current user: public

If you have questions about the server, please let us know.

Query: 4uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170
# Score Template Links and tools%idFirst MKPSPEILALRWKDTSAHYSPHEWVAARNVVTANKAALADYFYESMLADPNAAFFLSDQLVKTKLHASMQDWLESVYAAAPTEEYERTVAFQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDASLSAAQAAATCRYVADVTMTAVEMMSHAYSVSHDRNARAEELELast
1 -76.9004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model  100  1MKPSPEILALRWKDTSAHYSPHEWVAARNVVTANKAALADYFYESMLADPNAAFFLSDQLVKTKLHASMQDWLESVYAAAPTEEYERTVAFQRKVGEVHARIDIPVHLVTRGASALIRRICELLDRDASLSAAQAAATCRYVADVTMTAVEMMSHAYSVSHDRNARAEELE 171
2 -64.9004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  27  2......AMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVD-DVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSD-YSAAEKLQVYHFSINSIDIAMEVMTRAFTFSDSSASKEDE.. 162
3 -63.8004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  27  1MEMYFKRMKDEWTGLVEQADPPIRAKAAEIAVAHAHYLSIEFYRIVRIDPHAEEFLSNEQVERQLKSAMERWIINVLSAQVD-DVERLIQIQHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSS-DYSAAEKLQVYHFSINSIDIAMEVMTRAFLE............ 157
4 -62.0004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  35  43PGISPEQQAAEWKLLLGQFPAPVVAQIRELATTHQSELPGYFYEQMLQDEQAMLFLTHEQVKSRLHGTLRQWIVSVFSMSDDDAAQALIAQQKQIGEIHARIKIPIHLVLRGARHLRERLFVLLRQR-PLDPEHKLFGQRLISETVDLAMEIMSRAFSDAYDRNSRSEE.. 211
5 -61.4002w31_A mol:protein length:162 GLOBIN  ali model follow..  20  2.....LTMQEIKAHYFTDEDAELLGSLFPLAETNKERLADQFYDYLLGIPETAEFLKEDLVLQKLKQTHQDWFVSLFAGSYDNRY---IHNLQKIGHAHVRVGLNAHYVNVAMNVVRQFTLSIIQDNFP-DPEERRQRREAVEKILDINLDIMSASYREEEMRKFFVSH.. 162
6 -57.5005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  15  2TGVPETVFEELKRYVWGDGDERALRSLHGAAAPHFPRLAEEFYDRILGHEGARTALGGESQVGHLKVTMIAWLDELLGGPWDEAY---WDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLARLAYERFHGDPPELERVRNALGKVLDLELAVMLHTYRED........... 160
7 -53.8001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  27LTNKHADVKKQLKMVLGDAELYVLEQLQPLIQENIVNIVDAFYKNLDHESSLMDIINDHSSVDRLKQTLKRHIQEMFAGVIDDEF---IEKRNRIASIHLRIGLLPKWYMGAFQELLLSMIDIYEASIT-NQQELLKAIKATTKILNLEQQLVLE................ 178
8 -49.9002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  11  18APFNLEDLKLLKEAVFTAEDEEYIQKAGEVLEDQVEEILDTWYGFVGSHPHLLYYFTNEKYLAAVRKRFSRWILDTSNRSYDQAW---LDYQYEIGLRHHRTKKNQTDNVESVPNIGYRYLVAFLARKGHTPEEVEKMYQAWFKATTLQVALWSYPYVKYGD......... 194
9 -16.8002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  10  1...............MTKEQIQIIKDCVPILQKNGEDLTNEFYKIMFNYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIE-NLENMRSFVDKVAITHVNLGVKEEHY----PIVGACLLKAIKNLLNPDEATLKAWEVAYGKIAKFYIDIEKKLYDK............ 140
10 -16.4001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  18  3...............FTEKQDALVSSSFEAFKANIPQYSVVFYTSILEAPAAKDLFGVDPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDKWSDELSRAEVAYDELAAAI......................... 140
11 -16.0003pmd_A mol:protein length:153 Conserved domain protein  ali model follow..  6.....................ATKRYLCLYLKESQEKFISNWKKRILVHE-------HDPYKNEIIKNGTHLLHVFTMYMREEINLQDIEDSKKIAQERMDAKVNIADFIYNTNEGKKEILNTL-FLLNPTGQECKVVIEQINLFFDHLIYSTIYSYYKLKKEYIHSYY.. 146
12 -16.0003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  13  1..............MIDQKEKELIKESWKRIEPNKNEIGLLFYANLFKEPTVSVLFQNPISSQKLMQVLGILVQGI------DNLEGLIPTLQDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYLGQGFTEEAKAATKVYGIAAQVM......................... 130
13 -15.7003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  10  1...............MTREEIKMIQKSWLRVIDKMDEAGLLFYRRLFDEPKVRPLFKIDIEKQKLMDVLNWIVLNL------QDIDAALDAARELARRHVKYGVKAEHYPVVGHTLIWTLRKMIGSEWTKQLEQLTQAYEALAQVM......................... 129
14 -15.6001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  10  1..............MLDQQTINIIKATVPVLKEHGVTITTTFYKNLFAHPEVRPLFDMGEQPKALAMTVLAAAQNI------ENLPAILPAVKKIAVKHCQAGVAAAHYPIVGQELLGAIKEVLGDAATDD------ILDAWGKAYGVIADVFIQVEADLYAQAVE..... 146
15 -15.5003pmc_A mol:protein length:139 Uncharacterized protein pXO2-61/BXB0075/GBAA_pXO2_0075  ali model follow..  1................GSHMEEIKCLLCRYLKERQEKFISDWKKKVIIRE-------RDPYKEEIIKNGEHLLSAFIMYLKEEISLQEIEISKKIARERIDAKVNIAEFIHNTNVAKIEIMNIL-TLLNPDLQQYQALVKKINQFFDHLIYYTVHSYYE............ 136
16 -14.8001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  14  3...............LTESQAALVKSSWEEFNANIPKHTHRFFILVLEAPAAKDLFSNNPELQAHAGKVFKLVYEAAIQLEVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSATIAYDELAIVI......................... 145
17 -14.2001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  10  12...............................AKTFDAIVSRFYAQVAEDEVLRRVYPEDD-LAGAEERLRMFLEQYWGGP--RTYSE--RGHPRLRMRHAPFRISLIERDAWLRCMHTAVASIDSETLDDEHRR-----ELLDYLEMAAHSLVNSPF.............. 128
18 -14.1001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  20  9...............................QAAVQAVTAQFYANIQADATVATFFNGID-MPNQTNKTAAFLCAALGGP----------TGRNLKEVHANMGVSNAQFTTVIGHLRSAL-----TGAGVAAALVEQTVAVAETVRGDVVTV................... 116
19 -14.0003zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  13  1.......MESEGKIVFTEEQEALVVKSWSVMKKNSAELGLKLFIKIFEAPTTKKMFQNPKLKPHAMSVFVMCCESAVQLRKTGKVTVRETTLKRLGASHSKYGVVDEHFEVAKYALLETIKEAVPEMWSPEMKVAGQAYDHLVAAIKAEMN.................... 157
20 -13.9005v3t_A mol:protein length:132 Globin  ali model follow..  12  1...............MSKQPMTPFEAIGG--EQCIEILVDTFYSYVSKHPDLSPIFPDD--LTETARKQKQFLTQYLGGP--NLYTE--HGHPMLRARHLPFEITPKRAEAWLSCMEQAM-----DDTGVHGHIREFVFERLALT.......................... 118
21 -13.7004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  11  31...............................EAGALAIANRFYDIMATDEYAKPLYDMHPLLDRIRQVFFEFLSGWLGGP--DLFVA--HGHPMLRKRHMPFTIDQDLRDQWMYCMNKTL-----DLEVDNPLLREGLKQSFGQL.......................... 137
22 -13.7004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  10  60...............................EELLRKLVEVHHENLMKSKIHYLFPTSHEQLRSLVKRSADFVVEMCGGP--PYYTL--RGEPKMRARHFSVTIDEKAREIWLACYKHAL-----KDVHFPLSVLEEFWQWIES---FSIRMINRRTTLEPPRRVPYSEIQ 188
23 -13.7003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  12  14...............................ENAMKAAVPLFYKKVLADERVKHFFKNTD-MDHQTKQQTDFLTMLLGGPNH--------KGKNMTEAHKGMNLQNLHFDAIIENLAATL-----KELGVTDAVINEAAKVIEHT.......................... 114
24 -13.7004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  1MQSLQDKASVLSGVDQAEAFAIDESNLFDKLLQTFINLSTNFYTRVYDDEEEWQSIFSNSNKEDAIQNQYEFFVQRMGGP--PLYSQ--KGHPALIGRHRPFPVTHQ----AAERWLEHMQNALDDSVDIDQDSKIKMMKFFRHT.......................... 140
25 -13.7002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  16  1...............MSSETVTLYEAIGG--DATVRALTRRFYELMDTLPEAARCRAIHPALSGSEAKFYDYLTGYLGGP--PVYVE--HGHPMLRRRHFVAPIGPAERDEWLLCFRRAM-----DETIENAKLREIIWAPVERL.......................... 121
26 -13.6002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  14  22...............................HEAIEVVVEDFFVRVLADDQLSAFFSGTN-MSRLKGKVVEFFAAALGGPEP--------TGAPMKQVHQGRGITMHHFSLVAGHLADAL-----TAAGVPSETITEILGVIAPL.......................... 122
27 -13.6001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  15  22...............................HEAIEVVVEDFYVRVLADDQLSAFFSGTN-MSRLKGKQVEFFAAALGGPEP--------TGAPMKQVHQGRGITMHHFSLVAGHLADAL-----TAAGVPSETITEILGVIAPL.......................... 122
28 -13.5003qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  13  10...............FTEEQEALVVKSWAVMKKNSAELGLKFFLKIFEAPSAKNLFQNPKLKPHAMTVFVMTCESAVQLRKAGKVTVRESNLKRLGAIHFKNGVVNEHFEVTRFALLETIKEAVPEMWSPEMKN------AWGEAYDQLVAAIKSEMKPSST......... 162
29 -13.5002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  16  10...............................EETFTRLARRFYEGVAADPVLRPMYPEED-LGPAEERLRLFLMQYWGGP--RTYSE--RGHPRLRMRHFPYRIGAEERDRWLTHMRAAV-----DDLALPAHLEQQLWEYLVYA.......................... 114
30 -13.4006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  19  10...............................AAAVAATVDVFYKKLMNDPDLEPFFRGVD-MVTLIAKQNRFLAYAFGAT--THYHG-----KDIVMGHAHLIINRGLNLTHFDKVAGHFVDSL-KEMGVGQELIDEAAGVLIGV.......................... 114
31 -13.4002vry_A mol:protein length:154 NEUROGLOBIN  ali model follow..  10  4...............MERPESELIRQSWRVVSRSPLEHGTVLFARLFAEPSLLPLFQYLDHIRKVMLVIDAAVTNV------EDLSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEKSLGPDFTPATRT------AWSRLYGAVVQAMSRGWDGE........... 154
32 -13.3001oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  1...............MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFQYLDHIRKVMLVIDAAVTNV------EDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKSLGPAFTPATRA------AWSQLYGAVVQAMSRGWDGE........... 151
33 -13.3004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  16  43...............................EETFTRLARRFFEGVAADPVLRPMFPEED-LGPAEERLRLFLMQYWGGP--ETYSE--RGHPRLRMRHEPYRIGAEERDRFLTHMRAAV-----DDLALPAHLEQQLWEYLVYA.......................... 147
34 -13.3004mpm_A mol:protein length:151 Neuroglobin  ali model follow..  1...............MERPEPELIRQSWRAVSRSPLEHGTVLFARLFAEPDLLPLFQYLDHIRKVMLVIDAAVTNV------EDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRA------AWSQLYGAVVQAMSRGWDGE........... 151
35 -13.3005d1v_A mol:protein length:127 Globin  ali model follow..  13  13...............................EATFRRIVDIFYARVEADPRLRHLFPAD--LEPGKEHQRLFLMQYFGGP--RTYSE--RGHPRLRMRHAPFPIGPRERDAWLEHMLAAL-----NEAGVPEPARSVMENYFRHA.......................... 116
36 -13.2002r1h_A mol:protein length:143 Hemoglobin subunit alpha-4  ali model follow..  12  1.............XSLSAKDKANVKAIWGKILPKSDEIGEQALSRMLVYPQTKAYFSHWASVAPGSAPVKKHGITIMNQ---GHMDDLFGFLTKLSELHAKLRVDPTNFKILAHNLIVVIAAYFPAEFTPEIHL------SVDKFLQQLALALAEKY.............. 142
37 -13.2002bk9_A mol:protein length:153 CG9734-PA  ali model follow..  1...............MNSDEVQLIKKTWEIPVATPTDSGAAILTQFFNFPSNLEKFGNARFRAHAGRIIRVFDESIQVLGQDGDLEKLDEIWTKIAVSHIPRTVSKE-----YNQLKGVILDVLTAASSLDES----QAATWAKLVDHVYAIIFKAIDDDGNAK....... 153
38 -13.0001d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  11  14...............FSEEQEALVLKSWAILKKDSANIALRFFLKIFEAPSASQMFKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSP-----AMKSAWSEAYDHLVAAIKQEMKPAE.......... 166
39 -13.0003qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  15  10...............FTEEQEALVVKAWAVMKKNSAELGLQFFLKIFEAPSAKNLFQNPKLKPHATTVFVMTCESAVQLRKAGKVTVKESDLKRIGAIHFKTGVVNEHFEVTRFALLETIKEAVPEMWSPEMKNAGVAYDQLVAAI......................... 153
40 -12.9004hrr_A mol:protein length:150 Globin-2 A chain  ali model follow..  12  11...............GSEAIKANLRRSWGVLSADIEATGLMLMSNLFTRPDTKTYFTRLGDVQKGKANLRGHAITLTYA---DDPSRLKCVVEKFAVNHINRKISGDAFGAIVEPMKETLKARMGNYYSDDVAGAAALVGVVQAAL......................... 150
41 -12.9001gvh_A mol:protein length:396 FLAVOHEMOPROTEIN  ali model follow..  10  1..............MLDAQTIATVKATIPLLVETGPKLTAHFYDRMFHNPELKEIFNNGDQREALFNAIAAYASNI------ENLPALLPAVEKIAQKHTSFQIKPE-----YNIVGEHLLATLDEMFSPGQEVLDAWGKAYGVLANVFINREAEIYNENASKA....... 146
42 -12.9002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  13  13...............................EETVAKLVEAFYRRVAAHPDLRPIFPDD--LTETAHKQKQFLTQYLGGP---PLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAM-----DEIGLSGPAREQFYHRLVLT.......................... 116
43 -12.8002r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  13  13...............FGEEQEALVLKSWAVMKKDAANLGLRFFLKVFEAPSAKQMFKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRETTLKRLGATHLRYGVADGHFEVTGFALLETIKEALPADMWSL-----EMKKAWAEAYSQLVAAIKREMKPD........... 164
44 -12.8001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  13  52...............................REAVEAAVDKFYNKIVADPTVSTYFSNTD-MKVQRSKQFAFLAYALGGA-----SEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTL-----TELGVPPEDITDAMAVVAST.......................... 154
45 -12.8002oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  11  10...............FSEEKEALVLKSWAIMKKDSANLGLRFFLKIFEAPSARQMFTNPKLKTHAVSVFVMTCEAAAQLRKAGKITVRETTLKRLGGTHLKYGVADGHFEVTRFALLETIKEALPADMWGP-----EMRNAWGEAYDQLVAAIKQEMKPAE.......... 162
46 -12.7004hrr_B mol:protein length:152 Hemoglobin B chain  ali model follow..  10  13...............SNADQKDLLRMSWGVLSVDMEGTGLMLMANLFKSPSAKGKFARLGDVSAGKDNLRGHSITLMYA---DDVERLKCVVEKFAVNHINRQISADEFGEIVGPLRQTLKARMGNYFDEDTVAAASLVAVVQAAL......................... 152
47 -12.7001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  14  14...............................EELLSQLVDTFYERVASHPLLKPIFPSD--LTETARKQKQFLTQYLGGPYTEEH-----GHPMLRARHLPFPITNERADAWLSCMKDAM-----DHVGLEGEIREFLFGRLELT.......................... 117
48 -12.7004g1b_A mol:protein length:399 Flavohemoglobin  ali model follow..  14  1..............MLAEKTRSIIKATVPVLEQQGTVITRTFYKNMLEHTELLNIFNVGAQPNALATTVLAAAKNI------DDLSVLMDHVKQIGHKHRALQIKPEHYPIVGEYLLKAIKEVLGDAATPEIINAGEAYQAIADIF......................... 133
49 -12.7001cg5_A mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  10  1..............VLSSQNKKAIEELGNLIKANAEAWGADALARLFEHPQTKTYFSKFSGFEACNEQVKKHGKRVMNA---HHLDNLHLHLEDLARKHGNLLVDPH-----FHLFADCIVVTLAVNLQAFTPVTHCA----DKFLELVAYELSSCY.............. 140
50 -12.6001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  11  13...............LTPAEKDLIRSTWDQLMTHRTGFVADVFIRIFHDPTAQRKFAELRTSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAELGVGFTKQVHDAAKTFAIVQGVL......................... 153
51 -12.6003bj1_A mol:protein length:142 hemoglobin alpha  ali model follow..  2...............LSSKDKDAVKALWGKIADKAEEIGADALGRMLAYPQTKTYFSHWKDLSPGSAPVNKHGKTIMGG---ASIDDLNAGLLALSELHATLRVDPANFKILSHCILVQLAVKFPKDFTPEVHL------SYDKFFSAVARALAEKY.............. 141
52 -12.5001hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  12  13...............LTLAQKKIVRKTWHQLMRNKTSFVTDVFIRIFADPSAQNKFSQLRSSRQMQAHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAELGSDFNEKTRDAAKAFSVVQAVL......................... 153
53 -12.5002dhb_A mol:protein length:141 HEMOGLOBIN (DEOXY) (ALPHA CHAIN)  ali model follow..  1..............VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAHGKKVADGTLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHA------SLDKFLSSVSTVLTSKY.............. 140
54 -12.5002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  16  10...............................AAAVDLAVEKFYGKVLADERVNRFFVNTD-MAKQKQHQKDFMTYAFGGT----------PGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTL-QELNVSQDLIDEVVTIVGSV.......................... 114
55 -12.5001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  18  11...............................TTAVDLAVDKFYERVLQDDRIKHFFADVD-MAKQRAHQKAFLTYAFGGT----------DGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEM----PEDLIAEVAAVAGAPAHKRDVLNQ................ 124
56 -12.4004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  20  17...............................EAAVEKAVDVFYERIVADPQLAPFFANVD-MKKQRRKQVAFMTYVFGGS--GAYEG-----RDLGASHRRLIREQGMNHHHFDLVAAHLDSTL-QELGVAQELKAEAMAIVASA.......................... 121
57 -12.3002olp_A mol:protein length:152 Hemoglobin II  ali model follow..  4...............LTNPQKAAIRSSWSKFMDNGVSNGQGFYMDLFKHPETLTPFKSKAQSLVFCNGMSSFVDHL------DDNDMLVVLIQKMAKLHNNRGIRAS-----LRTAYDILIHYMEDHNHMVGG----AKDAWEVFVGFICKTLGDYMKE............ 150
58 -12.3001cqx_A mol:protein length:403 FLAVOHEMOPROTEIN  ali model follow..  15  1..............MLTQKTKDIVKATAPVLAEHGYDIIKCFYQRMEAHPELKNVFNQGQQQQALARAVYAYAENI------EDPNSLMAVLKNIANKHASLGVKPEQYPIVGEHLLAAIKEVLGNAA--TDDIISAWAQAYGNLADVLMGMESELYERSAEQP....... 148
59 -12.2001g0b_A mol:protein length:141 HEMOGLOBIN ALPHA CHAIN  ali model follow..  1..............VLSAADKTNVKAAWSKVGGHAGEYGAEALERMFLFPTTKTYFPHFDLSHGSAQVKAHGKKVGDATLAVGHLDDLPGALSDLSNLHAKLRVDPVNFKLLSHCLLSTLAVHLPNDFTPAVHA------SLDKFLSSVSTVLTSKY.............. 140
60 -12.2004b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  1.......MATLEAMQVSEEQQSLIMEDVQVLLPNYDDFVEDVLQQFMENPETFQIFPWKSHAKSIGKVISDCLVDL------NGVKKHEPKLSSLGAMHTKKKVPTELFGKLGGCILTQVVKRVSEAKWSE-----EKKEAWLKAYGIITVMVTE................ 154
61 -12.0003cy5_A mol:protein length:141 Hemoglobin subunit alpha-2  ali model follow..  11  1..............VLSAADKSNIQAAWGKVGGHAADYGAEALERMFLFPTTKTYFPHFDLSHG-SAQVKGHGAKVANA---GHLDDLPGALSELSDLHAHLRVDPVNFKLLSHSLLVTLASHLPNDFTPAVHA------SLDKFLASVSTVLTSKY.............. 140
62 -12.0001gcv_A mol:protein length:140 HEMOGLOBIN  ali model follow..  2...............FTACEKQTIGKIAQVLAKSPEAYGAECLARLFVHPGSKSYFEYKDYSAA-GAKVQVHGGKVIRA---EHVDDLHSHLETLALTHGKLLVDPQNFPMLSECIIVTLATHLTEFSPDTHCAVDKLLSAICQEL......................... 135
63 -11.8001hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGNVSQGMANLRGHSITLMYA---DNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146
64 -11.8003uhc_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYA---DNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146
65 -11.8003uh6_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSIALMYA---DNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146
66 -11.8003uhi_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYA---DNPDDLVCVVERFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146
67 -11.8003uhd_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYA---DNPDDLVCVVEKFAVAHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146
68 -11.8003uhb_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYA---DNPDDLVCVVEKFAVNHITKKISAA-----FGKINGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146
69 -11.8003ugy_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYA---DNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146
70 -11.8003ugz_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVAAMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYA---DNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146
71 -11.8002auo_A mol:protein length:146 Globin I  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYA---DNPDDLVCVVEKYAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146
72 -11.8001mba_A mol:protein length:147 MYOGLOBIN  ali model follow..  11  1.............XSLSAAEADLAGKSWAPVFANKNANGLDFLVALFEFPDSANFFADRDVSSRIFTRLNEFVNNA------ANAGKMSAMLSQFAKEHVGFGVGSA-----FENVRSMFPGFVASVAAPPAG----ADAAWTKLFGLIIDALKAAGA............. 147
73 -11.7002grf_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALVTTLFANQETIGYFKRLGDVSQGMANLRGHSITLMYA---DNPDDLVCVVEKFAVNHITRKISAA-----FGKINGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146
74 -11.7001hds_A mol:protein length:141 HEMOGLOBIN S (DEOXY) (ALPHA CHAIN)  ali model follow..  10  1..............VLSAANKSNVKAAWGKVGGNAPAYGAQALQRMFLFPTTKTYFPHFDLSHG-SAQQKAHGQKVANA---GHLNDLPGTLSNLSNLHAKLRVNPVNFKLLSHSLLVTLASHLPTNFTPAVHA------NLNKFLANDSTVLTSKY.............. 140
75 -11.7002r4x_A mol:protein length:146 Globin-1  ali model follow..  10...............LTADVKKDLRDSWKVIGSDKKGNGVALMTTLFANQETIGYFKRLGDVSQGMANLRGVSITLMYA---DNPDDLVCVVEKFAVNHITRKISAA-----FGKMNGPIKKVLASKNFGDKYANAKLVAVVQAAL......................... 146

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.