current user: public

If you have questions about the server, please let us know.

Query: 4uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MGGSGMASMTGGQQMGRDLYDDDDKDRWGSELEMSNRAGSSMPGISPEQQAAEWKLLLGQFPAPVVAQIRELATTHQSELPGYFYEQMLQDEQAMLFLTHEQVKSRLHGTLRQWIVSVFSMSDDDAALQALIAQQKQIGEIHARIKIPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISETVDLAMEIMSRAFSDAYDRNSRSEELast
1 -84.7004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model  100  1MGGSGMASMTGGQQMGRDLYDDDDKDRWGSELEMSNRAGSSMPGISPEQQAAEWKLLLGQFPAPVVAQIRELATTHQSELPGYFYEQMLQDEQAMLFLTHEQVKSRLHGTLRQWIVSVFSMSDDDAALQALIAQQKQIGEIHARIKIPIHLVLRGARHLRERLFVLLRQRPLDPEHKLFGQRLISETVDLAMEIMSRAFSDAYDRNSRSEE 211
2 -62.5004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  32  2................................................AMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDDV--ERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFTFSDSSASKEDE 162
3 -62.0004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  35  1..........................................MKPSPEILALRWKDTSAHYSPHEWVAARNVVTANKAALADYFYESMLADPNAAFFLSDQLVKTKLHASMQDWLESVYAAAPTEEY-ERTVAFQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDSLSAAQAAATCRYVADVTMTAVEMMSHAYSVSHDRNARAEE 169
4 -60.2004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  32  1..........................................MEMYFKRMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVDDV--ERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSIDIAMEVMTRAFLE.......... 157
5 -60.1002w31_A mol:protein length:162 GLOBIN  ali model follow..  22  3...............................................TMQEIKAHYRFTDEDAELLGSLFPLAETNKERLADQFYDYLLGIPETAEFLKEDLVLQKLKQTHQDWFVSLFAGSYDN----RYIHNLQKIGHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKILDINLDIMSASYREEEMRKFFVSH 162
6 -54.7001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  15  1................MLFKKDRKQETAYFSDSNGQQKNRIQLTNKHADVKKQLKMVLGDAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDD----EFIEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASITNQQELLKAIKATTKILNLEQQLVLE.............. 178
7 -52.4005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  20  6.............................................ETVFEELKRYVGWGDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTALGGESQVGHLKVTMIAWLDELLGGPWDE----AYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERHGDPPELERVRNALGKVLDLELAVMLHTYRED......... 160
8 -47.3002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  13  22.............................................LEDLKLLKEAVMFTAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTNEKYLAAVRKRFSRWILDTSNRSYDQ----AWLDYQYEIGLRHHRTKKNQTDNVESVPNITATMKPFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPYVKYGD....... 194
9 -19.4003pmd_A mol:protein length:153 Conserved domain protein  ali model follow..  10  1..........................................................GSHMEATKRYLCLYLKESQEKFISNWKKRILVHEH-------DPYKNEIIKNGTHLLHVFTMYMREEINLQDIEDISKKIAQERMDAKVNIADFIYNTNEGKKEILNTLFLLNPTGQECKVVIEQINLFFDHLIYSTIYSYYKLKKEYIHSYY 146
10 -18.8003pmc_A mol:protein length:139 Uncharacterized protein pXO2-61/BXB0075/GBAA_pXO2_0075  ali model follow..  10  1..........................................................GSHMEEIKCLLCRYLKERQEKFISDWKKKVIIRER-------DPYKEEIIKNGEHLLSAFIMYLKEEISLQEIEITSKKIARERIDAKVNIAEFIHNTNVAKIEIMNILTLLNPDLQQYQALVKKINQFFDHLIYYTVHSYYE.......... 136
11 -17.9002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  1.........................................................MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIEN---ENMRSFVDKVAITHVNLGVKEEHYPIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFY---IDIEKKLYDK.......... 140
12 -17.3001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  10  1........................................................MLDQQTINIIKATVPVLKEHGVTITTTFYKNLFAHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIEN---PAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATD-----DILDAWGKAYGVIADVFIQVEADLYAQAVE... 146
13 -16.2001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  1............................................MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEAPSASQMFSKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHF----EVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE........ 166
14 -16.0002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  13.........................................................FGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEAPSAKQMFSKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHF----EVTGFALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKPD......... 164
15 -15.9001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  10  3.........................................................FTEKQDALVSSSFEAFKANIPQYSVVFYTSILEAPAAKDLFNGVDPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSD-----ELSRAWEVAYDELAAAIKKA............. 143
16 -15.8002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  10.........................................................FSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEAPSARQMFPTNPKLKTHAVSVFVMTCEAAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHF----EVTRFALLETIKEALPADMWGPEMRNAWGEAYDQLVAAIKQEMKPAE........ 162
17 -15.7003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  1.........................................................MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDEPKVRPLFKIDIEKQKLMDVLNWIVLNL-------QDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTK-----QLEQLWTQAYEALAQVMIEE............. 132
18 -15.7003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  10  1........................................................MIDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEPTVSVLFQNPISSQKLMQVLGILVQGI-------DNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAAKVYGIAAQVM....................... 130
19 -15.5003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  10.........................................................FTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEAPSAKNLFSQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSP-----EMKNAWGEAYDQLVAAIKSEMKPSST....... 162
20 -15.4002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  4.........................................................MERPESELIRQSWRVVSRSPLEHGTVLFARLFAEPSLLPLFEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTP-----ATRTAWSRLYGAVVQAMSRGWDGE......... 154
21 -15.3004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  1.........................................................MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTP-----ATRAAWSQLYGAVVQAMSRGWDGE......... 151
22 -15.3001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  1.........................................................MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFEDSLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTP-----ATRAAWSQLYGAVVQAMSRGWDGE......... 151
23 -15.2001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  11  3.........................................................LTESQAALVKSSWEEFNANIPKHTHRFFILVLEAPAAKDLFEVPQNNPELQAHAGKVFKLVAAIQLEVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSE-----ELNSAWTIAYDELAIVIKKEMDDAA........ 153
24 -15.1003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  1.................................................MESEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEAPTTKKMFSQNPKLKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSP-----EMKVAWGQAYDHLVAAIKAEMNLS......... 159
25 -15.1004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  9.........................................................VSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMENPETFQIFKEMRSHPRFKSHAKSIGKVISDCLVDLNGVKKHEPKLSSLGAMHTKKKVPTELF----GKLGGCILTQVVKRVSEAKWSEEKKEAWLKAYGIITVMVTE.............. 154
26 -15.0003mvc_A mol:protein length:161 Globin protein 6  ali model follow..  15  3.........................................................LTQPQILFVRKTWNHARNQALEPAISIFRNSFFNPEIRQMITKNEGHERLKKHAQLFTVLMDDLIANLDSPSATVAGLREAGEKHVWPPFHAHLL----DQFATAMIERTLEWGEKKDRTETTQRGWTKIVLFVTEQLKEGFQDEQKRARR... 161
27 -15.0001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  52.........................................................................REAVEAAVDKFYNKIVADPTVSTYFSNTD-MKVQRSKQFAFLAYALGGA------SEWKGKDMRTAHKDLVPHLSDV----HFQAVARHLSDTLTELGVPPEDITDAMAVVAST........................ 154
28 -14.9003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  10.........................................................FTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEAPSAKNLFSQNPKLKPHATTVFVMTCESAVQLRKAGKVTVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSP-----EMKNAWGVAYDQLVAAIKFEMKPSST....... 162
29 -14.7006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  12  10.........................................................................AAAVAATVDVFYKKLMNDPDLEPFFRGVD-MVTLIAKQNRFLAYAFGAT------THYHGKDIV--MGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGV........................ 114
30 -14.6001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  10  13.........................................................LTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHDPTAQRKFPAELRTSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTK-----QVHDAWAKTFAIVQGVLITKHAS.......... 159
31 -14.6004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  11  31.........................................................................EAGALAIANRFYDIMATDEYAKPLYDMHPLLDRIRQVFFEFLSGWLGGP------DLFVAKHPMLRKRHMPFTIDQD----LRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQL........................ 137
32 -14.6004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  10  33.........................................................................LQTFINLSTNFYTRVYDDEEEWFQIFSNSNKEDAIQNQYEFFVQRMGGP------PLYSQRHPALIGRHRPFPVTHQAAERWLEHMQNALDDSVDIDQDSKIKMMKFFRHTAFFL....................... 144
33 -14.6005v3t_A mol:protein length:132 Globin  ali model follow..  1.........................................................MSKQPMTPFEAIGG--EQCIEILVDTFYSYVSKHPDLSPIFPDD--LTETARKQKQFLTQYLGGP------NLYTEEHPMLRARHLPFEITPK----RAEAWLSCMEQAMDDTGVHGHIREFVFERLALT........................ 118
34 -14.6004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  43.........................................................................EETFTRLARRFFEGVAADPVLRPMFPEED-LGPAEERLRLFLMQYWGGP------ETYSERHPRLRMRHEPYRIGAE----ERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYA........................ 147
35 -14.6004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  10  60.........................................................................EELLRKLVEVHHENLMKSKIHYLFPTSHEQLRSLVKRSADFVVEMCGGP------PYYTLTEPKMRARHFSVTIDEK----AREIWLACYKHALKDVHFPLSVLEEFWQWIESF........................ 165
36 -14.5002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  1.........................................................MSSETVTLYEAIGG--DATVRALTRRFYELMDTLPEAARCRAIHPALSGSEAKFYDYLTGYLGGP------PVYVEKHPMLRRRHFVAPIGPA----ERDEWLLCFRRAMDETIENAKLREIIWAPVERL........................ 121
37 -14.5002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  11  1.........................................................MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNFPSNLEKLSGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKESY----NQLKGVILDVLTAASSLDESQAAT----AKLVDHVYAIIFKAIDDDGNAK..... 153
38 -14.3002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  10  1........................................................VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAHGKKVADGLTLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP-----AVHASLDKFLSSVSTVLTSKY............ 140
39 -14.1004bja_A mol:protein length:266 PROTEIN GLB-12  ali model follow..  1..............MGATLSAPKKKKTQVGASWVGNES------------ENPFDLALNKKDRTLLRETWQRLDDPKDIVGLIFLDIVNDEPDLKKVFGKMPKFGGHILRFYEFMEQLTSMLGTSENLTGAWQLVRKTGRSHVRQGFLEQNQNQMEKNYFEIVINVFIERFAQNYTTSQITDVWKKFLNTVISQMTDSFELERAKQKSAQT 219
40 -14.1004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  15  17.........................................................................EAAVEKAVDVFYERIVADPQLAPFFANVD-MKKQRRKQVAFMTYVFGGS------GAYEGRDLG--ASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASA........................ 121
41 -14.1001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  15  12.........................................................................AKTFDAIVSRFYAQVAEDEVLRRVYPEDD-LAGAEERLRMFLEQYWGGP------RTYSEQHPRLRMRHAPFRISLIERDAWLRCMHTAV-ASIDSETLDDEHRRELLDYLEM---AAHSLVNSPF............ 128
42 -14.0001dm1_A mol:protein length:146 MYOGLOBIN  ali model follow..  2.........................................................LSAAEADLAGKSWAPVFANKNANGDAFLVALFEFPDSANFFADIKASPKLRDHSSTIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDALKAAGK.................. 146
43 -14.0001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  9.........................................................................QAAVQAVTAQFYANIQADATVATFFNGID-MPNQTNKTAAFLCAALGGPNA---------TGRNLKEVHANMGVSNA-----FTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTV................. 116
44 -14.0001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  16  22.........................................................................HEAIEVVVEDFYVRVLADDQLSAFFSGTN-MSRLKGKQVEFFAAALGGP------EPYTGAPMK--QVHQGRGITMH-----FSLVAGHLADALTAAGVPSETITEILGVIAPL........................ 122
45 -14.0002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  10  10.........................................................................EETFTRLARRFYEGVAADPVLRPMYPEED-LGPAEERLRLFLMQYWGGP------RTYSERHPRLRMRHFPYRIGAE----ERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYA........................ 114
46 -14.0002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  15  22.........................................................................HEAIEVVVEDFFVRVLADDQLSAFFSGTN-MSRLKGKVVEFFAAALGGP------EPYTGAPMK--QVHQGRGITMH-----FSLVAGHLADALTAAGVPSETITEILGVIAPL........................ 122
47 -13.9001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  11  13.........................................................LTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFADPSAQNKFPAGMSASQLRSSHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNE-----KTRDAWAKAFSVVQAVLLVKH............ 157
48 -13.9002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  11  10.........................................................................AAAVDLAVEKFYGKVLADERVNRFFVNTD-MAKQKQHQKDFMTYAFGGT------DRFPGRSMR--AAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSV........................ 114
49 -13.9001flp_A mol:protein length:142 HEMOGLOBIN I (AQUO MET)  ali model follow..  11  2.........................................................LEAAQKSNVTSSWAKASAAWGTAGPEFFMALFDHDDVFAKFGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQL----EAAFKVLSGFMKSYGGDEGAWTAVAGALMGEIEPDM................... 142
50 -13.9002r1h_A mol:protein length:143 Hemoglobin subunit alpha-4  ali model follow..  11  1.......................................................XSLSAKDKANVKAIWGKILPKSDEIGEQALSRMLVYPQTKAYFSHWASVAPGSAPVKKHGITIMNQIDDCGHMDDLFGFLTKLSELHAKLRVDPTNFKILAHNLIVVIAAYFPAEFTP-----EIHLSVDKFLQQLALALAEKY............ 142
51 -13.8001g0b_A mol:protein length:141 HEMOGLOBIN ALPHA CHAIN  ali model follow..  10  1........................................................VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTP-----AVHASLDKFLSSVSTVLTSKY............ 140
52 -13.8001yhu_B mol:protein length:144 Giant hemoglobins B chain  ali model follow..  4.........................................................CGPLQRLKVKRQWAEAGNSREEFGHFIWSHVFQSPAARDMFKRVRGDNIHTPAFRAHATRVLGG----DDEPVLNTQLAHLAKQHETRGVEAAHYDTVNHAVMMGVENVIGSEVFDQDAWKPCLNVITNGI....................... 142
53 -13.8002c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  1.........................................................MNSEEVNDIKRTWEVVAAKMTEAGVEMLKRYFKYPHNLNHFPENARFKTHGTRILRQVDEGVKALSVDFGDKKFDDVWKKLAQTHHEKKVERRSYNELKDIIIEVVCSCVKLNEKQVHAYHKFFDRAYDIAFAEMA.................. 148
54 -13.7001b0b_A mol:protein length:142 HEMOGLOBIN  ali model follow..  11  2.........................................................LSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDHDDVFAKFSG-KNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQL----EAAFKVLAGFMKSYGGDEGAWTAVAGALMGMIRPDM................... 142
55 -13.7001ebt_A mol:protein length:142 HEMOGLOBIN  ali model follow..  11  2.........................................................LSAAQKDNVTSSWAKASAAWGTAGPEFFMALFDHDDVFAKFGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQL----EAAFKVLSGFMKSYGGDEGAWTAVAGALMGEIEPNM................... 142
56 -13.7001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  1.......................................................XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEFPDSANFFADIKASPKLRDVSSRIFTRLNEFVNNAANAGKMSAMLSQFAKEHVGFGVGSAQFENVRSMFPGFVASVAAPPAGADAAWTKLFGLIIDAL....................... 142
57 -13.6005d1v_A mol:protein length:127 Globin  ali model follow..  13.........................................................................EATFRRIVDIFYARVEADPRLRHLFPAD--LEPGKEHQRLFLMQYFGGP------RTYSERRPRLRMRHAPFPIGPR----ERDAWLEHMLAALNEAGVPEPARSVMENYFRHA........................ 116
58 -13.6003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  13  14.........................................................................ENAMKAAVPLFYKKVLADERVKHFFKNTD-MDHQTKQQTDFLTMLLGGPNH---------KGKNMTEAHKGMNLQNL----HFDAIIENLAATLKELGVTDAVINEAAKVIEHT........................ 114
59 -13.6003uhb_A mol:protein length:146 Globin-1  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANDKTLMYALQNFIDQLDNPDDLVCVVEKFAVNHITKKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
60 -13.6003uhc_A mol:protein length:146 Globin-1  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANDKTLMYALQAFIDQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
61 -13.5003uh6_A mol:protein length:146 Globin-1  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANDKALMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
62 -13.5001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGNVSQGMANDKTLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
63 -13.5003uhi_A mol:protein length:146 Globin-1  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANDKTLMYALQNFIDQLDNPDDLVCVVERFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
64 -13.5001cg5_A mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  1........................................................VLSSQNKKAIEELGNLIKANAEAWGADALARLFEHPQTKTYFSKFSGFEACNEQVKKHGKRVMNA----HHLDNLHLHLEDLARKHGNLLVDPH-----FHLFADCIVVTLAVNLQAFTP--VTHCAVDKFLELVAYELSSCY............ 140
65 -13.5003uhd_A mol:protein length:146 Globin-1  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANDKTLMYALQNFIDQLDNPDDLVCVVEKFAVAHITRKISAAEF----GKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
66 -13.5004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  11.........................................................GSEAIKANLRRSWGVLSADIEATGLMLMSNLFTRPDTKTYFTRLGDVQKGKANSKTLTYALNNFVDSLDDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDVAGAALVGVVQAAL....................... 150
67 -13.5001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  15  11.........................................................................TTAVDLAVDKFYERVLQDDRIKHFFADVD-MAKQRAHQKAFLTYAFGGT------DKYDGRYMR--EAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAP........................ 115
68 -13.5002r4x_A mol:protein length:146 Globin-1  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANDKTLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAAEF----GKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
69 -13.5003ugz_A mol:protein length:146 Globin-1  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFANQETIGYFKRLGDVSQGMANDKTLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
70 -13.5003wct_B mol:protein length:144 A2 globin chain of giant V2 hemoglobin  ali model follow..  3.........................................................CGPLQRLKVKRQWAEAGNGREEFGHFIWANVFKAPSARDMFKRVRGDNIYTPAFRAHATRVLGG----DDESVLNTQLAHLASQHSSRGVSAEQYNVVEHAVMMGVEHEIGQNVFDKDAWQACLDVITSGI....................... 141
71 -13.5002d2m_B mol:protein length:142 Giant hemoglobin, A2(a5) globin chain  ali model follow..  11  2.........................................................CTSLNRLLVKRQWAEAGTNRELLGNRIWEDLFAMPDARGLFSRVNGNDIDSSEFQAHSLRVLGG----DDVPVLNALLARLNSQHDSRGIPAAGYPAFVASAISAVRATVGARSFDNDAWNSCMNQIVSGI....................... 140
72 -13.5004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  13.........................................................SNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKSPSAKGKFSAGKDNSKLRGHSITLMYALQNFVDALDDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDTVAASLVAVVQAAL....................... 152
73 -13.5002grf_A mol:protein length:146 Globin-1  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVALVTTLFANQETIGYFKRLGDVSQGMANDKTLMYALQNFIDQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
74 -13.4003ugy_A mol:protein length:146 Globin-1  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANDKTLMYALQNYIDQLDNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145
75 -13.4002auo_A mol:protein length:146 Globin I  ali model follow..  10.........................................................LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANDKTLMYALQNFIDQLDNPDDLVCVVEKYAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAA..................... 145

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.