current user: public

If you have questions about the server, please let us know.

Query: 4uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MIKRLFSKSKPATIEQTPTPEKTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDMHPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQHLast
1 -77.1004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model  100  1MIKRLFSKSKPATIEQTPTPEKTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDMHPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH 145
2 -69.9002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  39  2.................SSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAIHPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQE 129
3 -66.4002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  32  2......................TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYP--EEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVP 122
4 -66.0005d1v_A mol:protein length:127 Globin  ali model follow..  31  2...................SEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA---DLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNR. 123
5 -65.5005v3t_A mol:protein length:132 Globin  ali model follow..  31  2.................SKQPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD---DLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTP 126
6 -63.8002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  32  1..................EQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD---DLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNT. 123
7 -63.6001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  30  2....................PKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYP--EDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVNS. 126
8 -63.4004uzv_A mol:protein length:164 HEMOGLOBIN  ali model follow..  26  17....EASTYPVGAMTSQHDDQMTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFP--EEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVP 155
9 -61.4004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  14  1..............AADTAPADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFA--NVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTG 129
10 -60.1002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  13  2..........GLLSRLRKREPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFS--GTNMSRLKGKVVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGE 130
11 -60.0001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  14  3...........LLSRLRKREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFS--GTNMSRLKGKQVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGE 130
12 -60.0003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  21  2..................NKPQTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFK--NTDMDHQTKQQTDFLTMLLGGPNHYKGK----NMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK. 121
13 -59.3004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  20  4LQDKASVLSGVDQAEAFAIDESNLFDKLGL-QTFINLSTNFYTRVYDDEEEWFQSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDVDIDQDSKIKMMKFFRHTAFFLVAG. 147
14 -59.1006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  13  1.....................STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFR--GVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPER 122
15 -58.7002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  17  1.....................ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFV--NTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHDVLNR. 123
16 -58.5004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  17  32..SGSICEARIDFVFPEVKFPSKKVYLAAGEELLRKLVEVHHENLMKSK-IHYLFPTSHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMINRR 173
17 -58.5001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  34  2.................GQSFNAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPS---DLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQ. 124
18 -58.4001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  17  1......................SLFEQLGGQAAVQAVTAQFYANIQADATVATFFN--GIDMPNQTNKTAAFLCAALGGPNAWTGR----NLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVT.. 115
19 -57.8001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  19  2.....................STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFA--DVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAPARDVLNQ. 124
20 -56.9001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  13  26....SATAAAATAPAPARKCPSSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFS--NTDMKVQRSKQFAFLAYALGGASEWKGK--DMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNM. 161
21 -48.2002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  15  1.......................MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNSDEEWKEHKAKIGNFWAGMLLGEGDYNGQP----LKKHLDLPPFPQEFFEIWLKLFEESLNIVYNE-EMKNVILQRAQMIASHFQNM. 120
22 -16.3005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  16  34..............................APHFPRLAEEFYDRILGHEGARTALVGGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKV........ 145
23 -15.7001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  10  59..............................QENIVNIVDAFYKNLDHESSLMDIINDHSS-VDRLKQTLKRHIQEMFAGVIDDEFIEKRNRIASIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKI........ 168
24 -15.7002w31_A mol:protein length:162 GLOBIN  ali model follow..  11  29..............................ETNKERLADQFYDYLLGIPETAEFLKEDLV-LQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI........ 138
25 -14.9004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  13  32..............................VAHAHYLSIEFYRIVRIDPHAEEFLSNEQV-ERQLKSAMERWIINVLSAQVDDVERL-QHTVAEVHARIGIPVEIVEMGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINSID.. 145
26 -14.8001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  10.....................MQSYGRCCASTGF---FDDFYRHFASSPQIRAKFA--TTDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKSYY 132
27 -14.6004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  11  74..............................TTHQSELPGYFYEQMLQDEQAMLFLTHEQV-KSRLHGTLRQWIVSVFSMSQALIAQ--QKQIGEIHARIKIPIHGARHLRERLFVLLRQRPLDPEHKLFGQRLISET........ 187
28 -14.2004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  10  27..............................VAHAHYLSIEFYRIVRIDPHAEEFLSNEQV-ERQLKSAMERWIINVLSAQVDDVERL-QHTVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS........ 138
29 -13.7004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  11  32..............................TANKAALADYFYESMLADPNAAFFLSDQLV-KTKLHASMQDWLESVYAAAEEYER-AFQRKVGEVHARIDIPVHLVTRGASALIRRIRDASLSAAQAAATCRYVADV........ 145
30 -13.5002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  12  17..............................QKNGEDLTNEFYKIMNDYPEVKPMFNMEKQISGEQPKALAMAILMAAKNIENLEN----DKVAITHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYIDIE 134
31 -13.2002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  13  50..............................EDQVEEILDTWYGFVGSHPHLLYYFTSPDKYLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA........ 177
32 -12.9001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  11  18..............................KEHGVTITTTFYKNLAKHPEVRPLFDMGRQESLEQPKALAMTVLAAAQNIENLPA----KKIAVKHCQAGVAAAHYPIVGQELLGAIKEVAATDDILDAWGKAYGVIADVFIQVE 137
33 -12.9003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  15  17..............................IDKMDEAGLLFYRRLDVEPKVRPLFKIDIEKQGRKLMDVLNWIVLNLQDIDAALDA---RELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIEE. 132
34 -12.5003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  13  18..............................EPNKNEIGLLFYANLKEEPTVSVLFQNPISSQSRKLMQVLGILVQGIDNLEGLIPT---QDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTAE. 133
35 -12.3001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  14  19..............................KANIPQYSVVFYTSIEKAPAAKDLFSPTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK.. 142
36 -11.2001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  4.................SEDQEHYIKGVWKDVDHKQITAKALERVVVYPWTTRLFSKLQGLFSANDIGVQQHADKVQRALGEAIDDLKKQNLSGKHQEIGVDTQNFKLLGQTFMVELALHTFRPKEHAAAYKFFRLVAEALSSN. 139
37 -10.5001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  11.....................ASTWKDIAGADNGAGVGKECLSKFSAHPEMAAVFGFSGASDPGVAELGAKVLAQIGVAVSHLGDEGK-KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALIS.. 143
38 -10.3001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  11.....................ASTWKDIAGSDNGAGVGKECFTKFSAHHDMAAVFGFSGASDPGVADLGAKVLAQIGVAVSHLGDEGK-KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALIS.. 143
39 -10.2001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  14  19..............................NANIPKHTHRFFILVEIAPAAKDLFSQNNPELQAHAGKVFKLVYEALEVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVKWSEELNSAWTIAYDELAIVIKKE. 148
40 -10.0001kr7_A mol:protein length:110 Neural globin  ali model follow..  11  2...............................VNWAAVVDDFYQELKAHPEYQNKFGFKGVALGSLKGAYKTQAGKTVDYINAAIGGSADAGLASRHKGRNVGSAEFHNAKACLAKACSAH-GAPDLGHAIDDILSHL........ 110
41 -10.0001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  11.....................AATWKDIAGADNGAGVGKKCLIKFSAHPQMAAVFGFSGASDPGVAALGAKVLAQIGVAVSHLGDEGK-KAVGVRHKGYGIKAQYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALIS.. 143
42 -9.9101eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  10  21.....................................VGILYAVFKADPSIMAKFTQGTAPFETHANRIVGFFSKIIGELPNIEAD---NTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSK. 135
43 -9.8002vyw_A mol:protein length:148 HEMOGLOBIN  ali model follow..  1.........AVLTQTQIDSILADLAHHTDTTEHITEMGVSIYKTLAAHPEYISYFSKQSEGIRYYGRTLGEELIRLLKAASNPSV----VQGAKDHKARPVTKDQFTGAAPIFIKFFQGLLKKQEDKDAIEKFLLHVMQAIAAK. 147
44 -9.4202r4x_A mol:protein length:146 Globin-1  ali model follow..  26..............................GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGVSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
45 -9.3801hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  29..............................MTHRTGFVADVFIRIHNDPTAQRKFPQTSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAEGFTKQVHDAWAKTFAIVQGVLITKH 157
46 -9.3204b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  25..............................LPNYDDFVEDVLQQFEENPETFQIFPRSHPRFKSHAKSIGKVISDCLVDLNGVKK----SSLGAMHTKKKVPTELFGCILTQVVKRVSEAKWSEEKKEAWLKAYGIITVMVTE.. 154
47 -9.3103uhb_A mol:protein length:146 Globin-1  ali model follow..  26..............................GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITKKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
48 -9.3003uhc_A mol:protein length:146 Globin-1  ali model follow..  26..............................GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQAFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
49 -9.2803ugz_A mol:protein length:146 Globin-1  ali model follow..  26..............................GSDKKGNGVAAMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
50 -9.2703uhd_A mol:protein length:146 Globin-1  ali model follow..  26..............................GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
51 -9.2603ugy_A mol:protein length:146 Globin-1  ali model follow..  26..............................GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNYIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
52 -9.2504f68_A mol:protein length:110 Neural hemoglobin  ali model follow..  10  2...............................VNWAAVVDDFFQELKAHPEYQNKFGFKGVALGSLKGAYKTLAGKVVDYINAWIGGSADAALASRHKGRNVGSAEFHNAKACLAKACSAH-GAPDLGHAIDDILSHL........ 110
53 -9.2303uh6_A mol:protein length:146 Globin-1  ali model follow..  26..............................GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSIALMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
54 -9.2302grf_A mol:protein length:146 Globin-1  ali model follow..  26..............................GSDKKGNGVALVTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
55 -9.2103uhi_A mol:protein length:146 Globin-1  ali model follow..  26..............................GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----ERFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
56 -9.2002r4z_A mol:protein length:146 Globin-1  ali model follow..  26..............................GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
57 -9.1802auo_A mol:protein length:146 Globin I  ali model follow..  26..............................GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKYAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
58 -9.1702r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  10  1MALAEADDGAVVFGEEQEALVLKSWAVM--KKDAANLGLRFFLKVEIAPSAKQMFSEKNPKLKTHAMSVFVMTCEAAAQGKVTVRETTLKRLGATHLRYGVADGHFEALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKRE. 160
59 -9.1701hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  26..............................GSDKKGNGVALMTTLADNQETIGYFKRANDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL.... 146
60 -9.1604u8u_B mol:protein length:142 Globin b Chain  ali model follow..  11  23...............................HNREDFAQAIWRALAQVPDSRTLFKRTSPEFQAHALRVLAGFDIAISTLDQPDA----DHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRCWDKDAWSACFDHIAHGIKG.. 142
61 -9.1301x9f_B mol:protein length:145 Globin II, extracellular  ali model follow..  10  23..............................GHDREAFSQAIWRATAQVPESRSLFKRSHPAFIAHADRVLGGLDIAISTLDQPAT----DHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGIKGHH 145
62 -9.0801hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  12  29..............................MRNKTSFVTDVFIRIAYDPSAQNKFPQSSRQMQAHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAEDFNEKTRDAWAKAFSVVQAVLLVKH 157
63 -9.0604u8u_D mol:protein length:141 Globin d Chain  ali model follow..  12  21..............................GHHRVQFGLELWKRFDTHPEVKGLFKGYSPEFAAHAERVLSGLDMTIGLLDDTNA----THLHSQHVERSINPEFYEHFLGALLHVLPKYLGTKLDQDAWTKCFHTIADGIKG.. 141

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.