current user: public

If you have questions about the server, please let us know.

Query: 4uzv_A mol:protein length:164 HEMOGLOBIN, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160
# Score Template Links and tools%idFirst MVRVPRERSGTRSALGEASTYPVGAMTSQHDDQMTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPEDAQPPMVQLast
1 -76.4004uzv_A mol:protein length:164 HEMOGLOBIN  ali model  100  1MVRVPRERSGTRSALGEASTYPVGAMTSQHDDQMTFYEAVGGEETFTRLARRFFEGVAADPVLRPMFPEEDLGPAEERLRLFLMQYWGGPETYSERRGHPRLRMRHEPYRIGAEERDRFLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPEDAQPPMVQ 164
2 -63.4004uur_A mol:protein length:145 PUTATIVE HEMOGLOBIN-LIKE OXYGEN-BINDING PROTEIN  ali model follow..  26  5................LFSKSKPATIEQTPTPEKTPYEILGGEAGALAIANRFYDIMATDEYAKPLYDPLPLDRIRQVFFEFLSGWLGGPDLFVAKHGHPMLRKRHMPFTIDQDLRDQWMYCMNKTLDLEVDNPLLREGLKQSFGQLASHMINQH......... 145
3 -63.4002bmm_A mol:protein length:123 THERMOSTABLE HEMOGLOBIN FROM THERMOBIFIDA FUSCA  ali model follow..  95  2..................................TFYEAVGGEETFTRLARRFYEGVAADPVLRPMYPEEDLGPAEERLRLFLMQYWGGPRTYSERRGHPRLRMRHFPYRIGAEERDRWLTHMRAAVDDLALPAHLEQQLWEYLVYAAYAMVNVPE........ 123
4 -61.5005v3t_A mol:protein length:132 Globin  ali model follow..  36  2.............................SKQPMTPFEAIGGEQCIEILVDTFYSYVSKHPDLSPIFPD-DLTETARKQKQFLTQYLGGPNLYTEEHGHPMLRARHLPFEITPKRAEAWLSCMEQAMDDTGVHGHIREFVFERLALTAQHMVNTPNETGE.... 131
5 -61.5002xyk_A mol:protein length:133 2-ON-2 HEMOGLOBIN  ali model follow..  35  2.............................SSETVTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQEADN...... 132
6 -61.1001dly_A mol:protein length:164 HEMOGLOBIN  ali model follow..  14  10LRPCIRAQQQPVRPSTSATAAAATAPAPARKCPSSLFAKLGGREAVEAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGK--DMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ....... 164
7 -61.0005d1v_A mol:protein length:127 Globin  ali model follow..  51  2...............................SEPTIYEQIGGEATFRRIVDIFYARVEADPRLRHLFPA-DLEPGKEHQRLFLMQYFGGPRTYSERRGHPRLRMRHAPFPIGPRERDAWLEHMLAALNEAGVPEPARSVMENYFRHAAQAMMNRLGED...... 127
8 -60.5001ngk_A mol:protein length:128 Hemoglobin-like protein HbO  ali model follow..  54  2................................PKSFYDAVGGAKTFDAIVSRFYAQVAEDEVLRRVYPEDDLAGAEERLRMFLEQYWGGPRTYSEQRGHPRLRMRHAPFRISLIERDAWLRCMHTAVASITLDDEHRRELLDYLEMAAHSLVNSP......... 127
9 -60.4004xdi_A mol:protein length:135 Chlamydomonas reinhardtii THB1  ali model follow..  18  1..........................AADTAPADSLYSRMGGEAAVEKAVDVFYERIVADPQLAPFFANVDMKKQRRKQVAFMTYVFGGSGAYEGRDLGASHRRLIREQGMNHHHFDLVAAHLDSTLQELGVAQELKAEAMAIVASARPLIFGTGEAGAA.... 134
10 -59.6002bkm_A mol:protein length:128 TRUNCATED HEMOGLOBIN FROM GEOBACILLUS STEAROTHERMOPHILUS  ali model follow..  41  1..............................EQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPD-DLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDHLD..... 128
11 -59.3002gl3_A mol:protein length:136 Hemoglobin-like protein HbN  ali model follow..  17  2......................GLLSRLRKREPISIYDKIGGHEAIEVVVEDFFVRVLADDQLSAFFSGTNMSRLKGKVVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAP.... 135
12 -59.2001idr_A mol:protein length:136 HEMOGLOBIN HBN  ali model follow..  17  2......................GLLSRLRKREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGA----PMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAP.... 135
13 -58.3004nk1_A mol:protein length:193 Hemoglobin-like protein  ali model follow..  20  23.....KDREKKTAESGSICEARIDFVFPEVKFPSKKVYLAAGEELLRKLVEVHHENLMKSKIHYLFPSHEQLRSLVKRSADFVVEMCGGPPYYTLTRGEPKMRARHFSVTIDEKAREIWLACYKHALKDVHFPLSVLEEFWQWIESFSIRMINRRTTLEPPR.. 180
14 -57.5006bme_A mol:protein length:128 Truncated hemoglobin 4  ali model follow..  14  1.................................STLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAHLIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPERYKGKV.... 127
15 -57.4003aq5_A mol:protein length:121 Group 1 truncated hemoglobin  ali model follow..  19  2..............................NKPQTIYEKLGGENAMKAAVPLFYKKVLADERVKHFFKNTDMDHQTKQQTDFLTMLLGGPNHYKGK----NMTEAHKGMNLQNLHFDAIIENLAATLKELGVTDAVINEAAKVIEHTRKDMLGK.......... 121
16 -56.4004c0n_A mol:protein length:175 2-ON-2 HEMOGLOBIN  ali model follow..  23  1.........MQSLQDKASVLSGVDQAEAFAIDESNLFDKLGL-QTFINLSTNFYTRVYDDEEEWSIFSNSNKEDAIQNQYEFFVQRMGGPPLYSQRKGHPALIGRHRPFPVTHQAAERWLEHMQNALDDSDIDQDSKIKMMKFFRHTAFFLVAGNELKNQNEKP 157
17 -56.2002ksc_A mol:protein length:123 Cyanoglobin  ali model follow..  15  1.................................ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHDVLNR.......... 123
18 -56.1001dlw_A mol:protein length:116 HEMOGLOBIN  ali model follow..  20  1..................................SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGR----NLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVT........... 115
19 -55.6001s69_A mol:protein length:124 Cyanoglobin  ali model follow..  19  2.................................STLYEKLGGTTAVDLAVDKFYERVLQDDRIKHFFADVDMAKQRAHQKAFLTYAFGGTDKYDGRYMREAHKELVENHGLNGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGAHKRDVLNQ.......... 124
20 -54.2001ux8_A mol:protein length:132 YJBI PROTEIN  ali model follow..  37  2.............................GQSFNAPYEAIGE-ELLSQLVDTFYERVASHPLLKPIFPS-DLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAEDRS... 131
21 -42.8002ig3_A mol:protein length:127 Group III truncated haemoglobin  ali model follow..  15  1...................................MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNEEWKEHKAKIGNFWAGMLLGEGDYNGQP----LKKHLDLPPFPQEFFEIWLKLFEESLNIVYNE-EMKNVILQRAQMIASHFQNM.......... 120
22 -16.8001tu9_A mol:protein length:134 hypothetical protein PA3967  ali model follow..  16  10.................................MQSYGRCCASTGF---FDDFYRHFLASPQIRAKFATTDMTAQKHLLRAGIMNLVMYARGMSDSKLRAGASHSRAALDIRPELYDLWLDALLMAVAEHDCDAETRDAWRDVMGRGIAVIKSYYGS....... 134
23 -15.4001or4_A mol:protein length:178 Heme-based aerotactic transducer hemAT  ali model follow..  10  59..........................................QENIVNIVDAFYKNLDHESSLMDIINDHSVDRLKQTLKRHIQEMFAGVDEFIEKR--NRIASIHLRIGLLPKAFQELLLSMIDIYEASITNQQELLKAIKATTKI................. 168
24 -15.0002w31_A mol:protein length:162 GLOBIN  ali model follow..  13  29..........................................ETNKERLADQFYDYLLGIPETAEFLKEDLLQKLKQTHQDWFVSLFAGSYDNRYIHNLQKIGHAHVRVGLNAHAMNVVRQFTLSIIQDNFPDPEERRQRREAVEKI................. 138
25 -14.6004uii_A mol:protein length:217 GGDEF DOMAIN PROTEIN  ali model follow..  74..........................................TTHQSELPGYFYEQMLQDEQAMLFLTHEQKSRLHGTLRQWIVSVFSMSQALIAQ--QKQIGEIHARIKIPIHGARHLRERLFVLLRQRPLDPEHKLFGQRLISET................. 187
26 -14.3004zvb_A mol:protein length:163 Diguanylate cyclase DosC  ali model follow..  11  32..........................................VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQERLIQIQ--HTVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS................. 143
27 -13.8004zva_A mol:protein length:165 Diguanylate cyclase DosC  ali model follow..  11  27..........................................VAHAHYLSIEFYRIVRIDPHAEEFLSNEQERQLKSAMERWIINVLSAQERLIQIQ--HTVAEVHARIGIPVEGFRVLKKILYPVIFSSDYSAAEKLQVYHFSINS................. 138
28 -13.5005ohe_A mol:protein length:161 Globin-coupled histidine kinase  ali model follow..  15  34..........................................APHFPRLAEEFYDRILGHEGARTALGESQVGHLKVTMIAWLDELLGGPWDEAYWDRRYRIGRVHVRIGLPQHYMFGAMNVHRTGLERFHGDPPELERVRNALGKV................. 145
29 -13.3004uiq_A mol:protein length:177 GLOBIN-COUPLED SENSOR WITH DIGUANYLATE CYCLASE ACTIVITY  ali model follow..  16  32..........................................TANKAALADYFYESMLADPNAAFFLSDQLKTKLHASMQDWLESVYAAAEEYER-AFQRKVGEVHARIDIPVHLVTRGASALIRRIRDASLSAAQAAATCRYVADV................. 145
30 -13.2002veb_A mol:protein length:195 PROTOGLOBIN  ali model follow..  6IPGYTYGETENRAPFNLEDLKLLKEAVMFTAEDEEYIQKAGEEDQVEEILDTWYGFVGSHPHLLYYFTSPDLAAVRKRFSRWILDTSNRSYDQAWLDYQYEIGLRHHRTKKNQTDNYPITATMKPFLARKGHTPEEVEKMYQAWFKA................. 177
31 -12.7001vhb_A mol:protein length:146 HEMOGLOBIN  ali model follow..  13  18..........................................KEHGVTITTTFYKNLFAHPEVRPLFDRQESLEQPKALAMTVLAAAQNIENLPA----KKIAVKHCQAGVAAAHYPIVGQELLGAIKEVAATDDILDAWGKAYGVIADVFIQVEADLYAQAVE 146
32 -12.1003wfw_A mol:protein length:138 Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain  ali model follow..  17  21..............................................DEAGLLFYRRLFDEPKVRPLF-KIDIEKQGRKLMDVLNWIVLNLQDIDA----RELARRHVKYGVKAEHYPVVGHTLIWTLRKMEWTKQLEQLWTQAYEALAQVMIEE.......... 132
33 -11.9003s1i_A mol:protein length:139 Hemoglobin-like flavoprotein  ali model follow..  12  22..............................................NEIGLLFYANLFKEPTVSVLFQN-PISSQSRKLMQVLGILVQGIDNLEG----QDLGRRHKQYGVVDSHYPLVGDCLLKSIQEYGFTEEAKAAWTKVYGIAAQVMTAE.......... 133
34 -11.8002wy4_A mol:protein length:140 SINGLE DOMAIN HAEMOGLOBIN  ali model follow..  12  17..........................................QKNGEDLTNEFYKIMNDYPEVKPMFNMQISGEQPKALAMAILMAAKNIENLEN----DKVAITHVNLGVKEEHYPIVGACLLKAIKNLNPDEATLKAWEVAYGKIAKFYIDIEKK....... 136
35 -11.7001bin_A mol:protein length:143 LEGHEMOGLOBIN A  ali model follow..  10  19..........................................KANIPQYSVVFYTSILEAPAAKDLFTNPKLTGHAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAKWSDELSRAWEVAYDELAAAIKK........... 142
36 -11.0001jf3_A mol:protein length:147 monomer hemoglobin component III  ali model follow..  10  11.................................ASTWKDIAGADNGAGVGKECLSKFSAHPEMAAVFGDPGVAELGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYGDISGALISGLQS....... 147
37 -10.8001gdi_A mol:protein length:153 LEGHEMOGLOBIN (CARBONMONOXY)  ali model follow..  11  19..........................................NANIPKHTHRFFILVLEAPAAKDLFSNPELQAHAGKVFKLVYEALEVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVKWSEELNSAWTIAYDELAIVIKKEMDDAA..... 153
38 -10.7001jf4_A mol:protein length:147 monomer hemoglobin component IV  ali model follow..  11.................................ASTWKDIAGSDNGAGVGKECFTKFLSHHDMAAVFSDPGVADLGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAEYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQS....... 147
39 -10.6001gcv_B mol:protein length:136 HEMOGLOBIN  ali model follow..  4.............................TQEERDEISKTFQGTDMKTVVTQALDRMKVYPWTNRYFQKRTDFRSSIHAGIVVGALQDAVKHMDDKTLFKDLSKKHADLHVDPGSFHLLTDCIIVELAYLCFTPHIQGIWDKFFEVVIDAISKQ.......... 134
40 -10.6001cg5_B mol:protein length:141 PROTEIN (HEMOGLOBIN)  ali model follow..  4.............................SEDQEHYIKGVWKDVDHKQITAKALERVVVYPWTTRLFSDIGVQQHADKVQRALGEAIDDLKKVEI----QNLSGKHQEIGVDTQNFKLLGQTFMVELALHTFRPKEHAAAYKFFRLVAEALSSN.......... 139
41 -10.4001hbg_A mol:protein length:147 HEMOGLOBIN (CARBONMONOXY)  ali model follow..  11.................................AATWKDIAGADNGAGVGKKCLIKFSAHPQMAAVFGDPGVAALGAKVLAQIGVAVSHLGDEGK----KAVGVRHKGYGIKAQYFEPLGASLLSAMEHRKMNAAAKDAWAAAYADISGALISGLQS....... 147
42 -10.1002wtg_A mol:protein length:159 GLOBIN-LIKE PROTEIN  ali model follow..  16  20......................................MVGTEAQNIENGNAFYRYFTNFPDLRVYFKSERFDKQGQRILLACHLLYTNEEVFKG----RETINRHRIYKMDPALWMAFFTVFTGYLESGSLNDQQKAAWMALGKEFNAESQTHLKNSNLPHV. 159
43 -10.1001hlm_A mol:protein length:159 HEMOGLOBIN (CYANO MET)  ali model follow..  11  1............XGATQSFQSVGDLTPAEKDLIRSTWDQL--MTHRTGFVADVFIRIHNDPTAQRKFPSRQMHAHAIRVSALMTTYIDEMDTEVLPELLATLTRTHDKNHVGKKNYDLFGKVLMEAIKAEGFTKQVHDAWAKTFAIVQGVLITKHAS....... 159
44 -10.0003mkb_B mol:protein length:136 Hemoglobin subunit beta  ali model follow..  4.............................TQEERDEIVKTFFSANSSAIGTKALERMVVFPWTNAYFAKXXXFSASIHAAIVVGALQDAVKHEDDKAEFVNISKAHAKLHIDPGSFHLLTDSFIVELAHLAFTPFVFAVWIKFFQVVIDAISSQ.......... 134
45 -9.8701eca_A mol:protein length:136 ERYTHROCRUORIN (AQUO MET)  ali model follow..  12  21.................................................VGILYAVFKADPSIMAKFTTAPFETHANRIVGFFSKIIGELPNIEA----NTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSK.......... 135
46 -9.7402r4x_A mol:protein length:146 Globin-1  ali model follow..  10  26..........................................GSDKKGNGVALMTTLFADQETIGYFKNDKLRGVSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKMNGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
47 -9.6503uhb_A mol:protein length:146 Globin-1  ali model follow..  19.................................RDSWKVI--GSDKKGNGVALMTTLADNQETIGYFKNDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITKKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
48 -9.6403uhc_A mol:protein length:146 Globin-1  ali model follow..  19.................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQAFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
49 -9.6203uhd_A mol:protein length:146 Globin-1  ali model follow..  19.................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVAHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
50 -9.6203ugy_A mol:protein length:146 Globin-1  ali model follow..  10  19.................................RDSWKVI--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQNYIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
51 -9.6102r4z_A mol:protein length:146 Globin-1  ali model follow..  19.................................RDSWKVW--GSDKKGNGVALMTTLFADQETIGYFKNDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
52 -9.6003ugz_A mol:protein length:146 Globin-1  ali model follow..  19.................................RDSWKVI--GSDKKGNGVAAMTTLADNQETIGYFKNDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
53 -9.6002grf_A mol:protein length:146 Globin-1  ali model follow..  19.................................RDSWKVI--GSDKKGNGVALVTTLADNQETIGYFKNDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
54 -9.5802auo_A mol:protein length:146 Globin I  ali model follow..  19.................................RDSWKVI--GSDKKGNGVALMTTLADNQETIGYFKNDKLRGHSITLMYALQNFIDQLDNPDD----EKYAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
55 -9.5803qqq_A mol:protein length:168 Non-symbiotic hemoglobin  ali model follow..  11  26..........................................KKNSAELGLKFFLKIEIAPSAKNLFSNPKLKPHAMTVFVMTCESAVQLRKAGK----KRLGAIHFKNGVVNEHFEVTRFALLETIKEAMWSPEMKNAWGEAYDQLVAAIKSEMKPSST.... 162
56 -9.5702r50_A mol:protein length:165 Non-symbiotic hemoglobin  ali model follow..  15  2.............ALAEADDGAVVFGEEQEALVLKSWAVM--KKDAANLGLRFFLKVEIAPSAKQMFSNPKLKTHAMSVFVMTCEAAAQLRKAGK----KRLGATHLRYGVADGHFEALLETIKEALPADMWSLEMKKAWAEAYSQLVAAIKREMKPDA..... 165
57 -9.5701d8u_A mol:protein length:166 NON-SYMBIOTIC HEMOGLOBIN  ali model follow..  15  30..........................................KKDSANIALRFFLKIEVAPSASQMFSNPKLKTHAMSVFVMTCEAAAQLRKAGK----KRLGATHLKYGVGDAHFEALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE..... 166
58 -9.5603uhi_A mol:protein length:146 Globin-1  ali model follow..  19.................................RDSWKVI--GSDKKGNGVALMTTLADNQETIGYFKNDKLRGHSITLMYALQNFIDQLDNPDD----ERFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
59 -9.5501hbi_A mol:protein length:146 HEMOGLOBIN (OXY)  ali model follow..  19.................................RDSWKVI--GSDKKGNGVALMTTLADNQETIGYFKNDKLRGHSITLMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
60 -9.5403uh6_A mol:protein length:146 Globin-1  ali model follow..  26..........................................GSDKKGNGVALMTTLADNQETIGYFKNDKLRGHSIALMYALQNFIDQLDNPDD----EKFAVNHITRKISAAEFGKINGPIKKVLASKNFGDKYANAWAKLVAVVQAAL............. 146
61 -9.4602d2m_A mol:protein length:140 Giant hemoglobin, A1(b) globin chain  ali model follow..  12  21..........................................AENRAAFSRDLFSELNIQGSSRALFSSAAFTAHCLRVTGALNRLISQ----------AHLAGQHASRNLDASNFAAMGQAVMSVVPTH-LDCFNQHAWGECYERIASGIS............ 139
62 -9.4204u8u_B mol:protein length:142 Globin b Chain  ali model follow..  12  23...........................................HNREDFAQAIWRALAQVPDSRTLFTSPEFQAHALRVLAGFDIAISTLDQPDA----DHLEKQHEGRHIPDNYFDAFKTALLHVLPAQLGRCWDKDAWSACFDHIAHGIKG........... 142
63 -9.4103wct_A mol:protein length:146 A1 globin chain of giant V2 hemoglobin  ali model follow..  11  21..........................................GTERAKFGNSLWTSINYAPDARDLFKSPQFKAHIARVIGGLDRVISM----------EHLKSQHDPRGLDALNFVVFGKALFATVGGQFGVCFDLPAWESCYKVIAMGITGNDMFS...... 146
64 -9.4104mpm_A mol:protein length:151 Neuroglobin  ali model follow..  12  17..........................................SRSPLEHGTVLFARLFAEPDLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKCAFTPATRAAWSQLYGAVVQAMSRGWDGE...... 151
65 -9.4001yhu_A mol:protein length:145 hemoglobin A1 chain  ali model follow..  12  11.................................KDEWAKAYGGAARSKFGDALWRNVNYAPNARDIFESPEFKAHIARVLGGLDRVISMLDNQAT----AHLKSQHDPRTIDPVNFVVFRKALIATVAGTFGVCFDVPAWQGCYNIIAKGITGSDAA....... 145
66 -9.3502oif_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  16  26..........................................KKDSANLGLRFFLKIEIAPSARQMFPNPKLKTHAVSVFVMTCEAAAQLRKAGK----KRLGGTHLKYGVADGHFEALLETIKEALPADMWGPEMRNAWGEAYDQLVAAIKQEMKPAE..... 162
67 -9.2701oj6_A mol:protein length:151 NEUROGLOBIN  ali model follow..  12  17..........................................SRSPLEHGTVLFARLALEPDLLPLFQSPEFLDHIRKVMLVIDAAVTNVEDLSS----ASLGRKHRAVGVKLSSFSTVGESLLYMLEKSAFTPATRAAWSQLYGAVVQAMSRGWDGE...... 151
68 -9.2601hlb_A mol:protein length:158 HEMOGLOBIN (DEOXY)  ali model follow..  11  1.......................................XGGTLAIQKIVRKTWHQLMRNPSAQNKFPSRQMQAHAIRVSSIMSEYVEELDSDILPELLATLARTHDLNKVGADHYNLFAKVLMEALQAEDFNEKTRDAWAKAFSVVQAVLLVKHG........ 158
69 -9.1601x9f_B mol:protein length:145 Globin II, extracellular  ali model follow..  12  23..........................................GHDREAFSQAIWRATAQVPESRSLFKHPAFIAHADRVLGGLDIAISTLDQPAT----DHLQVQHEGRKIPDNYFDAFKTAILHVVAAQLGRCYDREAWDACIDHIEDGIKG........... 143
70 -9.1402c0k_A mol:protein length:151 HEMOGLOBIN  ali model follow..  10.................................KRTWEVV--AAKMTEAGVEMLKRYKKYPHNLNHFPNARFKTHGTRILRQVDEGVKALSVDFGDK--KKLAQTHHEKKVERRSYNELKDIIIEVVCSVKLNEKQVHAYHKFFDRAYDIAFAEMAKMG..... 151
71 -9.1404u8u_D mol:protein length:141 Globin d Chain  ali model follow..  11  21..........................................GHHRVQFGLELWKRFDTHPEVKGLFKSPEFAAHAERVLSGLDMTIGLLDDTNA----THLHSQHVERSINPEFYEHFLGALLHVLPKYLGTKLDQDAWTKCFHTIADGIKG........... 141
72 -9.0903qqr_A mol:protein length:162 Non-legume hemoglobin  ali model follow..  26..........................................KKNSAELGLQFFLKIEIAPSAKNLFSNPKLKPHATTVFVMTCESAVQLRKAGK----KRIGAIHFKTGVVNEHFEVTRFALLETIKEAMWSPEMKNAWGVAYDQLVAAIKFEMKPSST.... 162
73 -9.0703zhw_A mol:protein length:160 NON-SYMBIOTIC HEMOGLOBIN 1  ali model follow..  11  25..........................................KKNSAELGLKLFIKIFEAPTTKKMFSNPKLKPHAMSVFVMCCESAVQLRKTGK----KRLGASHSKYGVVDEHFEVAKYALLETIKEAMWSPEMKVAWGQAYDHLVAAIKAEMNLSN..... 160
74 -9.0604b4y_A mol:protein length:154 NEUROGLOBIN  ali model follow..  25..........................................LPNYDDFVEDVLQQFEENPETFQIFPHPRFKSHAKSIGKVISDCLVDLNGVKK----SSLGAMHTKKKVPTELFGCILTQVVKRVSEAKWSEEKKEAWLKAYGIITVMVTE........... 154
75 -9.0303pt7_B mol:protein length:152 Hemoglobin III  ali model follow..  1.....................SSGLTGPQKAALKSSWSRF--MNNAVTNGTNFYMDLFKAPDTLTPFKHPTMKAQSLVFCNGMSSFVDNLDDHEV----QKMAKLHFNRGIRIKELRDGYGVLLRYLEDCHVEGSTKNAWEDFIAYICRVQGDFMKER...... 151

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.