current user: public

If you have questions about the server, please let us know.

Query: 4wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase, from PDB1018

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst FQSMSAFSRFTPLIQSLPASVPFVGPEALERQHGRKIAARIGANESGFGPAPSVLLAIRQAAGDTWKYADPENHDLKQALARHLGTSPANIAIGEGIDGLLGQIVRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADDREDLEGLLAAVGRENAPLVYLANPDNPMGSWWPAERVVAFAQALPETTLLVLDEAYCETAPRDALPPIESLIDKPNVIRARTFSKAYGLAGARIGYTLSTPGTAQAFDKIRNHFGMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDASYARAIVDRLMSDHGIFIRMPGVAPLNRCIRISTAPDAEMDLLAAALPEVIRSLAATLast
1 -110.0004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model  100  1FQSMSAFSRFTPLIQSLPASVPFVGPEALERQHGRKIAARIGANESGFGPAPSVLLAIRQAAGDTWKYADPENHDLKQALARHLGTSPANIAIGEGIDGLLGQIVRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADDREDLEGLLAAVGRENAPLVYLANPDNPMGSWWPAERVVAFAQALPETTLLVLDEAYCETAPRDALPPIESLIDKPNVIRARTFSKAYGLAGARIGYTLSTPGTAQAFDKIRNHFGMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDASYARAIVDRLMSDHGIFIRMPGVAPLNRCIRISTAPDAEMDLLAAALPEVIRSLAAT 376
2 -101.0003ffh_A mol:protein length:363 Histidinol-phosphate aminotransferase  ali model follow..  23  1....SNAMKWKKSLAGLSSYKPGKREEEVMAELGLTKITKLSSNENPLGTSKKVAAIQANSSVETEIYPDGWASSLRKEVADFYQLEEEELIFTAGVDELIELLTRVLLDTTTNTVMATPTFVQYRQNALIEGAEVREIPLLQDGHDLEGMLNAID-EKTTIVWICNPNNPTGNYIELADIQAFLDRVPSDVLVVLDEAYIEYVTPQPEKHEKLVRTYKNLIITRTFSKIYGLASARVGYGIADKEIIRQLNIVRPPFNTTSIGQKLAIEAIKDQAFIGECRTSNANGIKQYEAFAKRFKVKLYPANGNFVLIDLGIE----AGTIFSYLEKNGYITRSGAALGFPTAVRITIGKEEDNSAVIALLEKLL...... 363
3 -100.0003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  23  3........KFNEFLNNLSNYEPGKDIEVIAKEYGVKEVIKLASNENPFGTPPKAIECLRQNANKAHLYPDDSMIELKSTLAQKYKVQNENIIIGAGSDQVIEFAIHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITHNDEFKKLYETHK-DEIKLIFLCLPNNPLGECLDASEATEFIKGVNEDCLVVIDAAYNEFASFKDSKPCELIKEFDNVLYLGTFSKLYGLGGLRIGYGIANANIISAFYKLRAPFNVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDE---KNSTDLSEKLLKKGIIIRNLKSYGLN-AIRITIGTSYENEKFFTEFDKILR..... 365
4 -97.8004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  31  2.....VTARLRPELAGLPVYVPGKTVPGA---------IKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCVQLKAALARHLGFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLYAMLATVT-DRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAIDEAYVEYIRDGMRDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDKVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSR----TQDFVEQAADARIVVRPY----GTDGVRVTVAAPEENDAFLRFARRWRSDQKLA 357
5 -95.3003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  25  2...............ETQPESAAF------TAPSTDNPIRINFNENPLGMSPKAQAAARDAVVKANRYAKNEILMLGNKLAAHHQVEAPSILLTAGSSEGIRAAIEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDNWFDIEGLKAAVAAYGPSIVYLVNPNNPTGTITPADVIEPWIASKPANTMFIVDEAYAEFVNDPRFRSI-ITQGAENIILLKTFSKIHAMAGMRVGYAVAHPTVIALMGRYVAGEKINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNFVFHQLVVP----LKDYQTHMADAGVLIGRAF-PPADNWCRISLGTPQEMQWVADTMREFRKK.... 351
6 -94.0003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  26  3......LIPLRQNIASMKGYIPGYQPPDIAS------WIKLNTNENPYPPSPEVVKAILEELGALRIYPSASSQKLREVAGELYGFDPSWIIMANGSDEVLNNLIRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTG---DFRIAGFPER-YEGKVFFLTTPNAPLGPSFPLEYIDELARRCAG--MLVLDETYAEFAES---NALELVRRHENVVVTRTLSKSYSLAGMRIGLAIARPEVIAALDKIRDHYNLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPD---RDGKRVYDGLYARKVLVRHFSDPLLAHGMRISIGTREEMEQTLAALKEIGEG.... 354
7 -92.6003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  25  1......................GMSVGEAMDTEAAAQAVCLAFNENPEAVEPRVQAAIAAAAARINRYPFDAEPRVMRKLAEHFSCPEDNLMLVRGIDECFDRISAEF--SSMRFVTAWPGFDGYRARIAVSGLRHFEIGLTDDLLDPNDLAQV---SRDDCVVLANPSNPTGQALSAGELDQLRQRAG---KLLIDETYVDYSSF----RARGLAYGENELVFRSFSKSYGLAGLRLGALFGPSELIAAMKRKQWFCNVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEANFVLVENAA-----GERTLRFLRERGIQVKDAGQFGLHHHIRISIGREEDNDRLLAALAEYSDH.... 336
8 -88.5003cq4_A mol:protein length:376 Histidinol-phosphate aminotransferase  ali model follow..  20  1MTKITLSDPLREELRGEHAYGAPQL----------NVDIRLNTNENPYPPSEALVADLVATVDELNRYPERDAVELRDELAAYIAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTEFIAVSRGADFIDMDVALEEIRAKQPDIVFVTTPNNPTGDVTSLDDVERIINVAPG--IVIVDEAYAEFSPSP--SATTLLEKYPKLVVSRTMSKAFDFAGGRLGYFVANPAFIDAVMLVRLPYHLSALSQAAAIVALRHSADTLGTVEKLSVERVRVAARLEELGYAVVPSESNFVFFGDFSD----QHAAWQAFLDRGVLIRDV---GIAGHLRTTIGVPEENDAFLDAAAEIIKLNLSA 368
9 -87.3002f8j_A mol:protein length:347 Histidinol-phosphate aminotransferase  ali model follow..  20  1................MGSDKIMNPLDLIAKRAEKRDKTYLALNENPFPFPEDLVDEVFRRLNSLRIYYDSPDEELIEKILSYLDLSKNNVSVGNGADEIIYVMMLMF----DRSVFFPPTYSCYRIFAKAVGAKFLEVPLTKDLR-----IPEVNVGEGDVVFIPNPNNPTGHVFEREEIERIL---KTGAFVALDEAYYEFHGE---SYVDFLKKYENLAVIRTFSKAFSLAAQRVGYVVASEKFIDAYNRVRLPFNVSYVSQMFAKVALDHREIFEERTKFIVEERERMKSALREMGYRITDSRGNFVFVFMEKE---EKERLLEHLRTKNVAVR-----SFREGVRITIGKREENDMILRELEVF....... 340
10 -87.2001fg3_A mol:protein length:356 HISTIDINOL PHOSPHATE AMINOTRANSFERASE  ali model follow..  21  1MSTVTITDLARENVRNLTPYQSA-------RRLGGNGDVWLNANEYPTAVEFQLTQQ------TLNRYPECQPKAVIENYAQYAGVKPEQVLVSRGADEGIELLIRAFCEPGDAILYCPPTYGMYSVSAETIGVECRTVPTLDNWLDLQGISDKL--DGVKVVYVCSPNNPTGQLINPQDFRTLLELTRGKAIVVADEAYIEFCPQASL--AGWLAEYPHLAILRTLSKAFALAGLRCGFTLANEEVINLLMKVIAPYPLSTPVADIAAQALSPQGIMRERVAQIIAEREYLIAALKEIPCQVFDSETNYILARFKA-----SSAVFKSLWDQGIILRDQNKQSLSGCLRITVGTREESQRVIDALRAE....... 354
11 -87.2004r8d_A mol:protein length:394 Histidinol-phosphate aminotransferase  ali model follow..  22  16.........LRADLRGKAPYGAPQL----------AVPVRLNTNENPHPPTRALVDDVVRSVRELHRYPDRDAVALRADLAGYLTLGVENIWAANGSNEILQQLLQAFGGPGRSAIGFVPSYSMHPIISDGTHTEWIEASRANDFLDVDVAVAAVVDRKPDVVFIASPNNPSGQSVSLPDLCKLLDVAPG--IAIVDEAYGEFSSQP--SAVSLVEEYPKLVVTRTMSKAFAFAGGRLGYLIATPAVIDAMLLVRLPYHLSSVTQAAARAALRHSDDTLSSVAALIAERERVTTSLNDMGFRVIPSDANFVLFGEFAD----APAAWRRYLEAGILIRDV---GIPGYLRATTGLAEENDAFLRASARIATDLVPV 373
12 -87.0003euc_A mol:protein length:367 Histidinol-phosphate aminotransferase 2  ali model follow..  22  5VDPSLIERIIRDDVRAMGAYHVPDS----------HGLVKLDAMENPYRLPPALRSELAARLGELNRYPVPSSEALRAKLKEVMQVPAGEVLLGNGSDEIISMLALAAARPGAKVMAPVPGFVMYAMSAQFAGLEFVGVPLRADFLDRGAMLAAMAEHQPAIVYLAYPNNPTGNLFDAADMEAIVRAAQGSVLVVVDEAYQPFAQE---SWMSRLTDFGNLLVMRTVSK-LGLAGIRLGYVAGDPQWLEQLDKVRPPYNVNVLTEATALFALEHVAVLDEQAAQLRAERSRVAEGMAAHGVTVFPSAANFLLARVPD-----AAQTFDRLLARKVLIKNVSKMHLANCLRVTVSTPEENAQFLEAFAASLQD.... 367
13 -80.6003ftb_A mol:protein length:361 Histidinol-phosphate aminotransferase  ali model follow..  17  1.........MYQKFKGGDLMIHGGDIYTEGVFKG-RELLDYSSNINPLGIPKSFLNNIDEGIKNLGVYPDVNYRRLNKSIENYLKLKDIGIVLGNGASEIIELSISLF----EKILIIVPSYAEYEINAKKHGVSVVFSYLDENMIDYEDIISKI--DDVDSVIIGNPNNPNGGLINKEKFIHVLKLAEEKKTIIIDEAFIEFTGDPSSSFVGEIKNYSCLFIIRAMTKFFAMPGIRFGYGINNKEIAAKIKAKQNPWNINCFAEMAAINCLKDTNYIEESLLWIKKERKRFIEELNKIGFRVFSPHANFVLCRLE---NISGEKLYDSLLKEDIVIRRCCNFI-DSFVRFAIKDEKKNTKFLRALKGVENNL... 361
14 -77.4003fkd_A mol:protein length:350 L-threonine-O-3-phosphate decarboxylase  ali model follow..  17  11...............................TPLSSEIVNFSTTVWTDGDKDHLEKHLVENLNCIRHYPEPDAGTLRQMLAKRNSVDNNAILVTNGPTAAFYQIAQAF--RGSRSLIAIPSFAEYEDACRMYEHEVCFYPSNED-------IGEADFSNMDFCWLCNPNNPDGRLLQRTEILRLLNDHP-DTTFVLDQSYVSFTTEE-VIRPADIKGRKNLVMVYSFSHAYGIPGLRIGYIVANKDFMKRVAAFSTPWAVNALAIEAAKFILIHPAQFTLPIRKWQRNTVDFITALNRLGVEVHPSGTTFFLLRLKKGT--AAELKKYMLEEYNMLIRDASNFR-ESYVRITTQRPAQNQLFIKALETFLEKYEG. 344
15 -77.3001lc5_A mol:protein length:364 L-Threonine-O-3-Phosphate Decarboxylase  ali model follow..  20  2...............ALFNTAHGGNIREPATVLGIDQLLDFSANINPLGMPVSVKRALIDNLDCIERYPDADYFHLHQALARHHQVPASWILAGNGETESIFTVASGL--KPRRAMIVTPGFAEYGRALAQSGCEIRRWSLRDGWQLTDAILEALT-PDLDCLFLCTPNNPTGLLPERPLLQAIADRCKSNINLILDEAFIDFIPHET-GFIPALKDNPHIWVLRSLTKFYAIPGLRLGYLVNSDDAMARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLTVYPGRANYLLLRCERE----DIDLQRRLLTQRILIRSCANYP-SRYYRVAIRSAAQNERLLAALRNVLTGIAPA 363
16 -51.2003bwn_A mol:protein length:391 L-tryptophan aminotransferase  ali model follow..  15  22...................................DFVVNLDHGDPTAYEEYWRKMGDRCTVSDMTNLCWFLEPELEDAIKDLHGTEDRYIVVGTGSTQLCQAAVHALSSLARSVVAAAPFYSTYVEETTYVRSGMYKWEGD---------AWGFDKKGPYIELVTSPNNPDGTIR--ETVVNRPDD--DEAKVIHDFAYYWPH-------TPITRRQDHDIMLFTFSKITGHAGSRIGWALVKDKEVAKKMVIVNSIGVSKESQVRTAKILNSENFFKYGREMMKNRWEKLREVVKESDAFTLPKYPEAFCNYFGK-GTKEETDLVSELRRHKVMSRAGERCGSKKHVRVSMLSREDVNVFLERLANMKLIKSID 390
17 -44.5001v2d_A mol:protein length:381 Glutamine Aminotransferase  ali model follow..  17  2............RLHPRTEAAKESIFPRMSGLAQRLGAVNLGQGFPSNPPPPFLLEAVRRALGRQDQYPPAGLPALREALAEEFAVEPESVVVTSGATEALYVLLQSLVGPGDEVVVLEPFFDVYLPDAFLAGAKARLVRLDGFRLDLSALEKALT-PRTRALLLNTPMNPTGLVFGERELEAIARLARADLFLISDEVYDELYYGERPRRLREFAP-ERTFTVGSAGKRLEATGYRVGWIVGPKEFMPRLAGMRQSFSAPTPLQAGVAEALKREGFYEALREGYRRRRDLLAGGLRAMGLRVYVPEGTYFLM-----AELPGWDAFRLVEEARVALIPASAFYLKDLFRFAFCKTEEEHLALERLGRVVNSPREA 374
18 -44.2003ezs_A mol:protein length:376 aminotransferase AspB  ali model follow..  14  2..............MTFEPYPFERLRALLKEITPKKRGLDLGIGEPQFETPKFIQDALKNHTHSLNIYPKSAFESLRAAQRGFFELKENELISTLGSREVLFNFPSFVLYQNPTIAYPNPFYQIYEGAAKFIKAKSLLMPLTKENDFTPSLNEKEL-QEVDLVILNSPNNPTGRTLSLEELISWVKLALKDFILINDECYSEIYENTPPPSLLEACMFKNVLVIHSLSKRSSAPGLRSGFIAGDSRLLEKYKAFRAGYTSANAIQKASEAAWLDDRHAEFFRNIYANNLKLARKIFKNT---LIYPYSFYVYLPVQNGENFAK----TLYQNEGIITLPALYLG-ADYVRLALVYDTPLEKPLEIIETYRENHA.. 376
19 -43.7004m2j_A mol:protein length:406 Aminotransferase  ali model follow..  14  8.LVPRGSHMSSLRPRREDPPVLEEWYRRHLGPDIHD-ISSSGVHPYSFAEIRDVCRIPAADLDAMDDSVSQGGEGVRRAIADRYGGDADRVLVTHGSSEAIALTLNALLHRGDRVVVQEGIYHSLGHYPRAAGCDVAVLPGRDGEIDPDVLAGLVT-PGTAAVIVNFPHNPTGVTLSPQGLRALKERTAAGAVLVWDAATAEIAHRWE-VLADPGADGGDTVSYGTLSKTFGLPGLRVGWAVAPKELLTATFPLRDTLFLSPLVELVAERAVRHDELIGARAAEARHNLAHLTGWMAAHE--TPPEGGVCALPVFREGPQEVERFCLELLERHRTLLVPGTAFGAPHGARLGFGGPQEDRAGLDGLSRFLRERAAG 399
20 -43.2002o1b_A mol:protein length:404 Aminotransferase, class I  ali model follow..  19  8.LVPRGSHMISNKLANIPDSYFGKTMGRKIEHGPLP-LINMAVGIPDGPTPQGIIDHFQKALTINQKYGAFHGKAFKQAIVDFYQ-KEDEVCILYGTKNGLVAVPTCVINPGDYVLLPDPGYTDYLAGVLLADGKPVPLNLEPPHYDWSKVDSQII-DKTKLIYLTYPNNPTGSTATKEVFDEAIAKFKGDTKIVHDFAYGAFGDAKNPSILASENGKDVAIEIYSLSKGYNMSGFRVGFAVGNKDMIQALKKYQTNAGMFGALQDAAIYALNYDDFLEEQSNVFKTRRDRFEAMLAKADLPFVHAKGGIYVWLETPPGYDSEQFEQFLVQEKSILVAPGKPFG-NRYVRISLALDDQKDEAAIRLTELAYLYE.. 398
21 -43.2002dou_A mol:protein length:376 probable N-succinyldiaminopimelate aminotransferase  ali model follow..  15  25...................................VGLIDLSIGSTDLPPPEAPLKALAEALNDTYGYCLKSCTPFLEEAARWYE-PRREALALIGSQEGLAHLLLALTEPEDLLLLPEVAYPSYFGAARVASLRTFLIPLREDGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIDNPYVDQVEGEAPSPLALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALARLERVKGDFNQYAGVLRMGVEALKPKEVVRGYARVYRERALGMAEALKGVLSLLPPRATMYLWGRLPE--GVDDLEFGLRLVERGVALAPGRGFG-KGFVRIALVRPLEELEAAKRIREALD..... 376
22 -42.8003h14_A mol:protein length:391 Aminotransferase, classes I and II  ali model follow..  17  1......MSLKNSSRSAVDPFIVMDVMEAARREEAGRRIIHMEVGQPGTGAPRGAVEALAKSLETLGYTVALGLPALRQRIARLYDLDPGRVVITPGSSGGFLLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPE-NRLQPVPADFAGLDLAGLMVASPANPTGTMLDHAAMGALIEAAQAGASFISDEIYHGIEYEAKAVTALELTD--ECYVINSFSKYFSMTGWRVGWMVVPEDQVRVVERIAQNMCAPHASQVAALAALDCDAELQANLDVYKANRKLMLERLPKAG--APPDGAFYVYADVSDLTDDSRAFAAEILEKAGVAVTPGLDFD-AGTLRFSYARATADEEGLDRLEAFMQARGEG 385
23 -42.6003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  16  31.RAGTIDVQRNENFGKLRAGYLFPEIARRRKAHQEKKIISLGIGDTTEPLPKYIADAMAKAAEGYSGYAEQGQGALREAVASTFGRAADEIFISDGSKCDIARI-QMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDNPDNHFFPDLSKAKRTDIIFFCSPNNPTGAAATRAQLTELVNFARKGSILVYDAAYALSNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGVRLGWTVVPKALKYAWNRVMTTCGASNIVQAGGLACLQPEKEMNAMIKFYKENAQILKTTFTEMGFSVYGDDAPYIWVGFPGKP--SWDVFAEILERCNIVTTPGSGYG-EGFVRASAFGSRENLEAVRRFKEAYGKRNAS 443
24 -42.5003op7_A mol:protein length:375 Aminotransferase class I and II  ali model follow..  15  18..........................NSAIYDIAGVSISSLTLEELFALSGTNPEDFYKKLQGTKLNYGWIEGSAFKKSVSQLYGVKPEQILQTNGATGANLLVLYSLIEPGDHVISLYPTYQQLYDIPKSLGAEVDLWQIEEELPDLEKLRQLIR-PTTKMICINNANNPTGAVMDRTYLEELVEIASEGAYILSDEVYRSFSELDVPSIIEV---YDKGIAVNSLSKTYSLPGIRIGWVAANHQVTDILRDYRDMICAGVFDDLVAQLALAHQEILERNRHILEENLAILDQWIEEELVSYIRPAVVSTSFVKIAVDMPMEDFCLQLLQEHGVLLVPGNRFERDGYVRLGFACEQETIKGLEKLSQFLRRFDKE 374
25 -42.5001b5o_A mol:protein length:385 PROTEIN (ASPARTATE AMINOTRANSFERASE)  ali model follow..  17  1......MRGLSRRVQAMKPSATVAVNAKALERRQGVDLVALTAGEPDFDTPEHVKEAARRALAQKTKYPPAGIPELREALAEKFSVTPEETIVTVGGSQALFNLFQAILDPGDEVIVLSPYWVSYPEMVRFAGGVVVEVETEGFVPDPERVRRAIT-PRTKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVDEIYEHLLYEGEHFSPGRVAP-EHTLTVNGAAKAFAMTGWRIGYACGPKEVIKAMASVSSQSSPDTIAQWATLEALASRAFVEMAREAYRRRRDLLLEGLTALGLKAVRPSGAFYVLMDTSPIAPDEVRAAERLLEAGVAVVPGTDFAAFGHVRLSYATSEENRKALERFARVLGR.... 384
26 -42.0002x5d_A mol:protein length:412 PROBABLE AMINOTRANSFERASE  ali model follow..  17  2.MAESRPARRFARIDRLPPYVFNITAELKMARRRGEDIIDLSMGNPDGPTPPHIVEKLCTVAQRTHGYSTSRGIRLRRAISHWYR-PESEAIVTIGSKEGLAHLMLATLDHGDTILVPNPSYPIHIYGAVIAGAQVRSVPLIDFFNELERAIRESI-PKPRMMILGFPSNPTAQCVELDFFERVVALAKQDVMVVHDLAYADYDGWKAPSIMQVPGAKDIAVEFFTLSKSYNMAGWRIGFMVGNPELVSALARIKSDYGTFTPLQVAAIAALEDQQCVRDIARQYQQRRDVLVKGLREAGWMVEPKASMYVWAKIPEAHLGSLEFAKKLLQDAKVSVSPGIGFG-DDHVRFALIENRDRRQAVRGIKAMFRADGLL 401
27 -41.9005bk7_A mol:protein length:376 PLP-Dependent L-Arginine Hydroxylase MppP  ali model follow..  16  17....................................LALNSELNIADGHARQALSPGQQKIVNELVLWAESEQREAHQAYFTLLGAEPGRVLSCYSSSVSMEILARSLSASVDRVALVHPTFDNIADLLRGNGLDLVPVEEDALH---GADLSAELLSSVGCVFVTTPNNPTGRVLAEERLRRLAEQCAEGTVLALDTSFRGFDAAAHYDHYAVLQEGCRWVVIEDTGKLWPTLDLKAGLLVFSEDIGLPVEKIYSDIGVSPLILALIREFSRDDGGLADLHAFILHNRSVVRRALAGVEGVSFPDPESRSSVERVAFAGRTGTEVWEELQRHHVFALPCRQFH-DHMVRIALSRSTEPEKSVQVLRTVLET.... 375
28 -41.4002z1z_A mol:protein length:432 LL-diaminopimelate aminotransferase  ali model follow..  15  18.IEYKTKVSRNSNMSKLQAGYLFPEIARRRSAHLLKQVISLGIGDTTEPIPEVITSAMAKKAEGYSGYAEQGAKPLRAAIAKTFGIGDDDVFVSDGAKCDISRL-QVMFGSNVTIAVQDPSYPAYVDSSVIMGQTGQFNTDVQKYGNIEYMPDLSTVGRTDIIFFCSPNNPTGAAATREQLTQLVEFAKKGSIIVYDSAYAMYMSDDNPRSIFEIPGAEEAMETASFSKYAGFTGVRLGWTVIPKKVAKDFNRIICTCGASNISQAGALACLTPEEAMHKVIGFYKENTNIIIDTFTSLGYDVYGKNAPYVWVHFPNQS--SWDVFAEILEKTHVVTTPGSGFG-EGFVRVSAFGHRENLEACRRFKQLYK..... 426
29 -41.4003jtx_A mol:protein length:396 aminotransferase  ali model follow..  17  2.........MNTLLKQLKPYP-HEAMQGISAPEGME-AVPLHIGEPKHPTPKVITDALTASLHELEKYPLTAGLELRQACANWLK-ADNEILPVLGSREALFSFVQTVLNPVSDIVSPNPFYQIYEGATLLGGGEIHFANCPAPSFDWRSISEEVW-KRTKLVFVCSPNNPSGSVLDLDGWKEVFDLQDKGFIIASDECYSEFDGNKPLGCLQAAAQRQKLLMFTSLSKRSNVPGLRSGFVAGDAELLKNFLLYRTGSAMSIPVQRASIAAWDDEQHVIDNRRLYQEKFERVIPILQQVFDVKLPDASFYIWLKVPDGD--DLAFARNLWQKAAIQVLPGRFLARDGYVRIALVADVATVKAAEDIVSLYR..... 396
30 -41.4005yhv_A mol:protein length:394 Aminotransferase  ali model follow..  20  1......MTDRVALRAGVPPFYVMDVWLAAAEQRTHGDLVNLSAGQPSAGAPEPVRAAAAAALHLQLGYVALGIPELRDAIAADYTVEPDAVVITTGSSGGFLLAFLACFDAGDRVAMASPGYPCYRNILSALGCEVVEIPCGQTRFQPTAQMLAEIDPPLRGVVVASPANPTGTVIPPEELAAIASWCDADVRLISDEVYHGLVYQGAPQTSCAWQTSRNAVVVNSFSKYYAMTGWRLGWLLVPTVLRRAVDCLTGNFCPPVLSQIAAVSAFTPEAEADGNLASYAINRSLLLDGLRRIGIDRLTDGAFYVYADVSDFTSDSLAFCSKLLADTGVAIAPGIDFD-GSFVRISFAGPSGDEEALRRIGSWLPS.... 387
31 -41.2002gb3_A mol:protein length:409 aspartate aminotransferase  ali model follow..  14  1MGSDKIMDVFSDRVLLTEESPIRKLVPFAEMKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYYHSAGIWELREAFASYYDVKPENVLVTNGGSEAILFSFAVIANPGDEILVLEPFYANYNAFAKIAGVKLIPVTRREEGFAIPQNLESFINERTKGIVLSNPCNPTGVVYGKDEMRYLVEIAERGLFLIVDEVYSEIVFRGEFASALSIES-DKVVVIDSVSKKFSACGARVGCLITRNEELISHAMKQGRLAPPLLEQIGSVGLLNDDSFFDFVRETYRERVETVLKKLEEHG--TKPSGAFYITAELPVEDAEEFAR-DFNMDGETTMVAPLRGFYLKKEIRIACVLEKDLSRAIDVLMEGLKMFCSS 399
32 -41.2004wp0_A mol:protein length:472 Kynurenine--oxoglutarate transaminase 1  ali model follow..  17  20...........................EFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGLNQYKTFGYPPLTKILASFFG-PLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKNWQLDPMELAGKFT-SRTKALVLNTPNNPLGKVFSREELELVASLCQQDVVCITDEVYQWYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQVFHCPTQSQAAVAESFERSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIPQGSYFLITDISDDEPYDRRFVKWMIKNKGLVAIPVSIFYSVHYIRFCFVKDEATQAMDEKLRKWKVELENL 425
33 -41.2001gd9_A mol:protein length:389 ASPARTATE AMINOTRANSFERASE  ali model follow..  16  5..............DRLELVSASEIRKLFDIAAGMKDVISLGIGEPDFDTPQHIKEYAKEALDKLTHYPNIGLLELREAIAEKLK-PKTEIMVLLGANQAFLMGLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTDEFRLNVDELKKYVT-DKTRALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVIDEVYEHYDDARHYSIASLDGMFERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNCPVTFIQYAAAKALRSWKAVEEMRKEYDRRRKLVWKRLNEMGLPTVPKGAFYIFPRIRDTGLTSKKFSELMLKEARVAVVPGSAFG-EGYVRISYATAYEKEEAMDRMERVLKERK.. 387
34 -41.2003ele_A mol:protein length:398 Amino Transferase  ali model follow..  15  26..........................KKRAAIVGKENVYDFSIGNPSIPAPQIVNDTIKELVTDLHGYSAQGDVETRAAIAEFLHFNADNLYMTMGAAASLSICFRALTSDYDEFITIAPYFPEYKVFVNAAGARLVEVPADTEHFQIDDALEERINAHTRGVIINSPNNPSGTVYSEETIKKLSDEIGRPIFIIADEPYREIV--DGIKVPFVTKYYDNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKAELYAA-VCAPSLFQKMIVKCQG----ATGDINAYKENRDLLYEGLTRIGYHCFKPDGAFYMF--VKALEDDSNAFCEKAKEEDVLIVAADGFGCPGWVRISYCVDREMKHSMPAFEKIYKKYNK. 398
35 -41.2004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  13  32.LGGSTKLVRNVNLEKLKNNYLFPEINRRELEHIEKQLISLGTGDTTEPIPEQITSHMSNFAHGLRGYLEQGNKTLRKAIAETFHVKSNEVFVSDGAQSDISRL-QLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPDLAMTPRTDVIFFCSPNNPTGYVASRKQLHQLVDFAKTGSIIIFDSAYAAFIEDGSPRSIYEIPGAREAIEVSSFSKFAGFTGVRLGWSIIPDELINDFHRIVTTSGASNIAQAGGLACLSGLKEIRSVNNYYKENRKILMDTLVSLGLKVYGVNAPYLWVHFKGSK--SWDVFNEILENTHIITVPGSGFG-EEYLRISGFGRRDHVEASKRLQNFFNTRTKH 445
36 -41.1003b46_A mol:protein length:447 Aminotransferase BNA3  ali model follow..  16  22.KVVANKYFTSNTAKDVWSLTNEAAAKAANNKNQGRELINLGQGFFSYSPPQFAIKEAQKALDIVNQYPTRGRPSLINSLIKLYSLKAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINEWTIDFEQFEKAIT-SKTKAVIINTPHNPIGKVFTREELTTLGNICVKNVVIISDEVYEHFTDSFTRIATLSPEIGQLTLTVGSAGKSFAATGWRIGWVLSLNELLSYAAKAHTCFASPSPLQEACANSINKIGYFEKMRQEYINKFKIFTSIFDELGLPYTPEGTYFVLVDFSKNKGKDFRISHWLINELGVVAIPPTEFYIKNLLRFAVCKDDAYENAVERLKLLKDYL... 447
37 -41.1001o4s_A mol:protein length:389 Aspartate aminotransferase  ali model follow..  16  35...................................EDVINLTAGEPDFPTPEPVVEEAVRFLQKEVKYDPRGIYELREGIAKRIDISPDQVVVTNGAKQALFNAFMALLDPGDEVIVFSPVWVSYIPQIILAGGTVNVVETKNFQPSLEEVEGLLV-GKTKAVLINSPNNPTGVVYRREFLEGLVRLAKKNFYIISDEVYDSLVYTDEFTSILDVSEFDRIVYINGFSKSHSMTGWRVGYLISSEKVATAVSKIQSH-CINTVAQYAALKALEVDN--SYMVQTFKERKNFVVERLKKMGVKFVPEGAFYLFFKVRGDDVKFCERL---LEEKKVALVPGSAFLKPGFVRLSFATSIERTEALDRIEDFLNS.... 382
38 -41.0004my5_A mol:protein length:393 Putative amino acid aminotransferase  ali model follow..  17  2..PMDLSKRFNKNLNKIE---VSMIRQFDQSISDIPDVLKLTLGEPDFATPKHIKEAAKRAIDA-SHYGMAGLLALRQAASAFVK-PDNEILVTIGATEALSASLTAILEPGDKVLLPAPAYPGYEPVVNLVGAEVVEIDTRSNDFVLEMLEEAILGEALKAVILNYPTNPTGVTYSRQQIKNLAEVLKKYPIFVIDEVYAELTYTGESHVSIAEYLPDQTILISGLSKSHAMTGWRLGLIFAPAVLTAQLIKSHQYLAATTSVQFAAIEALTGKDDALPMKEEYIKRRDYIIEKMEAMKFKIIPDGAFYIFAKIPVAQGQDSFKFLQDFAKEAVAFIPGVAFG-EGYLRISYAASMETKEAMKRLKEFMEQYAD. 393
39 -40.9001u08_A mol:protein length:386 Hypothetical aminotransferase ybdL  ali model follow..  16  22...........................QMSALAQQHQAINLSQGFPDFDGPRYLQERLAHHVAQANQYPMTGVQALREAIAQKTE-ADSDITVTAGATEALYAAITALVRNGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDQEFAALLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGEIFVISDEVYEHFSQQGHASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCVAPAPISAEIRKVHQTFSVNTPAQLALADMLREPEHYLALPDFYRQKRDILVNALNESRLEILCEGTYFLLVDYSAVSTLDDVEFCQWLTQEGVAAIPLSVFCADKLIRLCFAKKEST------LLAAAERLRQ. 385
40 -40.8003nra_A mol:protein length:407 aspartate aminotransferase  ali model follow..  17  2...MSIEAKFKKLGTDNAPGQEVRQSAAGLEALIEGRPVDFSHGDVDAHPTPGAFDSAGVQSGGVQAYEYRGDLGIRDLLAPRLA-ARDGLIITPGTQGALFLAVAATVARGDKVAIVQPDYFANRKLVEFFEGEMVPVQLDRAGLDLTGLEEAFK-AGARVFLFSNPNNPAGVVYSAEEIGQIAALAARGATVIADQLYSRYAGASYTHLRAEAAVAENVVTIMGPSKTESLSGYRLGVAFGSRAIIARMEKLQASLRAAGYSQAVLRGWFDEPGWMEDRIARHQAIRDELLHVLRGCE--RTPQAGSYLFPRLPKLAVAPAEFVKILRLQAGVVVTPGTEFS-ADSVRLNFSQDHEAVAAARRIVTLVERYRA. 407
41 -40.7006DK6 Entity 1(prereleased)  ali follow..  17  1.MALINENFLKLKAGYLFPEIARRVKAFTEGNPEAQRLIRCGIGDVTEALPEAVRYAMHEAVDELKGYPEQGYDFLRNAIADNDPIEADEIFISDGSKCDTGNIL-DIFGQGNTIAITDPVYPVYVDTNVMIGNTGEADENGAYA---NGFVPDIPQEKADLIYLCYPNNPTGAVATRPQLEAWVKYAREGSVLLYDAAYEAFIPTIPHSIFEIEGARDCAIEFRSFSKNGGFTGVRCAYVVIPKSLMGRKKNGEAQ-GASYIVQKGAEALYTDKSQTKALIEHYMGNAALLVEACKNAGLSVFGGVNAPYVWVGCPAGLTSWQMFDKMLNEANVVITPGSGFG-EGYFRISAFNSRAN------VEEVCRRIAA. 409
42 -40.6003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  16  1...MKRNPHFVSLTKNYLFADLQKRVAQFRLENPQHTVINLSIGDTTQPLNASVAEAFASSIARCRGYPDFGLPALRQKLSEDFYVDAKEIFISDGAKVDLFRLL-SFFGPNQTVAIQDPSYPAYLDIARLTGAKIIALPCLQ---ENAFFPEFPEDTHIDILCLCSPNNPTGTVLNKDQLRAIVHYAIEEILILFDAAYSTSDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGIRLGWTVIPQELIQDWERFLSTTGASIPAQEAGVAGLSILP-QLEAIHYYRENSDLLRKALLATGFEVFGEHAPYLWVKPTQANISDRDLFDFFLREYHIAITPGIGFG-SGFVRFSSLGKREDLAACERLQMAPALQS.. 394
43 -40.5002o0r_A mol:protein length:411 Rv0858c (N-Succinyldiaminopimelate aminotransferase)  ali model follow..  18  17...........................EMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGVNQYPGPGSAPLRRAIAAQRR-PETEVLVTVGATEAIAAAVLGLVEPGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLRGFALDADALRRAVT-PRTRALIINSPHNPTGAVLSATELAAIAEIAVANLVVITDEVYEHFDHARHLPLAGFDGMAERTITISSAAKMFNCTGWKIGWACGPAELIAGVRAAKQSYVGGAPFQPAVALALDEDAWVAALRNSLRARRDRLAAGLTEIGFAVHSYGTYFLCADPRPLGYDDSTEFCAALPEKGVAAIPMSAFC-NHLVRFTFCKRDDTDEAIRRLSVLAERPATG 399
44 -40.4003g0t_A mol:protein length:437 Putative aminotransferase  ali model follow..  16  15QNELHIKDLGMASIRDLVALV-----TNLEKATGTK-FCRMEMGVPGLPAPQIGIETEIQKLREASIYPNLDGLELKQEASRFADIPARACVPTVGSMQSFLVANRTHKNREYGTLFIDPGFNLNKLQCRILGQKFESFDLFEYR---EKLESYLQTGQFCSIIYSNPNNPTWQCMTDEELRIIGELATKDVIVIEDLAYFGMDPGEPLYQPSVANYTDNYILALSSSKAFSYAGQRIGVLMISGKLYEREYPYALSSGATHSAQWGMAAMLDGEYNFRDSVIEYGRKARIMKKMFLDNGFNIVPLADGFYF----GYKGMDSSKLIEKFVRYGMCAITLKTTG-NEAMRICTSLLPESPDLEKRLQMLNAE.... 436
45 -40.3001bw0_A mol:protein length:416 PROTEIN (TYROSINE AMINOTRANSFERASE)  ali model follow..  15  1...MSSWDVSMSNHAGLVFNPIRTVSDNAKPSPSPKPIIKLSVGDPTLDKNLLTSAAQIKKLKECNGYPTVGSPEAREAVATWWRIVKDNVVLCSGGSHGILMAITAICDAGDYALVPQPGFPHYETVCKAYGIGMHFYNCNDWEADLDEIRRLKD-DKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEERLPLFSDEIYAGMVPNATFTSVADFETTVPRVILGGTAKNLVVPGWRLGWLLYVPSFLEGLKRVGMLVPCTVVQAALGEALLNPQEHLDQIVAKIEESAMYLYNHIGECGLAPTPRGAMYLMSRIDRDIKTDVEFFEKLLEEENVQVLPGTIFHAPGFTRLTTTRPVEVREAVERIKAFCQRHAA. 415
46 -40.0002z61_A mol:protein length:370 Probable aspartate aminotransferase 2  ali model follow..  16  1........MLSKRLLNFESFEVMDILALAQKESEGKKVIHLEIGEPDFNTPKPIVDEGIKSLKEKTHYDSRGILELREKISELYDIIPDNIIITGGSSLGLFFALSSIIDDGDEVLIQNPCYPCYKNFIRFLGAKPVFCDFTVES------LEEALSDKTKAIIINSPSNPLGEVIDR-EIYEFAYE--NIPYIISDEIYNGLVEGKCYSAIEFDENLEKTILINGFSKLYAMTGWRIGYVISNDEIIEAILKLQQNLSAPTISQYAALKAFEKEREINSMIKEFDRRRRLVLKYVKDFGWEVNPIGAYYVFPNIGEDGREFAYKL---LKEKFVALTPGIGFG-KNYIRISYANSYENKEGLERIKEFLNK.... 370
47 -40.0001yiy_A mol:protein length:429 kynurenine aminotransferase; glutamine transaminase K  ali model follow..  16  7.ETMHNKFDLPKRYQGSTK----SVWVEYIQLAAQYKPLNLGQGFPDYHAPKYALNALAAAANSANQYRGFGHPRLVQALSKLYS-PMTEVLVTVGAYEALYATIQGHVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKDWVLDNNELEALFN-EKTKMIIINTPHNPLGKVMDRAELEVVANLCKKNVLCVSDEVYEHFEPFEHIRICTLPGMWERTITIGSAGKTFSLTGWKIGWAYGPEALLKNLQMVHQVYTCATPIQEAIAVGFEPECYFNSISGELMAKRDYMASFLAEVGMNPTPQGGYFMVADWSSDARKDYRFTKWMTKSVGLQGIPPSAFYSEDFVRYCFFKKDEN--LQKAAEILRKWKGSS 429
48 -39.7006c3a_A mol:protein length:413 Uncharacterized protein  ali model follow..  12  43....................................NLADAHTHQRQSASQQSIVSRLPQLWYEAEEGLQATYERFTEAFFQLHRLVKNKTMLSYAASISTMVAGMFLKKERLAVTLIEPCFDNLYDVLANMDVPLYPIDESVFYDVDRIYPELERRVRTDALFLVDPNNPTGFSLGRKGFEEVVRFCKDDKLLLIDFCFASFTELARFDMYELLENGVRYLAIEDTGKTWPVQDAKCALITASDDIWETVYNLHTSLNVSPFVLNMLTQYVRDADRLASVREVLTRNRECARKTLDGSILEYQPVVKVSVAWFRVDHPELTATDVHRLLSADGVYVLPGRYFY-DAYVRMALAREPEMADAMALTRQVLDRHGR. 407
49 -39.5001j32_A mol:protein length:388 aspartate aminotransferase  ali model follow..  20  30...................................IDVCSFSAGEPDFNTPKHIVEAAKAALEQKTRYPAAGEPRLREAIAQKLCYGADNILVTNGGKQSIFNLMLAMIEPGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTQFKVSPEQIRQAIT-PKTKLLVFNTPSNPTGMVYTPDEVRAIAQVAVEGLWVLSDEIYEKYDDAQHLSIGAASPEYERSVVCSGFAKTYAMTGWRVGFLAGPVPLVKAATKIQGHSNVCTFAQYGAIAAYESQDCVQEMLAAFAERRRYMLDALNAMGLECPPDGAFYMFPSIAKTGRSSLDFCSELLDQHQVATVPGAAFGADDCIRLSYATDLDTKRGMERLEKFLHGI... 387
50 -39.5003dyd_A mol:protein length:427 Tyrosine aminotransferase  ali model follow..  14  48...................................KTMISLSIGDGNLPTDPEVTQAMKDALDSYNGYPSIGFLSSREEIASYYHLEAKDVILTSGCSQAIDLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLKSWEIDLKQLEYLID-EKTACLIVNNPSNPCGSVFSKRHLQKILAVAARCVPILADEIYGDMVSDCKYEPLATLSTDVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLGPCTIVQGALKSILCRGEFYHNTLSFLKSNADLCYGALAAIGLRPVPSGAMYLMVGIEPEFENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMLEACSRIQEFCEQHYHC 421
51 -39.2005wmh_A mol:protein length:475 Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase  ali model follow..  21  64.LSSSVDMSLSPRVQSLKPSKTMVITDLAATVQSGVPVIRLAAGEPDFDTPKVVAEAGINAIREFTRYLNAGITELREAICRKLSYAPDQILVSNGAKQSLLQAVLAVCSPGDEVIIPAPYWVSYTEQARLADATPVVIPTNNFLLDPKDLESKLT-EKSRLLILCSPSNPTGSVYPKSLLEEIARIIAKRLLVLSDEIYEHYAPATHTSFASLPDMYERTLTVNGFSKAFAMTGWRLGYLAGPKHIVAACSKLQGQ-GASSIAQKAGVAALGGGETVAEMVKAYRERRDFLVKSLGDIGVKISEPQGAFYLFEGFGLINDSSSLALYFLDKFQVAMVPGDAFGDDSCIRISYATSLDVQAAVEKIRKALEPLRAT 472
52 -39.2005veq_A mol:protein length:411 Kynurenine--oxoglutarate transaminase 3  ali model follow..  16  16...........................EFTKLAADPSVVNLGQGFPDISPPSYVKEELSKAADNMNQYRGFGHPALVKALSCLYG-PNEEILVAVGAYGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRDWTFDPRELESKFS-SKTKAIILNTPHNPLGKVYTRQELQVIADLCVKDTLCISDEVYEWYTGHTHVKIATLPGMWERTITIGSAGKTFSVTGWKLGWSIGPAHLIKHLQTVQQFYTCATPLQAALAEAFWPECYFNSLPKELEVKRDRMVRLLNSVGLKPIVPDGGYFIIDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFC-EKLVRFCFIKKDST------LDAAEEIFRA. 409
53 -39.1004cvq_A mol:protein length:431 GLUTAMATE-PYRUVATE AMINOTRANSFERASE ALAA  ali model follow..  15  26.........KSSKLENVCYDIRGPVLKEAKREEEGNKVLKLNIGN--FDAPDEILVDVIRNLPTAQGYDSKGLYSARKAIMQHYDVTVEDIYIGNGVSELIVQAMQALLNSGDEMLVPAPDYPLWTAAVSLSSGKAVHYLCSDWFPDLDDIRAKIT-PRTRGIVIINPNNPTGAVYSKELLMEIVEIARQHNLIIFDEIYDKILDDAEHHSIAPLAPDLLTITFNGLSKTYRVAGFRQGWMVLNGPKKHAKGYIEMRLCANVPAQHAIQTALQSISEFITPGGRLYEQRNRAWELINDIGVSCVPRGALYMFPKIDAKRHDDQKMVLDFLLQEKVLLVQGTAFN-PDHFRIVTLPRVDDELSLSKFARFLSGYHQ. 424
54 -39.0001xi9_A mol:protein length:406 putative transaminase  ali model follow..  17  1....AGSIRASKRALSVEYAIRDVVLPARELEKKGIKVIRLNIGD-DFQPPEHMKEAYCKAIKEHNYYDSEGLPELRKAIVEREDITPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRTEDWQPDIDDIRKKIT-DRTKAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVIDEIYDLMTYEGEHISPGSLTKDVPVIVMNGLSKVYFATGWRLGYMYFVDSEVREAIDRLARICPNTPAQFAAIAGLTPMDYLKEYMKKLKERRDYIYKRLNEIGISTTPQGAFYIFPKIEVGPWKNDKEFVLDVLHNHVLFVHGSGFG-AGHFRAVFLPPIEIEEAMDRFEKFMKERLKE 400
55 -38.6004ix8_A mol:protein length:444 Tyrosine aminotransferase  ali model follow..  13  52..........................DNMKPSRSTKSNLRLSIGDGNLKTPDIVTEAMVDVVRSFNGYPTVGADNLRQVVSTYWRLKWENVIITSGVSQAIVLALTALCNEGDNILVCAPSFPHYKSVCDSYGIECRYYYLKSWECDLRAAAGMVD-SHTKAFVIINPSNPCGSNFSRAHVSDIIDFCQQQIPLISDEIYAEMVNNGIFTSVADFDTNVPRLILGGTAKYQVCPGWRVGWSILIDDWAVGMERLTQLIGVNSICQEAIARTLCPTECTEHIVTQLEAGAKVYARLLEHDGISMEPQASMFVMLKLNQDLKSDMEFYEKLLDEENVQVLPGEIFGMSGFLRATVSRPSAVNEAVDRIIEFCERHKK. 438
56 -38.5003pdx_A mol:protein length:402 Tyrosine aminotransferase  ali model follow..  14  31...................................KTVISLSIGDGNLPTDPEVTQAMKDALDSYNGYPSIGYLSSREEVASYYHLEAKDVILTSGCSQAIELCLAVLANPGQNILIPRPGFSLYRTLAESMGIEVKLYNLKSWEIDLKQLESLID-EKTACLVVNNPSNPCGSVFSKRHLQKILAVAERCVPILADEIYGDMVSDCKYEPMATLSTNVPILSCGGLAKRWLVPGWRLGWILIHDRRDIFGNEIRDGLGPCTIVQGALKSILQRQEFYQDTLSFLKSNADLCYGALSAIGLQPVPSGAMYLMVGIEPEFENDVEFTERLIAEQSVHCLPATCFEYPNFFRVVITVPEVMLEACSRIQEFCEQ.... 400
57 -38.0001ynu_A mol:protein length:473 1-aminocyclopropane-1-carboxylate synthase  ali model follow..  17  3MLSRNATFNSHGQDSSYFLGWQEYEKNPYHEVHNTNGIIQMGLAENQL-EAAAFKKNGESIFAELALFQDYHGLAFKKAMVDFMAFDPNHLVLTAGATSANETFIFCLADPGEAVLIPTPYYPGFDRDLKWRGVEIVPIHCNGFQITETALEEAYQELRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGILISDEIYSGFSSPSFISVMEVLKDRQRVHVVYSLSKDLGLPGFRVGAIYSNDDMVVAAATKMSSFGVSSQTQHLLSAMLSDKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGFCWVDMRHTFEAEMELWKKIVYEVHLNISPGSSCH-PGWFRVCFANLPERDLAMQRLKAFVGEYYNV 435
58 -37.2001iax_A mol:protein length:428 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2  ali model follow..  15  1ILSKLATNEEHGENSPYFDGWKAYDSDPFHPLKNPNGVIQMGLAENQLNPKGSICSEGIKSFKAIANFQDYHGLEFRKAIAKFMEFDPERVVMAGGATGANETIIFCLADPGDAFLVPSPYYPAFNRDLRWRGVQLIPIHCNNFKITSKAVKEAYENIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNILVCDEIYAAFDTPQFVSIAEILDEQDLVHIVYSLSKDMGLPGFRVGIIYSNDDVVNCARKMSSFGLVSTQTQYFLAAMLSDDNFLRESAMRLGKRHKHFTNGLEVVGIKCLKNNAGFCWMDLRPTFDSEMSLWRVIINDVKLNVSPGSSFE-PGWFRVCFANMDDGDIALARIRRFVGVEK.. 428
59 -36.1003f6t_A mol:protein length:533 Aspartate aminotransferase  ali model follow..  13  103...................................IDAVNYCHTELGLNRDKVVAEWVNGAVANNYPVPDRCLVNTEKIINYFLQAEQTDLFPTEGGTAAISLAENHLLKKGDKIAINEPIFTPYLRIPELKDYELVEVDLNDWEIEPNEIEKLKD-PSIKALIVVNPTNPTSKEFDTNALNAIKQAVEKKLMIISDEVYGAFVPNFKSIYSVV----YNTMLVYSYSKLFGCTGWRLGVIALNEKNVFDDNIAHLD-LRQLHKRYSSVVLCADSRSIGLYHTAGLSTPQQIMEALFSMPKDETDTNTHYYSLDYLTNNFEQVDFLLKLAEKNGVVLVDGVGFGAKPELRVSQANLPTEALIGKQVLELLKEYYEE 528
60 -35.4003if2_A mol:protein length:444 Aminotransferase  ali model follow..  18  21...MDDLGDALKSDQPVNMLGGGNPAKIDAVNELFLETYKALGNDN------DTGKANSSAIISMANYSNPQGDAFIDALVGFFNLTSENIALTNGSQNAFFYLFNLFGGAKSILLPLTPEYIGYSDVHVEGQHFAAVLPHIDYRVDFEALLPALKEGRIGAICCSRPTNPTGNVLTDEEMAHLAEIAKRDIPLIIDNAYGMPFPNIIYSDAH-LNWDNNTILCFSLSK-IGLPGMRTGIIVADAKVIEAVSAMNAVVNLTRFGAAIATPLVANDRIKQLSDNEIKPFYQKLKQALGDYPLMIHKPEGAIFLWLWFKDLPISTLDLYERLKAKGTLIVPSEYFF-HECIRMSIAADEQTIDGIKVIGEVVRELYDN 443
61 -35.3003g7q_A mol:protein length:417 Valine-pyruvate aminotransferase  ali model follow..  18  21.........................MEDLNDGLRTPGAIMLGGGNPAHIPAMQFQTLLTDMVESLCNYDGPQGKALLNALAVLLDIEPQNIALTNGSQSAFFYLFNLFAGRGSTKKVLFPLAPEYIGYADSGLEDDLFVPEGQFKYHVDFEHLHIG-EETGMICVSRPTNPTGNVITDEELMKLDRLANQNIPLVIDNAYGVPFPGIIFSEARPLWN-PNIILCMSLSK-LGLPGSRCGIIIANDKTITAIANMNGIISLGGMGPAMMCEMIKRNDLLRLSETVIKPFIAIIRRYLSEERCLIHKPEGAIFLWLWFKDLPITTELLYQRLKARGVLMVPGHYFF-HQCMRMNYVPEPDKEAGVKILAEEIERAWRE 416
62 -35.3003fdd_A mol:protein length:533 L-aspartate-beta-decarboxylase  ali model follow..  14  104...................................GKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYII-ESVNLFAVEGGTAAMSMKVNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPAL-DSELDKLKDPAIKIFFCVNPSNPPSVKMDERSLERVRKIVAEDLMILTDDVYGTFADGFQSLFAIC---PANTLLVYSFSKYFGATGWRLGVVAAHKENIFDLALGRLPESEKQMTLFSLFALMDESDQYKHTLKQLIRRREATLYRELGTPPQRDENAVDYYTLKWAVKQSSTGDMLFRIADETGIVLLPGRGFGSDRSGRASLANLNEYAAIGRALRQMADELYAQ 525
63 -34.8003rq1_A mol:protein length:418 Aminotransferase class I and II  ali model follow..  16  4MTSVAAKHAKGKKLKD-VIFVTAGQAQADAKENGRENVVNGTDEEGNLVFLKTVKEEYLSLSSEHVGYPIAGIPDFLCAAEKEC--GHIRSIATAGGTGGIHHLIHNYTEPGDEVLTADWYWGAYRVICSDTGRTLVTYSLFDEHNNFNRVNELAAKQTNVVVIFNTPNNPTGYSIEDKDWDSILNFLKDNVIIGIDVAYLDYSGEKDFNKFSHLPKEILTCVCYSLSKGFTMYGQRVGAMIGISDDEEIADEFFEVNNICRPAMRTMANIVADEAERNCYYQLIRDRADIFKQEAAQVGLPMLPYRGGFFIT-----PTDSANAICEELKKEHIYV-------LANGIRIAACPKCQMTGLAEKIYNAMKSLGK. 417
64 -34.5002zy2_A mol:protein length:544 L-aspartate 4-carboxylyase  ali model follow..  17  103...................................GKSLSYVRDQLGLDPAAFLHEMVDGILGC--NYPVPPRMTVSEQIVRQYPPESVDLFAVEGGTAAMSLRISGLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIHADPDN-DAELDKLKDPDVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEDLLILTDDVYGTFADEFQSLFSVC---PRNTLLVYSFSKYFGATGWRLGVIAAHKDNVFDHALSQLPESAKKALDHRYRSLLPDVRSLKFIDRLVADSRATLYRELGMPPLENPNSVNYYTLIDLQNQQSSTGDMLFRVADETGIVLLPGRGFGSDRSGRASLANLNEY--EYAAIGRALRRLADE 520
65 -34.4001lk9_A mol:protein length:448 ALLIIN LYASE  ali model follow..  14  56...................................GCSADVASGDEEYWKQHKEASAVLVSPWHRMSYFFNPVSELEKTIKELHEAKDRYIVFGVGVTQLIHGLVISLDAPESKVVAHAPFYPVFREQTKYFDKKGYVWAGN------AANYVNVSNPEQYIEMVTSPNNPEGL---------LRHAVIKGCKSIYDMVYYWPHYTP------IKYKADEDILLFTMSKFTGHSGSRFGWALIDESVYNNLLNYMTTEGTPRETQLRSLKVLKERDLNTFGFKKLRERWVNITALLDQSDRRMRPPSPSYAWVKCEWEEDKDCYQT---FQNGRINTQNGVGFEASRYVRLSLIKTQDDDQLMYYLKDMVKAKRKT 428
66 -34.1004emy_A mol:protein length:413 Aminotransferase class I and II  ali model follow..  14  1..SNAMPMTIKRATWNNGPFDINNKANAAIEKYGREAVINAALGT---KGKIIALPSVYDRLDEMASYPIEGEKDYRKIVIDTL--GYISAIATPGGTGAIRSAIFSYLDEGDPLICHDYYWAPYRKICEEFGRNFKTFEFDDFAFNIDVYKEAIDEDSDRIASLINGNNPTGYSLSDEEWDEVITFLKEKITLIVDVAYLEFAGDGDFEKFSNLPRNLFVVVAFSMSKSHTAYGLRSGAAVGSKEIIEEFEAARCNWSNGTHAAQNILIELEREQELVDLRNMLKSRADVFVTAAKENKLTMIPYFGGFFTF-----PTDKAFDIVKDLEKENIFT------PSAKGIRVAICGEEKIPKLVQRLAFYTNK.... 412
67 -34.1002zy3_A mol:protein length:546 L-aspartate beta-decarboxylase  ali model follow..  14  104...................................GKSLSYVRDQLGLDPAAFLHEMVDGILGCNYPVPPRMLNISEKIVRQYII-ESVNLFAVEGGTAAMSLKLNGLLKAGDKVAIGMPVFTPYIEIPELAQYALEEVAINADPSL-DSELDKLKDPAIKIFFCVNPSNPPSVKMDQRSLERVRNIVAEDLMILTDDVYGTFADDFQSLFAIC---PENTLLVYSFSKYFGATGWRLGVVAAHQQNVFDLALDKLQESEKQMALFSLFALMDEADEYKHTLKQLIRRRETTLYRELGMPPLRDENAVDYYTLEWAVKQSSTGDMLFRIADETGIVLLPGRGFGSNRSGRASLANLNEY--EYAAIGRALRKMADE 521
68 -33.4002x5f_A mol:protein length:430 ASPARTATE_TYROSINE_PHENYLALANINE PYRIDOXAL-5` PHOSPHATE-DEPENDENT AMINOTRANSFERASE  ali model follow..  11  41.............................QSAEAKSTTYNATIGMATNKDGKMFASSLDAMFNDLFPYPPQGIEELRDLWQQKM--NMSRPIVTNALTHGLSLVGDLFVNQDDTILLPEHNWGNYKLVFNTRNGANLQT--KDGHYTTDSLVEALQSKDKVIMILNYPNNPTGYTPTHKEVTTIVEAIKAKVIAVVDDAYYGLFYEDVYTQTNLHSNAILPIRLDGATKEFFAWGFRVGFMTFGTSDQTTKEVLEAKVSGPLPTQSAVKHVLKNNKQFDKEIEQNIQTKEVVYADQYHSHWQAYDFNSGYFMA-IKVHDVDPEALRKHLIDKYSIGVIALNATD----IRIAFSEKDDIPHVFDSIAKAIDDLR.. 430
69 -33.0003tcm_A mol:protein length:500 Alanine aminotransferase 2  ali model follow..  14  70....................QPVTFFREVLALCDHPDLLQREEIKTLFSADSRAKQILAMIPGRTGAYSHSQGIGLRDAIASGIAANADDIFLTDGASPGVHLMMQLLINEKDGILVPIPQYPLYSASIALHGGALVPYYLNESGLETSDVKKQLEDANVRALVVINPGNPTGQVLAEENQYDIVKFCKNEGLVLLDEVYQENIYVDNKKFHSFKKDLPLVSYQSVSKGYYGECGKRGGYFEITGFSAPVREQIYKIASVNLCSNITGQILASYKAEKDGILASLARRAKALEHAFNKLGITCNEAEGAMYVFP-AANKAPDAFYALRLLESTGIVVVPGSGFG-TWHFRCTILPQEDKPAVISRFTVFHEAFMSE 487
70 -32.8003ihj_A mol:protein length:498 Alanine aminotransferase 2  ali model follow..  14  91........................................LDSPSFPEDAKKRARRILQACGGNLGSYSASQGVCIREDVAAYITADPDNIYLTTGASDGISTILKILVSGGGKVMIPIPQYPLYSAVISELDAIQVNYYLDEEALNVNELRRAVQEADPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLDEVYQDYSPDCRFHSFKKVSSNVELASFHSTSKGYGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMD-SREKESVLGNLAKKAKLTEDLFNQVGIHCNPLQGAMYAFP-AHQMAPDMFYCMKLLEETGICVVPGSGFGQREHFRMTILPPVEKKTVLQKVKDFHINFLEK 490
71 -32.7005iwq_A mol:protein length:434 ASPARTATE AMINOTRANSFERASE  ali model follow..  15  1MSSVSLQDFDAERIGLFHE----DIKRKFDELKSKNLKLDLTRGADELLALPGKGDFKAADGTDVRNYGGLDGIDIRQIWADLLGVPVEQVLAGDASSLNIDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVPVFSNPTGFTVTEDVAKRLSAMETADFRVVWDNAYAVHTLTDEVGLGEAAGNPNRFWAFTSTSKIT-LAGAGVSFFLTSAENRKWYTGHAGIRGINKVNQLAHARYFGDRAVMRKHAASLAPKFNKVLEILDSR---TVPAGGYFISLDVVPG---TASRVAELAKEAGIALTGAGSSPENKNLRLAPSPVEELEVAMDGVATCVLLAAAE 422
72 -32.1002egy_A mol:protein length:397 Alpha-aminodipate aminotransferase  ali model follow..  18  1MKPLSWSEAFGKGAGRIQA----STIRELLKLTQRPGILSFAGGLPAPELFPAAARILREKGEVALQYSPTEGYPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKRERPRFLYIPSFQNPTGGLTPLPARKRLLQMVMEGLVVVEDDAYRELARLPSLFELAREAGYPGVIYLGSFSKVLS-PGLRVAFAVAHPEALQKLVQAKQGADLPMLNQMLVHELLKESERLERVRRVYREKAQAMLHALDRE---TRPKGGMFVWMELPK--GLSAEGLFRRALEENVAFVPGGPFGGENTLRLSYADREGIAEGVRRLGRALKGLLA. 395
73 -31.9003d6k_A mol:protein length:422 Putative aminotransferase  ali model follow..  15  2.NAMSLKDYDAARLAQVRE----EVTAKYAELKAKNLSLDLTRGK----PSAEQLDFRTKDGVDCRNYGGLLGIDIRELWAEALGLPADLVVAQDGSSLNIDSSRPWSAEEKVKWLCPVPGYDRHFTITEHFGFEMINVPMTDEGPDMGVVRELVKDPQVKGMWVPVFGNPTGVTFSEQTCRELAEMSTADFRIVWDNAYALHTLSDEIEFAQAAGNPNRFWFMSSTSKITH-AGSGVSFFASSKENIEWYASHANVRGINKLNQLAHAQFFGDKAHMLKHAASLAPKFERVLEILDSR---TSPTGGYFISVDVVPG---TASRVVELAKEAGIALTGAGSS--NENIRLAPSPVAELEVAMDGFATCVLMAALE 421
74 -31.0001wst_A mol:protein length:417 multiple substrate aminotransferase  ali model follow..  17  15.........FDSFFSEKAMLMKASEVRELLKLVETSDVISLAGGLPAPETFPIAVEVLEEHADKALQYGTTKGFPLRLALARWMEMSKVEIMTVAGSQQALDLIGRVFLNPGDPIVVEAPTYLAAIQAFKYYDPEFISIPLDDKGMRVDLLEEKLEEKRVKIVYVSTFQNPAGVTMSVDRRKKLLELANEDFLIVEDGPYSELRSGEPTPPIKHFDDYGRVIYLGTFSKILA-PGFRIGWVAAHPHLIRKMEIAKQSIDLNTFGQAIAWKYVENDEHIPKIIEFYKPRRDAMLEALEEY---TKPEGGMFVRVTLPEG--IDTKLMMERAVAKGVAYVPGEAFFVHNTMRLNFTPEETIREGVRRLAETIKEEMKR 414
75 -30.8001vp4_A mol:protein length:425 aminotransferase, putative  ali model follow..  17  11.........LEGKISKIGQNMKSSIIREILKFAADKDAISFGGGVPDPETFPIAKEIIEKEYHYTLQYSTTEGDVLKQQILKLLGLDEDNLIFTVGSQQALDLIGKLFLDDESYCVLDDPAYLGAINAFRQYLANFVVVPLEDDGMDLNVLERKLSEKQVKFIYVSNFHNPAGVTTSLEKRKALVEIAEKDLFIVEDDPYGALREGETVDPIFKIGGPERVVLLNTFSKVLA-PGLRIGMVAGSKEFIRKIVQAKQSADLPAITHRLAARYLERLEQLKPTIELYRRKRTVMLNALEEY---VKSEGGLFIWLTLPE--GFDTWEMFEYAKRKKVFYVPGRVFKVYPSMRLSFCPDEKIVEGIKRLREVVLEYGKE 415

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.