current user: public

If you have questions about the server, please let us know.

Query: 4r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# Score Template Links and tools%idFirst MMTRSGHPVTLDDLPLRADLRGKAPYGAPQLAVPVRLNTNENPHPPTRALVDDVVRSVREAAIDLHRYPDRDAVALRADLAGYLTAQTGIQLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRANDFGLDVDVAVAAVVDRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIVDEAYGEFSSQPSAVSLVEEYPSKLVVTRTMSKAFAFAGGRLGYLIATPAVIDAMLLVRLPYHLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDANFVLFGEFADAPAAWRRYLEAGILIRDVGIPGYLRATTGLAEENDAFLRASARIATDLVPVTRSPVGAPKLAAALELast
1 -118.0004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model  100  1MMTRSGHPVTLDDLPLRADLRGKAPYGAPQLAVPVRLNTNENPHPPTRALVDDVVRSVREAAIDLHRYPDRDAVALRADLAGYLTAQTGIQLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRANDFGLDVDVAVAAVVDRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPGIAIVDEAYGEFSSQPSAVSLVEEYPSKLVVTRTMSKAFAFAGGRLGYLIATPAVIDAMLLVRLPYHLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDANFVLFGEFADAPAAWRRYLEAGILIRDVGIPGYLRATTGLAEENDAFLRASARIATDLVPVTRSPVGAPKLAAALE 388
2 -113.0003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  59  2......TKITLSDLPLREELRGEHAYGAPQLNVDIRLNTNENPYPPSEALVADLVATVDKIATELNRYPERDAVELRDELAAYITKQTGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFRIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPGIVIVDEAYAEFSPSPSATTLLEKYPTKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSDQHAAWQAFLDRGVLIRDVGIAGHLRTTIGVPEENDAFLDAAAEIIKLNLSAWSHPQFEK....... 376
3 -101.0003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  29  1..........MSLIPLRQNIASMKGYIPGYQASWIKLNTNENPYPPSPEVVKAILEELGPDGAALRIYPSASSQKLREVAGELYG------FDPSWIIMANGSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTGDFRIAGFPE-----RYEGKVFFLTTPNAPLGPSFPLEYIDELARRCAGMLVLDETYAEFAE-SNALELVRRHE-NVVVTRTLSKSYSLAGMRIGLAIARPEVIAALDKIRDHYNLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPDDGKRVYDGLYARKVLVRHFLLAHGMRISIGTREEMEQTLAALKEIGEG................... 354
4 -97.0003euc_A mol:protein length:367 Histidinol-phosphate aminotransferase 2  ali model follow..  33  14...............IRDDVRAMGAYHVPDSHGLVKLDAMENPYRLPPALRSELAARLGEV--ALNRYPVPSSEALRAKLKEVMQVPAG-----MEVLLGNGSDEIISMLALAAARPGAKVMAPVPGFVMYAMSAQFAGLEFVGVPLRADFTLDRGAMLAAMAEHQPAIVYLAYPNNPTGNLFDAADMEAIVRAAQGLVVVDEAYQPFAQ-ESWMSRLTDFG-NLLVMRTVSK-LGLAGIRLGYVAGDPQWLEQLDKVRPPYNVNVLTEATALFALEHVAVLDEQAAQLRAERSRVAEGMAAHGVTVFPSAANFLLARVP-DAAQTFDRLLARKVLIKNVSLANCLRVTVSTPEENAQFLEAFAASLQD................... 367
5 -93.4003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  20  2.............MKFNEFLNNLSNYEPGKDKEVIKLASNENPFGTPPKAIECLRQNANK----AHLYPDDSMIELKSTLAQKYK------VQNENIIIGAGSDQVIEFAIHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITHNLDEFKKLYETHKD-EIKLIFLCLPNNPLGECLDASEATEFIKGVNELVVIDAAYNEFASFKEPCELIKEFD-NVLYLGTFSKLYGLGGLRIGYGIANANIISAFYKLRAPFNVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDENSTDLSEKLLKKGIIIRNLK--NAIRITIGTSYENEKFFTEFDKILR.................... 365
6 -92.9002f8j_A mol:protein length:347 Histidinol-phosphate aminotransferase  ali model follow..  31  10...............LDLIAKRAYPYETEK-RDKTYLALNENPFPFPEDLVDEVFRRLNSD--ALRIYYDSPDEELIEKILSYLDTD---FLSKNNVSVGNGADEIIYVMMLMF----DRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLRIP------EVNVGEGDVVFIPNPNNPTGHVFEREEIERILKT-GAFVALDEAYYEFHG-ESYVDFLKKYE-NLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMFAKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKEKERLLEHLRTKNVAVRSF--REGVRITIGKREENDMILRELEVF...................... 340
7 -92.8004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  30  1..........MVTARLRPELAGLPVYVPGKTPGAIKLASNETVFGPLPSVRAAIDRATDT----VNRYPDNGCVQLKAALARHLG----PDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPL-TDHTFDLYAMLATVTD-RTRLIFVCNPNNPTSTVVGPDALARFVEAVPALIAIDEAYVEYIRDGDSLGLVRAHN-NVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDKVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSRTQDFVEQAADARIVVRPY-GTDGVRVTVAAPEENDAFLRFARRWRSDQKLAAALE........... 361
8 -92.2001fg3_A mol:protein length:356 HISTIDINOL PHOSPHATE AMINOTRANSFERASE  ali model follow..  30  10...............ARENVRNLTPYQSARRNGDVWLNANEYPTAVEFQLTQQ----------TLNRYPECQPKAVIENYAQYAG------VKPEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTLDNWQLDLQGISDKL--DGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGIVVADEAYIEFCPQASLAGWLAEYP-HLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVIAPYPLSTPVADIAAQALSPQGIMRERVAQIIAEREYLIAALKEIPCQVFDSETNYILARF-KASSAVFKSLWDQGIILRDQNLSGCLRITVGTREESQRVIDALRAE...................... 354
9 -91.9003ffh_A mol:protein length:363 Histidinol-phosphate aminotransferase  ali model follow..  23  2...........NAMKWKKSLAGLSSYKPGKRTKITKLSSNENPLGTSKKVAAIQANSSVE----TEIYPDGWASSLRKEVADFYQ------LEEEELIFTAGVDELIELLTRVLLDTTTNTVMATPTFVQYRQNALIEGAEVREIPLLQDGEHDLEGMLNAIDE-KTTIVWICNPNNPTGNYIELADIQAFLDRVPSLVVLDEAYIEYVTPEKHEKLVRTYK-NLIITRTFSKIYGLASARVGYGIADKEIIRQLNIVRPPFNTTSIGQKLAIEAIKDQAFIGECRTSNANGIKQYEAFAKRFKVKLYPANGNFVLIDLGIEAGTIFSYLEKNGYITRSGGFPTAVRITIGKEEDNSAVIALLEKLL..................... 363
10 -90.6003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  25  2.................MSVGEAMDTEVRAAAQAVCLAFNENPEAVEPRVQAAIAAAAAR----INRYPFDAEPRVMRKLAEHFS------CPEDNLMLVRGIDECFDRISAEF--SSMRFVTAWPGFDGYRARIAVSGLRHFEIGLTDDLLLDPNDLAQV---SRDDCVVLANPSNPTGQALSAGELDQLRQRAG-KLLIDETYVDYSS--FRARGLAYGE-NELVFRSFSKSYGLAGLRLGALFGPSELIAAMKRKQWFCNVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEANFVLVENA-AGERTLRFLRERGIQVKDAGLHHHIRISIGREEDNDRLLAALAEYSDH................... 336
11 -89.5003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  22  2.....................ETQPESAAFTDNPIRINFNENPLGMSPKAQAAARDAVVK----ANRYAKNEILMLGNKLAAHHQ------VEAPSILLTAGSSEGIRAAIEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDNWAFDIEGLKAAVAAYGPSIVYLVNPNNPTGTITPADVIEPWIASKPAMFIVDEAYAEFVNDPSISPMITQGAENIILLKTFSKIHAMAGMRVGYAVAHPTVIALMGRYVAGEKINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNFVFHQLVVPLKDYQTHMADAGVLIGRAPADNWCRISLGTPQEMQWVADTMREFRKK................... 351
12 -87.2004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  22  10...............FTPLIQSLPASVPFVGKIAARIGANESGFGPAPSVLLAIRQAAGD----TWKYADPENHDLKQALARHLG------TSPANIAIGEGIDGLLGQIVRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADDR-EDLEGLLAAVGRENAPLVYLANPDNPMGSWWPAERVVAFAQALPELLVLDEAYCETAPRDPPIESLIDKP-NVIRARTFSKAYGLAGARIGYTLSTPGTAQAFDKIRNHFGMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDRAIVDRLMSDHGIFIRMPPLNRCIRISTAPDAEMDLLAAALPEVIRSLAAT............... 376
13 -80.2003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  24  1...............MYQKFKGGDLMIHGGDRELLDYSSNINPLGIPKSFLNNIDEGIKN----LGVYPDVNYRRLNKSIENYLK------LKDIGIVLGNGASEIIELSISLF----EKILIIVPSYAEYEINAKKHGVSVVFSYLDENMCIDYEDIISKIDD--VDSVIIGNPNNPNGGLINKEKFIHVLKLAEETIIIDEAFIEFTGDPSFVGEIKNYS-CLFIIRAMTKFFAMPGIRFGYGITNKEIAAKIKAKQNPWNINCFAEMAAINCLKDTNYIEESLLWIKKERKRFIEELNKIGFRVFSPHANFVLCRLENSGEKLYDSLLKEDIVIRRCC-DSFVRFAIKDEKKNTKFLRALKGVENNL.................. 361
14 -78.8001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  22  1........MALFNTAHGGNIREPATVLGISPDQLLDFSANINPLGMPVSVKRALIDNLDC----IERYPDADYFHLHQALARHHQ------VPASWILAGNGETESIFTVASGL--KPRRAMIVTPGFAEYGRALAQSGCEIRRWSLREADGWQLTDAILEALTPDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSNLILDEAFIDFIPHETGFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAMARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLTVYPGRANYLLLRCEREDIDLQRRLLTQRILIRSCA-SRYYRVAIRSAAQNERLLAALRNVLTGIAPAD.............. 364
15 -78.6003fkd_A mol:protein length:350 L-threonine-O-3-phosphate decarboxylase  ali model follow..  22  13.............................LSSEIVNFSTTVWTDGDKDHLEKHLVENLNC----IRHYPEPDAGTLRQMLAKRNS------VDNNAILVTNGPTAAFYQIAQAF--RGSRSLIAIPSFAEYEDACRMYEHEVCFYPSNEDIGEADF--------SNMDFCWLCNPNNPDGRLLQRTEILRLLNDHPDTFVLDQSYVSFTTEEVIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLGVEVHPSGTTFFLLRLKKAAELKKYMLEEYNMLIRDAS-ESYVRITTQRPAQNQLFIKALETFLEK................... 341
16 -53.0003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  13  8.................RKPEKISNKNIPMSDFVVNLDHGDPTAYEEYWRKMGDRCTVTIRGCDLMSYCWFLEPELEDAIKDLHGVVGNAATEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEGD----------AWGFDKKGPYIELVTSPNNPDGTIR--ETVVNRPDDDEAKVIHDFAYYWPHYTP-----ITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKKMVIVNSIGVSKESQVRTAKILNSENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGKEETDLVSELRRHKVMSRAGE-KKHVRVSMLSREDVNVFLERLANMKLIKSID............... 390
17 -46.2002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  15  1MGSSSSGLVPRGSHMISNKLANIPDSYEHGPLPLINMAVGIPDGPTPQGIIDHFQKALTIPEN--QKYGAFHGKAFKQAIVDFYQRQYNVTLDKEEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEPPYLPDWSKVDSQIID-KTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGKIVHDFAYGAFDAKNPSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTNAGMFGALQDAAIYALNHDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVTPPGYDSEQFEQFLVQEKSILVAPGKNRYVRISLALDDQKDEAAIRLTELAYLYE................. 398
18 -45.9001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  22  1.MRGLSRRVQAMKPSATVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQGKTKYA--PPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETEEGFVPDPERVRRAITP-RTKALVVNSPNNPTGAVYPKEVLEALARLAVEYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSS--SPDTIAQWATLEALASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLPIAPDEVRAAERLLEAGVAVTDFAAFGHVRLSYATSEENRKALERFARVLGR................... 384
19 -45.5002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  15  12..................VVDEAKRKARERGVGLIDLSIGSTDLPPPEAPLKALAEALNDPTT--YGYCLKSCTPFLEEAARWYEGRYGVGLDPREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLREDGLADLKAVPEGVWR-EAKVLLLNYPNNPTGAVADWGYFEEALGLARKWLIHDNPYVDYEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGDFNQYAGVLRMGVEALKPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPEDDLEFGLRLVERGVALAP-GGKGFVRIALVRPLEELEAAKRIREALD.................... 376
20 -44.6003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  17  21.............................PKKRGLDLGIGEPQFETPKFIQDALKNHTH----SLNIYPKSAFESLRAAQRGFFKRRFKIELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPS--LNEKELQEVDLVILNSPNNPTGRTLSLEELISWVKLALKILINDECYSEIYENTPPPSLLEEAFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRA-YTSANAIQKASEAAWLDDRHAEFFRNIYANNLKLARKIFKNT---LIYPYSFYVYLPVQNGENFAKTLYQNEGIITLP---ADYVRLALVYDTPLEKPLEIIETYRENHA................. 376
21 -44.2003ele_A mol:protein length:398 Amino Transferase  ali model follow..  20  3VVNESMYQLGSVRSAIRELFEYGKKRAAVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDYSVALHGYSAQGDVETRAAIAEFLNNTHGTHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADEHFQIDFDALEERINA-HTRGVIINSPNNPSGTVYSEETIKKLSDLLEKFIIADEPYREIVYDGIKVPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAA-VCAPSLFQKMIVKCQG----ATGDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMF-LEDDSNAFCEKAKEEDVLIDGFGCPGWVRISYCVDREMKHSMPAFEKIYKKYNK................ 398
22 -44.0002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  17  6IMDVFSDRVLLTEESPIRKLVPFAEMAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVV----YYHSAGIWELREAFASYYKRRQRVDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRRMEEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERFLIVDEVYSEIVFRGEFASALSIESDKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKQGRLAPPLLEQIGSVGLLNDDSFFDFVRETYRERVETVLKKLEEHG--TKPSGAFYITAELPEDAEEFARWMLTDGFYLTPGLGKKEIRIACVLEKDLSRAIDVLMEGLKMFCSSRIS............ 402
23 -44.0001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  19  1.............MRLHPRTEAAKESGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQ----DQYPPAGLPALREALAEEF------AVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDEGFRLDLSALEKALTP-RTRALLLNTPMNPTGLVFGERELEAIARLARAFLISDEVYDELYYGERPRRLREFAPERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQSFSAPTPLQAGVAEALKREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLM-AELPGWDAFRLVEEARVALLEDPPKDLFRFAFCKTEEEHLALERLGRVVNSPREAEGGAVSG........ 381
24 -43.8005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  11  6.................QLKENLTQWAYLALNSELNIADGHARQALSPGQQKIVNELPVLWAESEQRPVQQIESEAHQAYFTLLG-QHGYPAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALHGADLSAELL----SSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEVLALDTSFRGFDAHYDHYAVLQEAGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDIGVSPLILALIREFSRDDGGLADLHAFILHNRSVVRRALAGVGVSFPDPESRSSVERVGRTGTEVWEELQRHHVFALP---DHMVRIALSRSTEPEKSVQVLRTVLET................... 375
25 -43.8001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  21  1.............MALSDRLELVSA-IAAGMKDVISLGIGEPDFDTPQHIKEYAKEALDKGLTHYG--PNIGLLELREAIAEKLKKQNGIEADPKEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTEDEFRLNVDELKKYVTD-KTRALIINSPCNPTGAVLTKKDLEEIADFVVEIVISDEVYEHFIARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQM--CPVTFIQYAAAKALRSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFDTGLTSKKFSELMLKEARVAVVPGSEGYVRISYATAYEKEEAMDRMERVLKERK................. 387
26 -43.8001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  13  1.MSSTSNETMHNKFDLPKRYQGSTKIQLAAQYKPLNLGQGFPDYHAPKYALNALAAAANSPDPLANQYRGFGHPRLVQALSKLYSQLVDRTINPTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKADWVLDNNELEALFNE-KTKMIIINTPHNPLGKVMDRAELEVVANLCKKLCVSDEVYEHMVFEHIRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQVYTCATPIQEAIAVGFETECYFNSISGELMAKRDYMASFLAEVGMNPTVPQGGYFMVDARKDYRFTKWMTKSVGLQGIPPSAEDFVRYCFFKKDENQKAAEILRKWKGS................... 428
27 -43.7004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  20  29............................SDIPDVLKLTLGEPDFATPKHIKEAAKRAIDADESHYT--GMAGLLALRQAASAFVKEKYHLTYNPDEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTRSNFVLTPEMLEEAILGEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKFVISDEVYAELTTGESHVSIAEYLPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQ--AATTSVQFAAIEALTNKDDALPMKEEYIKRRDYIIEKMEAMKFKIIKPDGAFYIF-QGQDSFKFLQDFAKEKAVAFIPG-EGYLRISYAASMETKEAMKRLKEFMEQYAD................ 393
28 -43.5002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  18  1MLSKRLLNFESFEVM---DILALAQKLESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEGKTHYT--DSRGILELREKISELYKDKYKADIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDFTVE--------LEEALSDKTKAIIINSPSNPLGEVID-REIYEFAYENIPYIISDEIYNGYEGKCYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLSAPTISQYAALKAFEKEREINSMIKEFDRRRRLVLKYVKDFGWEVNPIGAYYVFPNIGEDGREFAYKLLKEKFVALTPGIKNYIRISYANSYENKEGLERIKEFLNK................... 370
29 -43.4003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  18  1.MSLKNSSRSAVDPFIVMDVMEAARRAEEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETDALGYT--VALGLPALRQRIARLYGEWYGVDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPV--PADFAGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQASFISDEIYHGIEYEAKAVT-ALELTDECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMCAPHASQVAALAALDCDAELQANLDVYKANRKLMLERLPKAGTRIAPPDGAFYVYDLTDDSRAFAAEILEKGLDFDPERGAGTLRFSYARATADEEGLDRLEAFMQARGE................ 384
30 -42.9001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  20  1........MGSDKIMVSRRISEIPISKTKKGEDVINLTAGEPDFPTPEPVVEEAVRFLQKGEVKYT--DPRGIYELREGIAKRIGERYKKDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETSKNFQPSLEEVEGLLVG-KTKAVLINSPNNPTGVVYRREFLEGLVRLAKKYIISDEVYDSYTDEFTSILDVSEGFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQS--CINTVAQYAALKALEVDN--SYMVQTFKERKNFVVERLKKMGVKFVPEGAFYLFFKVRGDDVKFCERLLEEKKVASAFLKPGFVRLSFATSIERTEALDRIEDFLNS................... 382
31 -42.9004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  17  1MGSSSSGLVPRGSHMSSLRPRREDPHLGPDIHDISSSGVHPYSFAEIRDVCRIPAADLDAVVMDDS--VSQGGEGVRRAIADRYA-----GGDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGVRDGEIDPDVLAGLVTP-GTAAVIVNFPHNPTGVTLSPQGLRALKERTAAVLVWDAATAEIAHRWEVLADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRTTLFLSPLVELVAERAVRHDELIGARAAEARHNLAHLTGWMAAHEVRWTPPEGGVCALAGPQEVERFCLELLERRTLLTAFGAPHGARLGFGGPQEDRAGLDGLSRFLRERAAGR.............. 400
32 -42.8003jtx_A mol:protein length:396 aminotransferase  ali model follow..  22  2...............MNTLLKQLKPYSAPEGMEAVPLHIGEPKHPTPKVITDALTASLHEL----EKYPLTAGLELRQACANWLKRRDGLTVDADEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANCPAPFNPDWRSISEEVWK-RTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKIIASDECYSEIYFDGQAAAQLGRSRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRT-SAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGDDLAFARWQKAAIQVLP---EGYVRIALVADVATVKAAEDIVSLYR.................... 396
33 -42.2005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  17  21............................AADPSVVNLGQGFPDISPPSYVKEELSKAAFID--NMNQYRGFGHPALVKALSCLYGKIYQRQIDPNEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSDWTFDPRELESKFSS-KTKAIILNTPHNPLGKVYTRQELQVIADLCVKLCISDEVYEWLVHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQFYTCATPLQAALAEAFWIECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIDEPYDYKFVKWMTKHKKLTAIPVSAEKLVRFCFIKKDST--LDAAEEIFRA.................... 409
34 -42.1003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  18  24VVQAVAQRAGTIDVQRNENFGKLRA-EKNPDAKIISLGIGDTTEPLPKYIADAMAKAAAGLATRYSGYAEQGQGALREAVASTFYGHAG--RAADEIFISDGSKCDIARI-QMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCFPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKILVYDAAYALYIDCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCGASNIVQAGGLACLQPEKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIW-PGKPSWDVFAEILERCNIVTTPGSEGFVRASAFGSRENLEAVRRFKEAYGKRNAS............... 443
35 -42.1003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  15  45...................AAKAANNSKNQGRELINLGQGFFSYSPPQFAIKEAQKALDIP--MVNQYPTRGRPSLINSLIKLYSPIYNTELKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPIGEEWTIDFEQFEKAITS-KTKAVIINTPHNPIGKVFTREELTTLGNICVKVIISDEVYEHLYSFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNELLSYAAKAHTCFASPSPLQEACANSINKIGYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLNKGKDFRISHWLINELGVVAIPPTEENLLRFAVCKDDAYENAVERLKLLKDYL.................. 447
36 -42.0006DK6 Entity 1(prereleased)  ali follow..  17  1MALINENFLKLKAGYLFPEVKAFTEGNPEAAQRLIRCGIGDVTEALPEAVRYAMHEAVDELGNTFKGYPEQGYDFLRNAIADNDYKARGLPIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYAGLVYNGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYAREVLLYDAAYEAFITIPHSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQ-GASYIVQKGAEALYTDKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVCPAGLTSWQMFDKMLNEANVVITPGSEGYFRISAFNSRAN--VEEVCRRIAA.................... 409
37 -41.9003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  15  22.........DLGMASIRDLVALVTNLEKATGTKFCRMEMGVPGLPAPQIGIETEIQKLREGVA--SIYPNLDGLELKQEASRFAKLFVNIDIPARACVPTVGSMQSFLVANRTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYRGEKLRKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKIVIEDLAYFGMDGEPLYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPDALSSGATHSAQWGMAAMLDGEYNFRDSVIEYGRKARIMKKMFLDNGFNIVPLADGFYFGYKGMDSSKLIEKFVRYGMCAITLKTNEAMRICTSLLPESPDLEKRLQMLNAE................... 436
38 -41.8003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  18  21.............VRQSAAGLEALIRGAPIEGRPVDFSHGDVDAPTPGAFDLFSAGVQSG---GVQAYEYRGDLGIRDLLAPRLAAFTGAPVDADGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDTRAGLDLTGLEEAFKA-GARVFLFSNPNNPAGVVYSAEEIGQIAALAARTVIADQLYSRLRSYTHLRAEAAVDAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQASLRAAGYSQAVLRGWFDEPGWMEDRIARHQAIRDELLHVLRGCGVFARTPQAGSYLFKLAVAPAEFVKILRLQAGVVVTPG-ADSVRLNFSQDHEAVAAARRIVTLVERYRA................ 407
39 -41.6004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  16  1..........MAKQLQARRLDGIDYVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYPPLTKILASFFGELLGQEIDPRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLSSNWQLDPMELAGKFTS-RTKALVLNTPNNPLGKVFSREELELVASLCQQVCITDEVYQWMVHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQVFHCPTQSQAAVAESFERSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLIDEPYDRRFVKWMIKNKGLVAIPVSIDHYIRFCFVKDEATQAMDEKLRKWKVELENLYFQGKGGR....... 433
40 -41.3006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  10  11RGSHMHPQATPAPGAPLLDLTQHEIQALTMKYNLADAHTHQRQSASQQSIVSRLPQLWYEAE---EGLQATYEKRFTEAFFQLHR--QPTALVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVFYDVDRIYPELERR-VRTDALFLVDPNNPTGFSLLREEVVRFCKDHDKLLLIDFCFASFTARFDMYELLENSGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHT-LNVSPFVLNMLTQYVRDADRLASVREVLTRNRECARKTLDGSILEYQEPVVKVSVAHPELTATDVHRLLSADGVYVLP---DAYVRMALAREPEMADAMALTRQVLDRHGR................ 407
41 -41.2001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  18  1........MTNNPLIPQSKLPQLGTSALAQQHQAINLSQGFPDFDGPRYLQERLAHHVAQ---GANQYPMTGVQALREAIAQKTERLYGYQPDADDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPHFRVDWQEFAALLSE-RTRLVILNTPHNPSATVWQQADFAALWQAIAGFVISDEVYEHINQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQTFSVNTPAQLALADMLREPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYFLLSTLDDVEFCQWLTQEHGVAAIPLSVHKLIRLCFAKKESTLAAAERLRQL...................... 386
42 -41.2005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  17  1.MTDRVALRAGVPPFYVMDVWLAAAERQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLNQLGYS--VALGIPELRDAIAADYQRRHGITVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGPQTRFQPTAQMLAEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDARLISDEVYHGLVQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFCPPVLSQIAAVSAFTPEAEADGNLASYAINRSLLLDGLRRIGDRLAPTDGAFYVYDFTSDSLAFCSKLLADGIDFDTARGGSFVRISFAGPSGDEEALRRIGSWLPS................... 387
43 -41.0002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  17  26.RNSNMSKLQAGYLFPEIARRRSAHLLKYPDAQVISLGIGDTTEPIPEVITSAMAKKAHELSTGYSGYAEQGAKPLRAAIAKTF--YGGLGIGDDDVFVSDGAKCDISRL-QVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNENGFFPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKIIVYDSAYAMSDDNPRSIFEIPGAEEVAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCGASNISQAGALACLTPEEAMHKVIGFYKENTNIIIDTFTSLGYDVYGGKNAPYVW-PNQSSWDVFAEILEKTHVVTTPGSEGFVRVSAFGHRENLEACRRFKQLYK.................... 426
44 -40.9002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  17  24..................ITAELKMAARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQREDT--HGYSTSRGIRLRRAISHWYRDRYDVQIDPEEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLGIDFFNELERAIRESIP-KPRMMILGFPSNPTAQCVELDFFERVVALAKQMVVHDLAYADIVWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSDYGTFTPLQVAAIAALEDQQCVRDIARQYQQRRDVLVKGLREAGWMVENPKASMYVW-AHLGSLEFAKKLLQDAKVSVSPGIDDHVRFALIENRDRRQAVRGIKAMFRADGLLSPQRKVDS....... 409
45 -40.5001xi9_A mol:protein length:406 putative transaminase  ali model follow..  17  6.ASKRALSVEYAIRDVVLPARELE----KKGIKVIRLNIGD-DFQPPEHMKEAYCKAIKEGHNYYG--DSEGLPELRKAIVEREKRKNGVDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTEEDWQPDIDDIRKKITD-RTKAIAVINPNNPTGALYDKKTLEEILNIAGEPVISDEIYDLMTYEGEHISPGSTKDVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRRIRLCPNTPAQFAAIAGLTPMDYLKEYMKKLKERRDYIYKRLNEIGISTTKPQGAFYIF-PWKNDKEFVLDVLHNAHVLFVHG-AGHFRAVFLPPIEIEEAMDRFEKFMKERLKE............... 400
46 -40.1004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  16  39VRNVNLEKLKNNYLFPEINRRELEHIEKHPNVQLISLGTGDTTEPIPEQITSHMSNFAHGLSTVYRGYLEQGNKTLRKAIAETF--YRDLHVKSNEVFVSDGAQSDISRL-QLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNNNSFFPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTIIIFDSAYAAEDGSPRSIYEIPGAREVAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSGASNIAQAGGLACLSSLKEIRSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLW-KGSKSWDVFNEILENTHIITVPGSEEYLRISGFGRRDHVEASKRLQNFFNTRTKHFTYLSSTSNTN.... 456
47 -40.0002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  17  1.............MATVSRLRPYATSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAG---GVNQYPGPGSAPLRRAIAAQRRRHFGVDYDPEEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLGRGFALDADALRRAVTP-RTRALIINSPHNPTGAVLSATELAAIAEIAVAVVITDEVYEHLVARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQSYVGGAPFQPAVALALDEDAWVAALRNSLRARRDRLAAGLTEIGFAVHDSYGTYFLCGYDDSTEFCAALPEKVGVAAQADVWNHLVRFTFCKRDDTDEAIRRLSVLAERPATGVPRG........... 403
48 -39.8003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  17  27...............................VSISSLTLEE-LFALSGTNPEDFYKKLQGTKLNYG--WIEGSPAFKKSVSQLYT-----GVKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIENGWLPDLEKLRQLIRP-TTKMICINNANNPTGAVMDRTYLEELVEIASEYILSDEVYRSFSELD--VPSIIEVYDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRTMICAGVFDDLVAQLALAHQEILERNRHILEENLAILDQWIEEELVSYIRPAVVFVKIAVDMPMEDFCLQLLQEGVLLNRFERDGYVRLGFACEQETIKGLEKLSQFLRRFDKEN.............. 375
49 -39.8001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  17  17..................IIDAKAKAMKAEGIDVCSFSAGEPDFNTPKHIVEAAKAALEQGKTRYG--PAAGEPRLREAIAQKLQRDNGLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTETQFKVSPEQIRQAITP-KTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEWVLSDEIYEKILQHLSIGAASPEAYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQG--NVCTFAQYGAIAAYESQDCVQEMLAAFAERRRYMLDALNAMGLECPKPDGAFYMFKTGRSSLDFCSELLDQHQVAAAFGADDCIRLSYATDLDTKRGMERLEKFLHGI.................. 387
50 -39.6001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  16  36.............................NTNGIIQMGLAENQL--KNPEAAAFKKNGESIFAELALFQDYHGLAFKKAMVDFMARGNKVTFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRGVEIVPIHCSNGFQITETALEEAYQEARVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDHLISDEIYSGTASSPSFISVMEEVWQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGVSSQTQHLLSAMLSDKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWNTFEAEMELWKKIVYEHLNISP-TEPGWFRVCFANLPERDLAMQRLKAFVGEYYNVPEVNGGSQSSHLSHS 450
51 -39.3004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  18  22SPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGN-PAPFGFDAPDEILVDVIRNLPTAQGYDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCSSDWFPDLDDIRAKITP-RTRGIVIINPNNPTGAVYSKELLMEIVEIARQIIFADEIYDKYDDAEHHSIAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEMRLCANVPAQHAIQTALQSISEFITPGGRLYEQRNRAWELINDIGVSCVKPRGALYMFNIHDDQKMVLDFLLQEKVLL-NWPWPDHFRIVTLPRVDDELSLSKFARFLSGYHQ................ 424
52 -39.0005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  18  68VDMSLSPRVQSLKPSKTMVITDLAATLVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIREGFTRYT--LNAGITELREAICRKLKEENGLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTSNNFLLDPKDLESKLTE-KSRLLILCSPSNPTGSVYPKSLLEEIARIIAKLVLSDEIYEHIIATHTSFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQG--GASSIAQKAGVAALGLGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFGLINDSSSLALYFLDKFQVADAFGDDSCIRISYATSLDVQAAVEKIRKALEPLRATVS............. 474
53 -38.7001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  16  30............................PSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKEASQECNGYPTVGSPEAREAVATWWREELKSTIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCENDWEADLDEIRRLKDD-KTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEEPLFSDEIYAGFKGKDPNATFTSETTVPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGM--PCTVVQAALGEALLNPQEHLDQIVAKIEESAMYLYNHIGECGLAPTMPRGAMYLMDIKTDVEFFEKLLEEENVQVTIFHAPGFTRLTTTRPVEVREAVERIKAFCQRHAA................ 415
54 -38.1003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  14  17MWSVRPSDMAKKTFNPIRAIVDNMKVKPNPNKTMISLSIGDGNLPTDPEVTQAMKDALDSG--KYNGYPSIGFLSSREEIASYYH-CPEAPLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLEKSWEIDLKQLEYLIDE-KTACLIVNNPSNPCGSVFSKRHLQKILAVAARPILADEIYGDFSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLGPCTIVQGALKSILCRGEFYHNTLSFLKSNADLCYGALAAIGLRPVRPSGAMYLMEFENDVEFTERLVAEQSVHCTCFEYPNFIRVVITVPEVMLEACSRIQEFCEQHYHC............... 421
55 -37.9003if2_A mol:protein length:444 Aminotransferase  ali model follow..  15  2.MKFSKFGQKFTQPTGISQLMDDLGDALKSDQPVNMLGGGNPAKIDAVNELNDTGKANSSAIISMANYSNPQGDAFIDALVGFFNRHYDWNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDEYRVDFEALLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRPLIIDNAYGMPFPNIIYSDAHLNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLTRFGAAIATPLVANKQLSDNEIKPFYQKQKLLKQALGDYPLMIHKPEGAIFLWDLPISTLDLYERLKAKGTLIVP---HECIRMSIAADEQTIDGIKVIGEVVRELYDNK.............. 444
56 -37.9003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  20  30............................NPQHTVINLSIGDTTQPLNASVAEAFASSIARSPTTCRGYPDFGLPALRQKLSEDF---YRGFVDAKEIFISDGAKVDLFRLL-SFFGPNQTVAIQDPSYPAYLDIARLTGAKEIPCLQENAFFPEFP------EDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIELILFDAAYSTFISLPKSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTGASIPAQEAGVAGLSILPQ-LEAIHYYRENSDLLRKALLATGFEVFGGEHAPYLWQANISDRDLFDFFLREYHIAITPGISGFVRFSSLGKREDLAACERLQMAPALQS................. 394
57 -37.7003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  16  2MTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAHIPAMQDYFQTLLTDMVESAADALCNYDGPQGKALLNALAVLLRETLGWDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFVSAEGQFKYHVDFEHLHIGE-ETGMICVSRPTNPTGNVITDEELMKLDRLANQPLVIDNAYGVPFPGIIFSEARPLWNPNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLGGMGPAMMCEMIKRNDLLRLSETVIKPFIAIIRRYLSEERCLIHKPEGAIFLWDLPITTELLYQRLKARGVLMVP-HTHQCMRMNYVPEPDKEAGVKILAEEIERAWREG.............. 417
58 -37.4003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  14  3VRPSDMSNKTFNPIR---AIVDNMKVKPNPNKTVISLSIGDGNLPTDPEVTQAMKDALDSG--KYNGYPSIGYLSSREEVASYYH-CPEAPLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLEKSWEIDLKQLESLIDE-KTACLVVNNPSNPCGSVFSKRHLQKILAVAERPILADEIYGDFSDCKYEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLGPCTIVQGALKSILQRQEFYQDTLSFLKSNADLCYGALSAIGLQPVRPSGAMYLMEFENDVEFTERLIAEQSVHCTCFEYPNFFRVVITVPEVMLEACSRIQEFCEQ................... 400
59 -37.3001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  16  34.............................NPNGVIQMGLAENQL-IKRNPKGSICSEGIKSFKAIANFQDYHGLEFRKAIAKFMEKTRGVRFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRGVQLIPIHCENNFKITSKAVKEAYENAKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHLVCDEIYVSIAEILDEQEMTYCNKDLVHIVYSLSKDMGLPGFRVGIIYSNDDVVNCARKMSSFGLVSTQTQYFLAAMLSDDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGLFCWSTFDSEMSLWRVIINDVKLNVSPG-PGWFRVCFANMDDGDIALARIRRFVGVEK................. 428
60 -36.9003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  13  48....................................IHDEEGNLVFLKTVKEEYLSLSDS---EHVGYPIAGIPDFLCAAEKECFGNFRPE-GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLDEHNNFNHEAFQNRVNEQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDIIGIDVAYLDYSGERAFFNKFSHLPKEICVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNNICRPAMRTMANIVADEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFITIPTDSANAICEELKKEHIYV--IALANGIRIAACPKCQMTGLAEKIYNAMKSLGK................ 417
61 -36.7004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  18  57...........................SRSTKSNLRLSIGDGNLKTPDIVTEAMVDVVRSG--KFNGYPTVGADNLRQVVSTYWRRFCQTKLKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLSKSWECDLRAAAGMVDS-HTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQPLISDEIYAEMVLNNGIFTSVADFDTPRLILGGTAKYQVCPGWRVGWSILIDDWAVGMERLQLIAGVNSICQEAIARTLLKTECTEHIVTQLEAGAKVYARLLEHDGISMEAPQASMFVMDLKSDMEFYEKLLDEENVQVEIFGMSGFLRATVSRPSAVNEAVDRIIEFCERHKK................ 438
62 -36.6001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  11  55..............................QGCSADVASGDGLFLEEYWKQHKEASAVLVSPWHRMSYFFNPVSELEKTIKELHEVVGNAAAKDRYIVFGVGVTQLIHGLVISLSPNMTATPDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGNANYVNVSNPEQYIEMVTSPNNPEGLLRHAVI--------GCKSIYDMVYYWPH-----YTPIKYKADEDILLFTMSKFTGHSGSRFGWALIDESVYNNLLNYMNTEGTPRETQLRSLKVLKERDLNTFGFKKLRERWVNITALLDQSDRRMRPPSPSYAWVKCEWEEDKDCYQTFQNRINTQNFEASRYVRLSLIKTQDDDQLMYYLKDMVKAKRKTPLIKQLFIDQTETAS 443
63 -35.8004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  16  6MTIKRATWNNGPDLAFDINNKANAAIEKYGREAVINAALGT---KGKIIALPSVYDRLDEMDRSIASYPIEGEKDYRKIVIDTLFGPYKPE-GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFTDDFAFNIDVYKEAIDESDRIASLINSPNNPTGYSLSDEEWDEVITFLKETLIVDVAYLEFAGDRKFFEKFSNLPRNVVVAFSMSKSHTAYGLRSGAAVGSKEIIEEFEAARCNWSNGTHAAQNILIELEREQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTFIPTDKAFDIVKDLEKENIFT--IPSAKGIRVAICGEEKIPKLVQRLAFYTNK................... 412
64 -35.2002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  17  103...............................GKSLSYVRDQLGLDPAAFLHEMVDGILG------CNYPVPPRMTVSEQIVRQYIVREAVPPESVDLFAVEGGTAAMSLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIDNGWQYSDAELDKLKD-PDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAELILTDDVYGTFA--DEFQSLFSVCPRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRLFALMDEADAYKQALKQLIRRREATLYRELGMPPLENPNSVNYYTLQQSSTGDMLFRVADETGIVLLP-SDRPSGRASLANLNEYYAAIGRALRRLADELYEQYKALGKEKLAAALE 538
65 -34.9002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  12  36....................KGILSQSAEAKSTTYNATIGMATNKDGKMFASSLDAMFNDLTPDIFPYPPQGIEELRDLWQQKMLRDNP---NMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQT-FDKDGHYTTDSLVEALQSKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKAIAVVDDAYYGLFYEDTALTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKEVLEAKVSGPLPTQSAVKHVLKNNKQFDKEIEQNIQTKEVVYADQYHSHWQAYDFNSGYFMA-HDVDPEALRKHLIDKYSIGVIALNATDIRIAFSEKDDIPHVFDSIAKAIDDLR................. 430
66 -34.9002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  17  104...............................GKSLSYVRDQLGLDPAAFLHEMVDGILGCN----YPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAISLNWQYPDSELDKLKD-PAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEMILTDDVYGTFA---DFQSLFAICPENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQ-KVALDHRYRSLLPDDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLKQSSTGDMLFRIADETGIVLRGFGSNRSGRASLANLNEYAAIGRALRKMADELYAEYSGQAQNLKLAAALE 540
67 -34.7003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  14  104................................DAVNYCHTELGLNRDKVVAEWVNGAVANN----YPVPDRCLVNTEKIINYFLQYKDANLAEQTDLFPTEGGTAAIVYAFHSLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLKNDWEIEPNEIEKLKDP-SIKALIVVNPTNPTSKEFDTNALNAIKQAVEKMIISDEVYGAFV--PNFKSIYSVVPYNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLD-LRQLHKRYSSVVLCADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLNNFEQVDFLLKLAEKNGVVLVD-AKPGELRVSQANLPTEALIGKQVLELLKEYYEEFKQNN.......... 533
68 -34.5003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  13  85...............................PDLLQREEIKTLF-SADSISRAKQILAMIPGRATGAYSHSQGIGLRDAIASGIASRDGFPANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESWGLETSDVKKQLEDANVRALVVINPGNPTGQVLAEENQYDIVKFCKNVLLADEVYQEYVDNKKFHSFKKEDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASYKAEKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFNKAPDAFYALRLLESTGIVV-----TWHFRCTILPQEDKPAVISRFTVFHEAFMSEYRD............ 490
69 -34.4003zzj_A mol:protein length:396 ASPARTATE AMINOTRANSFERASE  ali model follow..  13  4.........NITAAPADPILGLADLFRADERPGKINLGQGETGKTPVLTSVKKAEQYLLENETTKNYLGIDGIPEFGRCTQELLFGKGSALINDKRATPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYAENHTLDFDALINSLNEAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVELPLFDFAQQGFARGLEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMNPPAHGASVVATILSNEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKMFSFSGLTKEQVLRLREEFGVYAVASG-----RVNVGMTPDNAPLCEAIVAVL..................... 396
70 -34.2003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  17  104...............................GKSLSYVRDQLGLDPAAFLHEMVDGILGCN----YPVPPRMLNISEKIVRQYIIREMGADAIPSNLFAVEGGTAAMSMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAIALNWQYPDSELDKLKDP-AIKIFFCVNPSNPPSVKMDERSLERVRKIVAEMILTDDVYGTFAD--GFQSLFAICPANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLP-KTALDDRYRSLLPDDESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLKQSSTGDMLFRIADETGIVLRGFGSDRSGRASLANLNEYAAIGRALRQMADELYAQYTQQGNKR....... 533
71 -33.6003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  18  92........................................DSPSFPEDAKKRARRILQACGGNSLGSYASQGVNCIREDVAAYITRRDGVPADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEEWALNVNELRRAVQEADPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEFLLADEVYQDYSPDCRFHSFKKVLYEELASFHSTSKGYMGCGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMD-SREKESVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFQMAPDMFYCMKLLEETGICV-----TYHFRMTILPPVEKKTVLQKVKDFHINFLEK............... 490
72 -33.4004wd2_A mol:protein length:408 Aromatic-amino-acid transaminase TyrB  ali model follow..  16  6.........HIDAYPGDPILTLNENFQKDPRDQKVNLSIGIFDAEGRIPVMGAVREAETALQRD-KPYPMVGLAAYRDAVQSLVFGADHPARAAGRIALGGSGALKVGADFLKRYFPDSQVWLSDPSWENHRFIFERAGFTVNTYPYEATGGLKFDAMLAAIDAARSIVLLHACCHNPTGVDLDEGQWEKLIDVIEALPFVDMAYQGFGAGLDAVRELARRGVPTLVANSFSKNFSLYGERVGGLSVVCEDAAAAERVLGQLNPQTYGAKVVAAVLGTPALRKQWEEELSAMCRRIARMRQSIGLRDHVSGEALMFTYTGLTESQVDALREVHGVYILRSG-----RMCVANDSNVGIVADAIGKVLKSGA................. 402
73 -33.3004w5k_A mol:protein length:396 Aspartate aminotransferase, mitochondrial  ali model follow..  16  1..........MAMGKPDPILGLGQDFRMDPAKRKVNLSIGVRDDADQPFVLECVKQATLGTN---MDYPVTGIASFVEEAQKLCFGPTCAALRDGRILGGTGALRIGGDLLNRFVANCNRIYGPDVGYPNHESIFAKAGMELTPYSYPATKGLNLAGMLECLDKEGSVILVHACAHNPTGVDPTHDDWRQVCDVIKRIPFVDMAYQGFATGQ-VPRHLVDMVPNLIVAQSFSANFGLYGHRCGALHISTASAEEAKRLVSQLNPPLYGAWVVSSILKDPQLTALWKKELKQMSSRIAEVRKRLELKACGSVHDWMMAYTGLTREQVELLRSEYHIYMTLNG-----RAAVGLNSTNEYVSQAIHNVTK.................... 390
74 -33.0001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  17  29.................SEVRELLKLVETSDVISLAGGLPAPETFPVETIKKIAVEVLEEHADKALQYGTTKGFPLRLALARWMEKRYDIPMSKVEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDK-GMRVDLLEEKLEEKRVKIVYTV-STNPAGVTMSRKKLLELANEYDFLIVEDGPYSELRYSGEPTPPIKHFYGRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKMEIAKQSIDLNTFGQAIAWKYVENDEHIPKIIEFYKPRRDAMLEALEEY---TKPEGGMFVRVTLPEDTKLMMERAVAKGVAYVP-DKKNTMRLNFTPEETIREGVRRLAETIKEEMKRVKG............ 417
75 -33.0004eff_A mol:protein length:420 Aromatic-amino-acid aminotransferase  ali model follow..  19  3MGTLEAQTQGPGSMSLFSAVELAPRFNADTRPTKVNLGVGEDGKIPLLRAVRDAEKARVEAGLPRGYLPIDGIAAYDASVQKLLLGDDSPLIAAGRVVLGGTGALKIGADFLRTLNPKAKVAISDPSWENHRALFDMAGFEVVAYPYAKTNGVNFDGMLAALNGPGTIVVLHACCHNPTGVDLNDAQWAQVVEVVKAVPFLDIAYQGFGESIEAVRLFAAANLNVFVSSSFSKSFSLYGERVGALSIITDSKDEAARVLSQLNPPTHGGAIVAAVLASPELRASWVQELGEMRDRIRAMRNGLRLKAAGIERDFMFSYSGLTSAQVDRLREEFGIYAVSTG-----RICVANTRNLDVVANAIAAVLK.................... 414

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.