAALAEYSDHS....... 337
10 -89.8002f8j_A mol:protein length:347 Histidinol-phosphate aminotransferase  ali model follow..  26  1............MGSDKIMNPLDDKTYLALNENPFPFPEDLVDEVFRRLNSLRIYYDSPDEELIEKILSYLDTDLSKNNVSVGNGADEIIYVMMLMF----DRSVFFPPTYSCYRIFAKAVGAKFLEVPLTK------RIPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL---KTGAFVALDEAYYEFHGE----SYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMFAKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEKERLLEHLRTKNVAVRSF-REGVRITIGKREENDMILRELEVF........... 340
11 -89.4003euc_A mol:protein length:367 Histidinol-phosphate aminotransferase 2  ali model follow..  28  9LIERIIRDDVRAMGAYHVPDS-HGLVKLDAMENPYRLPPALRSELAARLGELNRYPVPSSEALRAKLKEVMQVP-AGMEVLLGNGSDEIISMLALAAARPGAKVMAPVPGFVMYAMSAQFAGLEFVGVPLRDFTLDRGAMLAAMAEQPAIVYLAYPNNPTGNLFDAADMEAIVRAAQGSVLVVVDEAYQPFAQE----SWMSRLTDFGNLLVMRTVSK-LGLAGIRLGYVAGDPQWLEQLDKVRPPYNVNVLTEATALFALEHVAVLDEQAAQLRAERSRVAEGMAAHGVTVFPSAANFLLARVP-DAAQTFDRLLARKVLIKPLLANCLRVTVSTPEENAQFLEAFAASLQD........ 367
12 -88.3001fg3_A mol:protein length:356 HISTIDINOL PHOSPHATE AMINOTRANSFERASE  ali model follow..  24  6.ITDLARENVRNLTPYQSARRLNGDVWLNANEYPTAVEFQLTQQ------TLNRYPECQPKAVIENYAQYAG--VKPEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTDNWQLDLQGISDKL-DGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAIVVADEAYIEFCPQA---SLAGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVIAPYPLSTPVADIAAQALSPQGIMRERVAQIIAEREYLIAALKEIPCQVFDSETNYILARFK-ASSAVFKSLWDQGIILRPSLSGCLRITVGTREESQRVIDALRAE........... 354
13 -80.0003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  19  1.....MYQKFKGGDLMIHGGDIRELLDYSSNINPLGIPKSFLNNIDEGIKNLGVYPDVNYRRLNKSIENYLK--LKDIGIVLGNGASEIIELSISLF----EKILIIVPSYAEYEINAKKHGVSVVFSYLDNMCIDYEDIISKI-DDVDSVIIGNPNNPNGGLINKEKFIHVLKLAEEKKTIIIDEAFIEFTGDPSS-SFVGEIKNYSCLFIIRAMTKFFAMPGIRFGYGINNKEIAAKIKAKQNPWNINCFAEMAAINCLKDTNYIEESLLWIKKERKRFIEELNKIGFRVFSPHANFVLCRLENSGEKLYDSLLKEDIVIRRLDDSFVRFAIKDEKKNTKFLRALKGVENN........ 360
14 -79.2003fkd_A mol:protein length:350 L-threonine-O-3-phosphate decarboxylase  ali model follow..  18  11..................TPLSSEIVNFSTTVWTDGDKDHLEKHLVENLNCIRHYPEPDAGTLRQMLAKRNS--VDNNAILVTNGPTAAFYQIAQAF--RGSRSLIAIPSFAEYEDACRMYEHEVCFYPSNE------DIGEADFSNMDFCWLCNPNNPDGRLLQRTEILRLLNDHP-DTTFVLDQSYVSFTTEE--VIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLGVEVHPSGTTFFLLRLKKAAELKKYMLEEYNMLIRDLDESYVRITTQRPAQNQLFIKALETFLEKYE...... 343
15 -78.8001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  22  20..................GISPDQLLDFSANINPLGMPVSVKRALIDNLDCIERYPDADYFHLHQALARHHQ--VPASWILAGNGETESIFTVASGL--KPRRAMIVTPGFAEYGRALAQSGCEIRRWSLRDGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSNINLILDEAFIDFI--PHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAMARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLTVYPGRANYLLLRCEREDIDLQRRLLTQRILIRSLDSRYYRVAIRSAAQNERLLAALRNVLTGIAPA.... 363
16 -52.3003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  15  22......................DFVVNLDHGDPTAYEEYWRKMGDRCTVSDMTNLCWFLEPELEDAIKDLHGAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEGD--------AWGFDKKGPYIELVTSPNNPDGTIR--ETVVNRPDD--DEAKVIHDFAYYWP-------HYTPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKKMVIVNSIGVSKESQVRTAKILNSENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKEETDLVSELRRHKVMSRAGEKKHVRVSMLSREDVNVFLERLANMKLIKSID.... 390
17 -48.2003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  17  20...................TPKKRGLDLGIGEPQFETPKFIQDALKNHTHSLNIYPKSAFESLRAAQRRRFKIELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPSLNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKDFILINDECYSEIYENTPPPSLLEACEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRA-YTSANAIQKASEAAWLDDRHAEFFRNIYANNLKLARKIFKNT---LIYPYSFYVYLPVQNGENFAKTLYQNEGIITLPALADYVRLALVYDTPLEKPLEIIETYREN........ 374
18 -47.9002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  21  26.......................GLIDLSIGSTDLPPPEAPLKALAEALNDTYGYCLKSCTPFLEEAARWYGVGLDPREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLEDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKGLWLIHDNPYVDQVYEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGDFNQYAGVLRMGVEALKPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEDDLEFGLRLVERGVALAPGRKGFVRIALVRPLEELEAAKRIREALD......... 376
19 -47.4001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  24  26.......................GAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYPPAGLPALREALAEEF--AVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDGFRLDLSALEKALTPRTRALLLNTPMNPTGLVFGERELEAIARLARADLFLISDEVYDELYYGERPRRLREFAPE--RTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQSFSAPTPLQAGVAEALKREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLM-AELPGWDAFRLVEEARVALIPASKDLFRFAFCKTEEEHLALERLGRVVNSPREAEG.. 376
20 -46.6002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  19  20.LANIPDSYFGKTMGRKIEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTINQKYGAFHGKAFKQAIVDFYNVTLDKEEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLPHYLPDWSKVDSQIIDKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGDTKIVHDFAYGAFGFDAKNPSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTNAGMFGALQDAAIYALNYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVTPPGYDSEQFEQFLVQESILVAPGKNRYVRISLALDDQKDEAAIRLTELAYLYE...... 398
21 -45.9005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  16  17.......................LALNSELNIADGHARQALSPGQQKIVNELVLWAESEQREAHQAYFTLLGYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEED--ALHGADLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEGTVLALDTSFRGFDAAAHYDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYS-LGVSPLILALIREFSRDDGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVERVGRTGTEVWEELQRHHVFALPCRDHMVRIALSRSTEPEKSVQVLRTVLETR....... 376
22 -45.8001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  25  31......................VDLVALTAGEPDFDTPEHVKEAARRALAQKTKYPPAGIPELREALAEKFGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETEGFVPDPERVRRAITPRTKALVVNSPNNPTGAVYPKEVLEALARLAVEDFYLVSDEIYEHLLYEGEHFSPGRVAPE--HTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSS--SPDTIAQWATLEALASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLPIAPDEVRAAERLLEAGVAVVPGTFGHVRLSYATSEENRKALERFARVLGR........ 384
23 -45.3001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  21  35......................EDVINLTAGEPDFPTPEPVVEEAVRFLQKEVKYDPRGIYELREGIAKRIKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETKNFQPSLEEVEGLLVGKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKNFYIISDEVYDSLVYTDEFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQS--CINTVAQYAALKALEVDN--SYMVQTFKERKNFVVERLKKMGVKFVPEGAFYLFFKVRGDDVKFCERLLEEKKVA--LKPGFVRLSFATSIERTEALDRIEDFLNSR....... 383
24 -45.3002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  19  29......................KKVIHLEIGEPDFNTPKPIVDEGIKSLKETHYTDSRGILELREKISELYKADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDF-----TVESLEEALSDKTKAIIINSPSNPLGEVIDREIYEFAYEN---IPYIISDEIYNGLVYEGKCYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLSAPTISQYAALKAFEKEREINSMIKEFDRRRRLVLKYVKDFGWEVNPIGAYYVFPNIGEDGREFAYKLLKEGIGFGSKGKNYIRISYANSYENKEGLERIKEFLNK........ 370
25 -45.0003jtx_A mol:protein length:396 aminotransferase  ali model follow..  19  9.LKPYPFARLHEAMQGISAPEGMEAVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLELRQACANWLGLTVDADEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANCPSFNPDWRSISEEVWKRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKGFIIASDECYSEIYFDGNKPLGCQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTGSAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGDDLAFARWQKAAIQVLPGREGYVRIALVADVATVKAAEDIVSLYR......... 396
26 -44.7003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  17  57......................RELINLGQGFFSYSPPQFAIKEAQKALPMVNQYPTRGRPSLINSLIKLYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPIEEWTIDFEQFEKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKNVVIISDEVYEHLYFTDSFTRIATLSPEGQLTLTVGSAGKSFAATGWRIGWVLSLNELLSYAAKAHTCFASPSPLQEACANSINKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLNKGKDFRISHWLINELGVVAIPPTENLLRFAVCKDDAYENAVERLKLLKDY........ 446
27 -44.3003ele_A mol:protein length:398 Amino Transferase  ali model follow..  19  35......................ENVYDFSIGNPSIPAPQIVNDTIKELVTDLHGYSAQGDVETRAAIAEFLGTHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPAEHFQIDFDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDEIGRPIFIIADEPYREIVYDGIKVPFVTKYYD--NTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAA-VCAPSLFQKMIVKCQG----ATGDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMFVLEDDSNAFCEKAKEEDVLIVAADPGWVRISYCVDREMKHSMPAFEKIYKKYN...... 397
28 -44.1004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  18  1MAKQLQARRLDGIDYFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGLNQYKTFGYPPLTKILASFFGQEIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQDVVCITDEVYQWMVDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQVFHCPTQSQAAVAESFERSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLIDEPYDRRFVKWMIKNKGLVAQKHFDHYIRFCFVKDEATQAMDEKLRKWKVELENLYF.. 427
29 -44.0003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  21  31......................RRIIHMEVGQPGTGAPRGAVEALAKSLETLGYTVALGLPALRQRIARLYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVPADFAGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAGASFISDEIYHGIEYEAKAVTALEL---TDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMCAPHASQVAALAALDCDAELQANLDVYKANRKLMLERLPKAG--APPDGAFYVYADVSDDSRAFAAEILEKGVAVTPGLAGTLRFSYARATADEEGLDRLEAFMQARG...... 383
30 -43.8004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  19  11RGSHMSSLRPRREDPPV-GPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAMDDSVSQGGEGVRRAIADRYA-GGDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRDGEIDPDVLAGLVTPGTAAVIVNFPHNPTGVTLSPQGLRALKERTAAGAVLVWDAATAEIAHRWEVLADPG--ADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDTLFLSPLVELVAERAVRHDELIGARAAEARHNLAHLTGWMAAHE--TPPEGGVCALPVFPQEVERFCLELLERRTLLVPGAPHGARLGFGGPQEDRAGLDGLSRFLRERAAGR... 400
31 -43.8001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  21  22..................AAGMKDVISLGIGEPDFDTPQHIKEYAKEALDKLTHYPNIGLLELREAIAEKLGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTDEFRLNVDELKKYVTDKTRALIINSPCNPTGAVLTKKDLEEIADFVVEDLIVISDEVYEHFIDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQM--CPVTFIQYAAAKALRSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFDTGLTSKKFSELMLKEGSAFGKAGEGYVRISYATAYEKEEAMDRMERVLKERK...... 387
32 -43.8001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  21  31.......................QAINLSQGFPDFDGPRYLQERLAHHVAQANQYPMTGVQALREAIAQKTGYQPDADDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQHFRVDWQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGEIFVISDEVYEHINSQQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQTFSVNTPAQLALADMLREPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLL-STLDDVEFCQWLTQEHGVADPFPHKLIRLCFAKKESTLAAAERLRQL........... 386
33 -43.7002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  21  37......................EDIIDLSMGNPDGPTPPHIVEKLCTVAQRTHGYSTSRGIRLRRAISHWYDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLIDFFNELERAIRESIPKPRMMILGFPSNPTAQCVELDFFERVVALAKQDVMVVHDLAYADIVDGWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSDYGTFTPLQVAAIAALEDQQCVRDIARQYQQRRDVLVKGLREAGWMVEPKASMYVWAKIPEGSLEFAKKLLQDKVSVSPGIDDHVRFALIENRDRRQAVRGIKAMFRADGLLSPQR 405
34 -43.6001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  20  38.......................KPLNLGQGFPDYHAPKYALNALAAAANSANQYRGFGHPRLVQALSKLYDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKDWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKNVLCVSDEVYEHMVEPFEHIRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQVYTCATPIQEAIAVGFETECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVTDARKDYRFTKWMTKSVGLQKHLGEDFVRYCFFKKDENQKAAEILRKWKGSS....... 429
35 -43.5006DK6 Entity 1(prereleased)  ali follow..  17  36......................QRLIRCGIGDVTEALPEAVRYAMHEAVDELKGYPEQGYDFLRNAIADNDGLPIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYA-ENGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYAREGSVLLYDAAYEAFIDPTIPHSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQ-GASYIVQKGAEALYTDKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVCPAGLTSWQMFDKMLNENVVITPGSEGYFRISAFNSRAN--VEEVCRRIAA......... 409
36 -43.4004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  19  21MSPIEKSSKLENVCYDIRGEEGNKVLKLNIGN-GFDAPDEILVDVIRNLPTAQGYDSKGLYSARKAIMQHYMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCSDWFPDLDDIRAKITPRTRGIVIINPNNPTGAVYSKELLMEIVEIARQNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEMRLCANVPAQHAIQTALQSISEFITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFNIHDDQKMVLDFLLQEKVLLVQGTPDHFRIVTLPRVDDELSLSKFARFLSGYH...... 423
37 -43.4002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  19  38.......................RIHHLNIGQPDLKTPEVFFERIYENKPEVVYYHSAGIWELREAFASYYRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTREEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERGLFLIVDEVYSEIVFRGEFASALSIESD--KVVVIDSVSKKFSACGARVGCLITRNEELISHAMKQGRLAPPLLEQIGSVGLLNDDSFFDFVRETYRERVETVLKKLEEHG--TKPSGAFYITAELPEDAEEFARWMLTDTTMVAPLRKKEIRIACVLEKDLSRAIDVLMEGLKMFCSSRI.. 401
38 -43.1002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  21  56......................AQVISLGIGDTTEPIPEVITSAMAKKAEGYSGYAEQGAKPLRAAIAKTFGLGIGDDDVFVSDGAKCDISRL-QVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYM-LSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCGASNISQAGALACLTPEEAMHKVIGFYKENTNIIIDTFTSLGYDVYGKNAPYVWVHFPSSWDVFAEILEKTHVVTTPGSEGFVRVSAFGHRENLEACRRFKQLYK......... 426
39 -43.1002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  24  26.......................GAVNLGQGFPDEDGPPKMLQAAQDAIAGVNQYPGPGSAPLRRAIAAQRGVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLRGFALDADALRRAVTPRTRALIINSPHNPTGAVLSATELAAIAEIAVANLVVITDEVYEHLVDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQSYVGGAPFQPAVALALDEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCGYDDSTEFCAALPEKVGVAAIPMSNHLVRFTFCKRDDTDEAIRRLSVLAERPATGVP.. 401
40 -42.9003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  19  39......................GRPVDFSHGDVDAHPTPGAFDSAGVQSGGVQAYEYRGDLGIRDLLAPRLGAPVDADGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDRAGLDLTGLEEAFKAGARVFLFSNPNNPAGVVYSAEEIGQIAALAARGATVIADQLYSRLRYAGASYTHLRAEAAAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQASLRAAGYSQAVLRGWFDEPGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFKLAVAPAEFVKILRLQGTEFSPHTADSVRLNFSQDHEAVAAARRIVTLVERYRA..... 407
41 -42.7003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  15  30........DLVALVTNLEKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREASIYPNLDGLELKQEASRFANIDIPARACVPTVGSMQSFLVANRTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLRGEKLREKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKDVIVIEDLAYFGMDFRKDYLYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPYALSSGATHSAQWGMAAMLDGEYNFRDSVIEYGRKARIMKKMFLDNGFNIVPLADGFYFGYKGMDSSKLIEKFVRYGMCA-SKRNEAMRICTSLLPESPDLEKRLQMLNAEG....... 437
42 -42.7005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  20  25.......................SVVNLGQGFPDISPPSYVKEELSKAADNMNQYRGFGHPALVKALSCLYQRQIDPNEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRDWTFDPRELESKFSSKTKAIILNTPHNPLGKVYTRQELQVIADLCVKDTLCISDEVYEWLVTGHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQFYTCATPLQAALAEAFWPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIDEPYDYKFVKWMTKHKKLTAKPHFEKLVRFCFIKKDSTDAAEEIFRAW........... 410
43 -42.6003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  20  69......................AKIISLGIGDTTEPLPKYIADAMAKAAEGYSGYAEQGQGALREAVASTF-AGRAADEIFISDGSKCDIARI-QMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKGSILVYDAAYALYINPDCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCGASNIVQAGGLACLQPEKEMNAMIKFYKENAQILKTTFTEMGFSVYGDDAPYIWVGFGKPSWDVFAEILERNIVTTPGSEGFVRASAFGSRENLEAVRRFKEAYGKRNAS.... 443
44 -42.5003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  16  27......................VSISSLTLEELFALSGTNPEDFYKKLQGTKLNYWIEGSPAFKKSVSQLYT-GVKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQINGWLPDLEKLRQLIRPTTKMICINNANNPTGAVMDRTYLEELVEIASEGAYILSDEVYRSFS----ELDVPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRTMICAGVFDDLVAQLALAHQEILERNRHILEENLAILDQWIEEELVSYIRPAVVFVKIAVDMPMEDFCLQLLQEGVLLVPGRDGYVRLGFACEQETIKGLEKLSQFLRRFDKEN... 375
45 -42.3004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  19  35STKLVRNVNLEKLKNHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAHGLRGYLEQGNKTLRKAIAETFDLHVKSNEVFVSDGAQSDISRL-QLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKGPNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTGSIIIFDSAYAAFIEDGSPRSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSGASNIAQAGGLACLSGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGVNAPYLWVHFGSKSWDVFNEILENGSGFGPGGEEYLRISGFGRRDHVEASKRLQNFFNTRTKHFT.. 447
46 -42.0004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  19  29...................SDIPDVLKLTLGEPDFATPKHIKEAAKRAIDA-SHYGMAGLLALRQAASAFVHLTYNPDEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTNDFVLTPEMLEEAILEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKPIFVISDEVYAELTYTGESHVSIAEYLP-DQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQ--AATTSVQFAAIEALTGKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIFAQGQDSFKFLQDFAKEGVAFGKYGEGYLRISYAASMETKEAMKRLKEFMEQ........ 390
47 -41.7006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  10  43.......................NLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQATYERFTEAFFQLHRQPLVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDDKLLLIDFCFASFTLFEPELARFDMYELLERYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHT-LNVSPFVLNMLTQYVRDADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAHPELTATDVHRLLSADGVYVLPGRDAYVRMALAREPEMADAMALTRQVLDR........ 404
48 -41.6001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  17  33......................KPIIKLSVGDPTLDKNLLTSAAQIKKLKECNGYPTVGSPEAREAVATWWKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCNDWEADLDEIRRLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEERLPLFSDEIYAGMVFKGKDPNSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGM--PCTVVQAALGEALLNPQEHLDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMDIKTDVEFFEKLLEEENVQVLPGAPGFTRLTTTRPVEVREAVERIKAFCQRHAA..... 415
49 -41.4005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  22  31......................GDLVNLSAGQPSAGAPEPVRAAAAAALHLLGYSVALGIPELRDAIAADYGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCTRFQPTAQML-AEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDADVRLISDEVYHGLVYQGAPQTSCA-WQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFCPPVLSQIAAVSAFTPEAEADGNLASYAINRSLLLDGLRRIG--APTDGAFYVYADVSDDSLAFCSKLLADGVAIAPGIGSFVRISFAGPSGDEEALRRIGSWLPSQ....... 388
50 -41.1003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  16  48......................KTMISLSIGDGNLPTDPEVTQAMKDALDSYNGYPSIGFLSSREEIASYYEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLKSWEIDLKQLEYLIDEKTACLIVNNPSNPCGSVFSKRHLQKILAVAARCVPILADEIYGDMVFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLGPCTIVQGALKSILCRGEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMEFENDVEFTERLVAEQSVHCLPATPNFIRVVITVPEVMLEACSRIQEFCEQHYHC.... 421
51 -41.0001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  22  30......................IDVCSFSAGEPDFNTPKHIVEAAKAALEQKTRYPAAGEPRLREAIAQKLGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTQFKVSPEQIRQAITPKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEGLWVLSDEIYEKILYDDAQHLSIGAASPYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQG--NVCTFAQYGAIAAYESQDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFKTGRSSLDFCSELLDQHQVA--GADDCIRLSYATDLDTKRGMERLEKFLHG........ 386
52 -40.9001xi9_A mol:protein length:406 putative transaminase  ali model follow..  22  32......................IKVIRLNIGD-DFQPPEHMKEAYCKAIKEHNYYDSEGLPELRKAIVEREGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTEDWQPDIDDIRKKITDRTKAIAVINPNNPTGALYDKKTLEEILNIAGEEIPVISDEIYDLMTYEGEHISPGSLTKD-VPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRRIRLCPNTPAQFAAIAGLTPMDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIFPPWKNDKEFVLDVLHNGSGFGEYGAGHFRAVFLPPIEIEEAMDRFEKFMKERLKE.... 400
53 -40.7005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  24  99......................VPVIRLAAGEPDFDTPKVVAEAGINAIREFTRYLNAGITELREAICRKLGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTNNFLLDPKDLESKLTEKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKRLLVLSDEIYEHIIAPATHTSFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQG--GASSIAQKAGVAALGGGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFGLINDSSSLALYFLDKFQVA--GDDSCIRISYATSLDVQAAVEKIRKALEPLRATVS.. 474
54 -40.4003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  16  31......................KTVISLSIGDGNLPTDPEVTQAMKDALDSYNGYPSIGYLSSREEVASYYEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLKSWEIDLKQLESLIDEKTACLVVNNPSNPCGSVFSKRHLQKILAVAERCVPILADEIYGDMVFSDCKYEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLGPCTIVQGALKSILQRQEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMEFENDVEFTERLIAEQSVHCLPATPNFFRVVITVPEVMLEACSRIQEFCEQH....... 401
55 -40.4001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  16  29.............NPYHEVHNTNGIIQMGLAENQL-EAAAFKKNGESIFAELALFQDYHGLAFKKAMVDFMKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWTGVEIVPIHCNGFQITETALEEAYQERVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGILISDEIYSGTASSPSFISVMEVLKDRQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGVSSQTQHLLSAMLSDKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGFCWVDMRHEMELWKKIVYEVHLNISPGSPGWFRVCFANLPERDLAMQRLKAFVGEYYNVPEVN 439
56 -40.0003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  20  33......................HTVINLSIGDTTQPLNASVAEAFASSIARCRGYPDFGLPALRQKLSEDFYRGVDAKEIFISDGAKVDLFRLL-SFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIAQENAFFPEFP-----EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEEILILFDAAYSTFIDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTGASIPAQEAGVAGLSILPQ-LEAIHYYRENSDLLRKALLATGFEVFGEHAPYLWVKPTQSDRDLFDFFLREHIAITPGISGFVRFSSLGKREDLAACERLQMAPALQS...... 394
57 -39.8004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  17  58...................RSTKSNLRLSIGDGNLKTPDIVTEAMVDVVRSFNGYPTVGADNLRQVVSTYWRRFLKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLKSWECDLRAAAGMVDSHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQQIPLISDEIYAEMVLNNGIFTSVADFDTNVPRLILGGTAKYQVCPGWRVGWSILIDDWAVGMERLQLIAGVNSICQEAIARTLCPTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMDLKSDMEFYEKLLDEENVQVLPGMSGFLRATVSRPSAVNEAVDRIIEFCERHK...... 437
58 -39.4001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  19  27.............DPFHPLKNPNGVIQMGLAENQLNPKGSICSEGIKSFKAIANFQDYHGLEFRKAIAKFMEVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRGVQLIPIHCNNFKITSKAVKEAYENKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQNIHLVCDEIYAATVDTPQFVSIAEILDEQDLVHIVYSLSKDMGLPGFRVGIIYSNDDVVNCARKMSSFGLVSTQTQYFLAAMLSDDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGFCWMDLRDSEMSLWRVIINDKLNVSPGSPGWFRVCFANMDDGDIALARIRRFVGVEK...... 428
59 -38.2003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  14  99..................DKFLIDAVNYCHTELGLNRDKVVAEWVNGAVANNYPVPDRCLVNTEKIINYFLANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLNDWEIEPNEIEKLKDPSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKKLMIISDEVYGAFVPNFKSIYSV------YNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLD-LRQLHKRYSSVVLCADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLNNFEQVDFLLKLAEKNGVVLVDGVPGELRVSQANLPTEKQVLELLKEYYEEFKQNN... 533
60 -37.9003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  20  31......................PGAIMLGGGNPAHIPAMQFQTLLTDMVESLCNYGPQGKTALLNALAVLLGWDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFVPEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDEELMKLDRLANQNIPLVIDNAYGVPFPGIIFSEARPLWNP--NIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLGGMGPAMMCEMIKRNDLLRLSETVIKPFIAIIRRYLSEERCLIHPEGAIFLWLWFKDTTELLYQRLKARGVLMVPGHHQCMRMNYVPEPDKEAGVKILAEEIERAWREG... 417
61 -37.5003if2_A mol:protein length:444 Aminotransferase  ali model follow..  18  31......DQPVNMLGGGNPAKIDAVNELFLETYKALGNDNDTGKANSSAIISMANYSNPQGDAFIDALVGFFDWNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHID---ALENLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRDIPLIIDNAYGMPFPNIIYSDAH--LNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLTRFGAAIATPLVANDRIKQLSDNEIKPFYQKLKQALGDYPLMIHPEGAIFLWLWFKDSTLDLYERLKAKGTLIVPSEHECIRMSIAADEQTKVIGEVVRELYDNK....... 444
62 -36.8001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  14  56......................GCSADVASGDEEYWKQHKEASAVLVSPWHRMSYFFNPVSELEKTIKELHNAAAKDRYIVFGVGVTQLIHGLVISLDAPESKVVAHAPFYPVFREQTKYFDKKGY-----VWAGNAANYVNVSNPEQYIEMVTSPNNPEGL---------LRHAVIKGCKSIYDMVYYW-------PHYTPIKYKADEDILLFTMSKFTGHSGSRFGWALIDESVYNNLLNYMTTEGTPRETQLRSLKVLKERDLNTFGFKKLRERWVNITALLDQSDRRMRPPSPSYAWVKCEWEEDKDCYQTFQNRINTQNGVSRYVRLSLIKTQDDDQLMYYLKDMVKAKRKTPL.. 430
63 -36.7003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  16  104......................GKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMESVNLFAVEGGTAAMSMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEDLMILTDDVYGTFADGFQS-----FAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKQMTLFSLFALMDESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLVKQSSTGDMLFRIADEGIVLLPGRRPSGRASLANLNEYRALRQMADELYAQYTQQGNKR 533
64 -36.7002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  18  82.IEGRFERFIAEHRDQEGVKFLGKSLSYVRDQLGLDPAAFLHEMVDGILGC--NYPVPPRMTVSEQIVRQYAVPPESVDLFAVEGGTAAMSLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPINGWQYSDAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEDLLILTDDVYGTFAD--EFQSLFSVCPR--NTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRATLYRELGMPPLENPNSVNYYTLIDLQSTGDMLFRVADETGIVLLPGRRPSGRASLANLNEYGRALRRLADELYEQYKALGKE 531
65 -36.4003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  16  38......................ENVVNGTDEEGNLVFLKTVKEEYLSLSSEHVGYPIAGIPDFLCAAEKECFGNFRPERSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLEHNNFNHEAFQNRVNETNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNVIIGIDVAYLDYSGEKDFFNKFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNNICRPAMRTMANIVADEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTDSANAICEELKKEHIYV--ALANGIRIAACPKCQMTGLAEKIYNAMKS........ 414
66 -36.4004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  17  24.........NNKANAAIEKYGREAVINAADDKGKIIALPSVYDRLDEMDRSIASYPIEGEKDYRKIVIDTLFGPYKPESAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFDDFAFNIDVYKEAIDESDRIASLINGNNPTGYSLSDEEWDEVITFLKEKITLIVDVAYLEFAGDGDQQRKF--LPRNLFVVVAFSMSKSHTAYGLRSGAAVGSKEIIEEFEAARCNWSNGTHAAQNILIELEREQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPTDKAFDIVKDLEKENIFTIPS-AKGIRVAICGEEKIPKLVQRLAFYTNKK....... 413
67 -36.1002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  12  43..................AEAKSTTYNATIGMATNKDGKMFASSLDAMFNDLFPYPPQGIEELRDLWQQKMLRD-NMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQT--KDGHYTTDSLVEALNKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKAKVIAVVDDAYYGLFYEDVYTQSLNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKEVLEAKVSGPLPTQSAVKHVLKNNKQFDKEIEQNIQTKEVVYADQYHSHWQAYDFNSGYFMA--DVDPEALRKHLIDKSIGVIALNATDIRIAFSEKDDIPHVFDSIAKAIDDLR...... 430
68 -36.0002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  17  104......................GKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYIIREMESVNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINNWQYPDSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEDLMILTDDVYGTFADDFQSLFAI------ENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLKQSSTGDMLFRIADETGIVLLPGRRPSGRASLANLNEYDELYAEYSGQAQNLKLAAALE 540
69 -35.0003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  16  91...........................LDSPSFPEDAKKRARRILQACGGNLGSYSASQGVCIREDVAAYIGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLNCWALNVNELRRAVQEDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLDEVYQDYSPDCRFHSFKKVLYENVELASFHSTSKGYGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMD-SREKESVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFQMAPDMFYCMKLLEETGICVVPGSTYHFRMTILPPVEKKTVLQKVKDFHIN........ 486
70 -34.9003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  16  85......................PDLLQREEIKTLFSADSRAKQILAMIPGRTGAYSHSQGIGLRDAIASGIGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLTGWGLETSDVKKQLEDNVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLDEVYQEYVDNKKFHSFKKIVRSLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASYKAEKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFPKAPDAFYALRLLESTGIVVVPGSTWHFRCTILPQEDKPAVISRFTVFHEA........ 483
71 -32.8001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  17  42...........DVISLAGGLPAPETFPVET-------KKIAVEVLEEHADKALQYGTTKGFPLRLALARWMDIPMSKVEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDKGMRVDLLEEKLEERVKIVYVSTFQNPAGVTMSVDRRKKLLELANEDFLIVEDGPYSELRYSGEPTPPIKHFDDYGRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKMEIAKQSIDLNTFGQAIAWKYVENDEHIPKIIEFYKPRRDAMLEALEEY---TKPEGGMFVRVTLPEDTKLMMERAVAKGVAYVPGEKNTMRLNFTPEETIREGVRRLAETIKEEMKRVKG. 417
72 -32.6003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  15  5.ITAAPADPILGLADLFRADERPGKINLGDETGKTPVLTSVKKAEQYLLENTKNYGIDGIPEFGRCTQELLSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYENHTLDFDALINSLQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEGWLPLFDFAQQGFALEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMNPPAHGASVVATILSNEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKMFSFSGLTKEQVLRLREEFGVYAVA----SGRVNVATPDNMAPLCEAIVAVL.......... 396
73 -32.6004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  13  1.MAMGKPDPILGLGQDFRMDPAKRKVNLSIGVRDDADQPFVLECVKQATLGTMDYPVTGIASFVEEAQKLC--RIASCQTLGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYATKGLNLAGMLECLPEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRNHIPFVDMAYQGFATGQLDYDAFVPVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLELKACGSVHDWMMAYTGLTREQVELLRSEYHIYMTLNG----RAAVSNSTNVEYVSQAIHNVTK......... 390
74 -32.1004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  15  7.IDAYPGDPILTLNENFQKDPRDQKVNLSIGIFDAEGRIPVMGAVREAETALKPYPMVGLAAYRDAVQSLVHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYATGGLKFDAMIDALPARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEAELLPFVDMAYQGFGLDADAFAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIGLRDHVSGEALMFTYTGLTESQVDALREVHGVYILR----SGRMCVANDSNVGIVADAIGKVLKSGA...... 402
75 -32.0003fdb_A mol:protein length:377 putative PLP-dependent beta-cystathionase  ali model follow..  17  23......................QGVLPLWVAESDFSTCPAVLQAITDAVQRYQPDGSLLSQATAEFYADRYGYQARPEWIFPIPDVVRGLYIAIDHFTPAQSKVIVPTPAYPPFFHLLSATQREGIFIDAT-GGINLHDVEKGFQAGARSILLCNPYNPLGMVFAPEWLNELCDLAHRDARVLVDEIHAPLVFDGQHTVAAGVSDTASVCITITAPSKAWNIAGLKCAQIISNPSDAEHWQQLSPVIGASTLGLIAAEAAYRYTDFLNQEVAYLKNNHDFLLHEIPKRGAKITPMQATYLFRDTTIEGSPSEFFIEKAKVAMNDGATGFCRLNFATSREVEEAIDRMAKAVSHHT...... 377

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.